08^j<  ^jiCt t^j@@<@T 08^j<  ^jiCt t^j@@<@TU ^jt`A^j^j^j$h ^j^j^jA^j^j^jA.^j^j^jA^j^j^jA^j^j^jA^j^j^jA^j^j^jA^j^j^jA^j^j^jmD$"^j^j^j (08@HPX`hpxP$^j^j^jpxO$Q^j^j^jL$v^j^j^j (08@HPXM$s^j^j^j`hpxFA^j^j^jC^j^j^jA^j^j^jA^j^j^j!^j^j^j a^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^ja^j^j^ja^j^j^ja^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^ja^j^j^j a^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^j!^j^j^j4!^j^j^j!^j^j^j!^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j B!^j^j^j B!^j^j^j!^j^j^j"!^j^j^j"!^j^j^j"a^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^ja^j^j^ja^j^j^ja^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^ja^j^j^j a^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j!^j^j^j!^j^j^j!^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j!^j^j^j !^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j!^j^j^j!^j^j^j!^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j!^j^j^j !^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j !^j^j^j!^j^j^j !^j^j^j!^j^j^j!^j^j^j!^j^j^j?\!^j^j^j>\!^j^j^j=\!^j^j^j<\!^j^j^j;\!^j^j^j:\!^j^j^j9\!^j^j^j8\!^j^j^j?\!^j^j^j>\!^j^j^j=\!^j^j^j<\!^j^j^j;\!^j^j^j:\!^j^j^j9\!^j^j^j8\!^j^j^j:\!^j^j^j7\!^j^j^j6\!^j^j^j5\!^j^j^j4\!^j^j^j3\!^j^j^j2\!^j^j^j1\!^j^j^j0\!^j^j^j7\!^j^j^j6\!^j^j^j5\!^j^j^j4\!^j^j^j3\!^j^j^j2\!^j^j^j1\!^j^j^j0\!^j^j^j2\!^j^j^j/\!^j^j^j.\!^j^j^j-\!^j^j^j,\!^j^j^j+\!^j^j^j*\!^j^j^j)\!^j^j^j(\!^j^j^j/\!^j^j^j.\!^j^j^j-\!^j^j^j,\!^j^j^j+\!^j^j^j*\!^j^j^j)\!^j^j^j(\!^j^j^j*\!^j^j^j'\!^j^j^j&\!^j^j^j%\!^j^j^j$\!^j^j^j#\!^j^j^j"\!^j^j^j!\!^j^j^j \!^j^j^j'\!^j^j^j&\!^j^j^j%\!^j^j^j$\!^j^j^j#\!^j^j^j"\!^j^j^j!\!^j^j^j \!^j^j^j"\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j \!^j^j^j \!^j^j^j \!^j^j^j \!^j^j^j \!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j \!^j^j^j \!^j^j^j \!^j^j^j \!^j^j^j \!^j^j^j\!^j^j^j \!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j\!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j!^j^j^j!^j^j^j!^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j!^j^j^j !^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j !^j^j^j!^j^j^j !^j^j^j!^j^j^j!^j^j^j$!^j^j^j4!^j^j^j!^j^j^j!^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j !^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^j!^j^j^ja^j^j^ja^j^j^j!^j^j^j!^j^j^j!^j^j^ja^j^j^j a^j^j^ja^j^j^j a^j^j^ja^j^j^ja^j^j^ja^j^j^j?\a^j^j^j>\a^j^j^j=\a^j^j^j<\a^j^j^j;\a^j^j^j:\a^j^j^j9\a^j^j^j8\a^j^j^j?\a^j^j^j>\a^j^j^j=\a^j^j^j<\a^j^j^j;\a^j^j^j:\a^j^j^j9\a^j^j^j8\a^j^j^j:\a^j^j^j7\a^j^j^j6\a^j^j^j5\a^j^j^j4\a^j^j^j3\a^j^j^j2\a^j^j^j1\a^j^j^j0\a^j^j^j7\a^j^j^j6\a^j^j^j5\a^j^j^j4\a^j^j^j3\a^j^j^j2\a^j^j^j1\a^j^j^j0\a^j^j^j2\a^j^j^j/\a^j^j^j.\a^j^j^j-\a^j^j^j,\a^j^j^j+\a^j^j^j*\a^j^j^j)\a^j^j^j(\a^j^j^j/\a^j^j^j.\a^j^j^j-\a^j^j^j,\a^j^j^j+\a^j^j^j*\a^j^j^j)\a^j^j^j(\a^j^j^j*\a^j^j^j'\a^j^j^j&\a^j^j^j%\a^j^j^j$\a^j^j^j#\a^j^j^j"\a^j^j^j!\a^j^j^j \a^j^j^j'\a^j^j^j&\a^j^j^j%\a^j^j^j$\a^j^j^j#\a^j^j^j"\a^j^j^j!\a^j^j^j \a^j^j^j"\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j \a^j^j^j \a^j^j^j \a^j^j^j \a^j^j^j \a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j \a^j^j^j \a^j^j^j \a^j^j^j \a^j^j^j \a^j^j^j\a^j^j^j \a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\a^j^j^j\ !^j^j^ji!^j^j^j!^j^j^j!^j^j^j a^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^ja^j^j^ja^j^j^ja^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^j a^j^j^ja^j^j^j a^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^j!^j^j^j!^j^j^ja^j^j^ja^j^j^j!^j^j^j!^j^j^j!^j^j^j B!^j^j^j B!^j^j^j!^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^ja^j^j^j!^j^j^j!^j^j^ja^j^j^j a^j^j^ja^j^j^j a^j^j^ja^j^j^ja^j^j^j^j^j^jbpf!^j^j^j $ ^j^j^j]$^j^j^j$>^j^j^j $^j^j^j$s^j^j^j$^j^j^jA^j^j^jm ^j^j^j$^j^j^j $^j^j^jA^j^j^jA^j^j^jA^j^j^jA^j^j^jA^j^j^jA^j^j^jA^j^j^jA^j^j^jA^j^j^jA^j^j^j7Uf W+6LDk}7UlM0swEe?"ӚqaFB`֕I !tS?u CmP=َ7zc&` ^:| tzlb/ +QI> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4,"4 ((!(!ص!%%< LLص!%%NetBSD|LwGPaX NetBSDearmv5hf3D0D 0p@-O-`LL2@HRtHM$H000pWr ,hP@tH$H( R @Pp0: S 3`0SЍf@P0`0x= 0S(0S P0S S0p WP  0S;00 0 0pP s0s 8#8T >T@N#L  PpW&7&V?`&YH0`  BR` pR RX X/&P&@-8l0 __& 000/&pC-P0-` M؀ @S'{ A (M'`P40 A00{{z 6ЍpY@&&!&00@-@ M@  P  ЍH t1A-`0Vz P0 @P@TV PC  W@@7k0S@ @0;0P W 0XpkV pk0-S XdHp 8@0SV  W &_U&i5O-MpY xp v`P` Ѝ 'p` 0d`$5XP0S 5%0 0 5X0S40S* D$尠Dt00CS0 #@ Pp  @YT  `0 @00CS0X#0 X0 Kp004p  p@300 80: Sx h+p@ p Qt  X0 0 03$0000x, 00 Q00S(> 0 0 `Pp2 p  000Z H 1(# O 0P \\P 4 `+X"J 0R 0p0ZZ3r0S  P XY'  p00R0S ``p0S  0 >(h P <`V k` 0R?o20S 0  0 0R0P :` P hh2`0S L,` P0Rt00!7P &&u&&&&&&x&&&& &&&0@-MM@ P p  ;0U$C dP TTۍЍ08 P0 (0P X&&Q@-@ TP DD,P $ 0P@&&Q@-@ XP HH",P $ 0P@&&@-i0 &0$/'0$/ '@-a x@-\ @-W @-R d@-1  0) 0 Ѝ'@-1  0 0 Ѝ '@-1  0  0 Ѝ'@-1  0 0 Ѝ'@-0  0 0 Ѝ'@-0  000 Ѝ ''<00/@-0  00 Ѝ`'& '<00/@-0  00 Ѝ`'8' 0@- 00 $0P@IЍI&,0A-MA!q`!X0 p! R0B=0B  P40H 8 R8B 4!010,!0ЍPP =X0P   0S  0 pP0P      0 3/R ! 7000<040LKD0 '`'4'#= \ 'T(0p@-|@PtP00 R 0p800 p0  B0Sqs $'' '0 0 0 /' ' @-@- @-@-80@-M0@@(3/P $ H08 : S( 0h 3/ 0P  0 0Ѝ000  1/qp h0S 00m8@@-@fLPЍ@[ PЍp@-(`Vp80@ 0 3/PP8003/(Pp@-@P`P Q80 (0(3/@g PDgPЍp'3 PO-MP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 AM 000+ xpt| L  ЍO0 P % Hpp 81/qp4 -  ?P p 4 Ug0S4 tp0 0 0 0 "K0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0`004 8pX  FЍ'Q '2R/ R 0 0/\\CC B 0R0012/P/ A A A A  A A  A A A A A A A A PPA AC-MhB0 0  T0 0 8   ?$ Ÿ ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!d!!4! P ` !q4`4 " BXX P!d4^4 `4 " B   !d4K4_4 # B  d484_4 /0_8p<0@! J` @d44_4 Ѝ'Mbp' ?XkU@-@Rd/C- A `00P4 82#&PP0 (1/qp$ 밀pU Ѝ0S0C080$0( 3/P 0 `V`PED0  Y $  '`'&@-MPA P04 00#!8 0 (1/qp$ aP9 0080 0( 3/PЍ80 $0(3/PP`#U0:0080p0h( p3/p #U0* ,0P`/RP ` 'mXSP @- M0@ @  Ѝ('O-Mxx M0@S. 8S+ #=P(P0|.0S( 0| 0(0" ! !x00# #x|0 s& %mݍ Ѝ'|P 0 X0 S 0F0WS07  S  S $0S1 \7000000S<70 0,70 00 0@R^ R0r0C0C00Q0 0S- ,B< }6P`0 V  $ ( ,PU 00,0$0 000 0S $Y% 440 eb(0Sf0'  - 00   0 0,0S 0H 2 8P|Xʠ0 @@pW= ?W09*_ 0  ](^0$ ]`^0  ]p,00 0 00,00 $0 @<@( 0|@ p` ^W6) `(0 ?W  : 0吣$0c#`ᐅ{'00S/ ,0S#$`V %;#40S a\ /\ * ^0  p] 0N ^%;# |0 h>$0(0Z0`40L !(9#q0 !$!0f0%#^,00 0 00,0@0 $0 < ,0S 0p804< $`WPPe  07000#10_PdVp- ?V0)*^ 0  4\4^$0 \^0  \00(0004 ( 0 X]4 V2*40 ?V  :] 0V㐓$0吃# ?V  :]5!0 0 0@0 0<l('* 2a&VL7[B<'J7K"Hgcl&t@-pPPP@`D ^P Ѝ`3MU@p@-XP8@T`@D p ]P<opQ<Pp('A-AP 0$ P0 0 SQ ( $0ۭP bh d`P, R2DaDqU`0``000hPbj 00CS000 Q   0,`0CS0000 (00/U R cb;8 4hD 0$00 0$ '&''T0 S 0SP/P/S/@-'p@-XAXT0040S+@! PP P0P`04 PV R@40 0PPU4 ^*00" 0PE`PP 0P4  P U 4P0C SR40P 0P p''&''p@-@8P0 00@0@00000p''G-PP0 a0 ,(%p 0 R`GvQ@0S ( Pal (&?$00 0(0 Q0V0? 0"xaP8 4}@Ђ`Ɵ&' 0p@-?0 `0|@]VPPPZ 0P 00S/S` y8P|`p0pP X\P(@88Lp'' ''9SVYp@-@(P *8PP a\ 0TP}p`U(` 88` 0"p'o&w@-P4@(P 8P 8080'DD @-yP $000<0 P'&'@@-<pPG0`F [stlV000PX^4 0,J00C0Cf 00CS010:0PUP1 ` 00CS00 P U Rt0V00lP^n  00C0S"10 U00CS000 U0P 0@ n^F |s V 0  00 0 @00S 0S YI'''&''O-M` R0000200010S uܱ@q0`0#0P 00)<T0J?o20ST SRP 50S  RZ  @T  Z     0010S@@  0 10P00CS000 Ѝ S 0P  BR l  @0S Z0 0$''''''&'(A-P0`!S+P@]x 0LpP0!S 'P ]\P 0HH<00S0 |$0@:<&D['s'A-Php@`T0S PS]+$ X 6'&xO-`@ ؀0SP ĐĠİp0 T T R R u0p[P Ѝ PP P   P Pp@''''A-p0`!SP~P@\ 0a @ PP0!S wP \P 0HH<00S0 UpGP<&'sO-@bP00CS0 p0@g \z  0 `001 pTpP@0 pW2tQtTP0PP00MPw\O8 |, 00CS010 6 u0P0CS0000 S00 @ X 0000  X0 `0U0$0T p 0 &''&x'''''O-pLP0 SPEUP ЍE P C0 0X2b U000P[ g 00C0S 20  0 0CS0L200 ZZ 0 PPE C P 000S S 1 `V%0 V00P [x tp 00C00 0CS0@100 0ZX 0PFH0P 0 ZPF C V'P尀VP0PP00=P g[?t pll 00C0m0 P0CS0<00jl00`6x'''&''O-P@`p P`CT  0PSEP 0@^S00\P0S @\[  BKP @P+0P00&P&@-@T 00H0 P 0S( 0C00S 0C0 Ѝ'ht@&P0 R  QQP0R/@-9 'G-`PP@ X 0S@ @0S" @T@@DT qpP 0S  0 0 HPЍ'G-@P tp0SK`HPUP 0 @+PP @'X0000D@- 40aA R    0/&'40000 01h@- &'G-dRdr@`0 0S0"3(< 0?Y+Y# Y{00 R  % Z 1@sZ0"Sz @`` IQV^Y0^Y-Yj @ 0@^Y-Y00@R(Y0 01@s@Y0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 000;Y 00 V@ T0S'& x'@-0@00 00U0 P000 ,R;R 0S  S   0;SPp'P 0p@-PQS@@R0p`V0C P'p@-P@P KY#, (P$ p 00$&(Q 0Q\SA@- /`@-0S* 0@ 000S! P|"NpP RPP p@P 0 S@/R/    0  '6?8( Q 0@30/@-'00@- R 0C30V'A-ppQ1SPS a00S S @10`! S:`Fp00  1S p&Oa0S ʼ1`0 BRpE`  S`l  /P 0a0CS00   'F$&(^r'( Q 0@30/@-I'`01S @-@0!S @XPP /YEP /'F7@-A0 R!RUUʐ0\00P@U |xp00CS00+ 0 @ R,\ R P Ѝ00!S KP l0 Sڰ 0R0CS0000 0 Q  vP   '&$&(?A-O 0 P,0p W !GY\ϟYPPP0  nQ pQ lQ 0 S @ PP1S P PPP0 nR pR lR 00 S1S P P0PP[PP0 nR pR lR 00 S1S gP0 S00P0PP1S 2S 0Sڤ 000@ `PP 0 nR* pR# lR$ 00 S}1Pq PPPೀ0S!S < >0S 1Sm `P0PPPbL ,0100,0Z0S000@ PN 0!SPH :P00 nR pR lR 00 S*0S ( > gk0PP1S PP"G@oG`GoobPVWP 1019P P00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  HP0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PPPP0 nR pR lR 00 Sx1Sn P k{P0PP PP` 0 nR pR lR 00 STY]P0PP PR0nQ pQ lQ 00 S 5 PP? = 0  P1p PP,0S `Vn0VkVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  d P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S 602P0 PP R l B R0" 0 S1S 2SqW P0000@ 0S0 0`PPz 0 nR- pR& lR' 00 S^1ST1S0!S  <0S1S d PSS 0S0O 1MP0PPP` gRF  R 0 B RQ@ `咹@p>Q0"S:b(pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 (P00PP2P02 ZP P 0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& @PP0 nR' pR lR! 00 S1S" P20 2 2020P0PP P pIPP0SR `V0V pվʈ0 nR pR lR 00 SX1SN^P0PP RPӮ nQ pQ lQ 0 S:8P0 PP&',r$& &'$&"7X-dK''6~x'&QP000P0P@u Z`P 00 00 P0 nR, pR% lR& 00 S1S0!S  ^;0S1Sz aWWv 0 =P0S0P0PP1S 2SqXP R! l B R0"0 S07PP0010CSP bP@p O0"S4mPP00 nR pR lR 00 Sy|2 00S <PPPP0  nQ pQ lQ 0 S[0S $dPP0S0PPX0 nR pR lR 00 S<P }g2SA P0PP P0 -@-0 0q ЍЍ/''-0^S0]S0]S S]S[S .0L0S>30  Q  ]Q RG-`ጁP@0 SS&tPD(!RGdadqU`0``0,0P,2O ( $7 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a MP0  0@S  0Gx'''v&z'F_'!p@-0 P= P@01SE0p0 SS t`P@0P 00S0PP0 00P h0T 0X0QP0Nw0 ,(x'''''v&zO-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00P? 0A0CS0l10G0 P \QH 0 SP 010S mP/ 000S S)00 S [ U 000ܻ PNݾ t00CS0L00 0`00 p<P Px'('''''&&A-0P0 0p@ W 0 `@P 0 R00R00 1BQM@X @嶵@pM0"S,"@gR000x'('O-ScpгM@00 0GS TcsT`0``00TP~MV` \X00C0+0&SK BR D R: Y J@p R(PQM) V00C0S @Ѝh20   K  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WpBp@| \  Ϻ P LϽD @<f00C0 AQ 0 T0 Tpppp  坺Pu p BR   @W0 `0CS0(00oq0  b('''&O-M 0@P0P0s <40S  0 0000 (0 :pP ߍ0`CԳ0#2P 00 S pSN(0Y01ڐ Y   $ 0$PYL1T P^L  BR +430 # W  BR 200S 00 c +K 0 0(PP.000YX Y   $ $P  BR 200S 0 - J P0 (0 P'0 p1pG Y;xxZ 娹D1PK娼0 ,(?00CS0uX   R   lP> 00CS000^`W 004 00S |xP00S 0  J8 JX '(''&'O-㴡A0QM0Cp` 01 00C S00`NlЍ' 0 P5 P!` 00000`P00CS000  E[  0S00CS0x00` P  P''''(''O-M R B000bsp 0shЍؑ؁0S1  0000 P@  0#੟ɐ Y Fp10S Q0000000p0CS0C01;  \" \    " L\ B   @      0C LN ' &'<'''''A- `P 0 0Cs 0x 0t0 l  C A^  00@pT @ 0<'' &'G-p@P0 `R0  P(S%0  d P 0 ,&(Ǹ<'+&/@-I0 O&O-GMeM0PS@p$Q403/P ɰ0: SI00W +4 P8:I?0P0: S 0SP0: S 0S 0S 0/S&P700poDP- dP #0v PvO+40P ]H#P]~P U/~H/PxHP D0P+I [(H Z% U8..0 0WPT9..0 0KP @DP ^ PT1RP  oR00S$ 0SS 0: SOwPN 6  0#HG=00 04K HG=00J0SP. Tq:XGH X 00CS0 Zp Pp  pYW rX0 X p00CS0B0 0S P0SGݍЍ0?o25c 00 08H'| 7 +P&^&k&y\\C0\\CX X0p@-@P@@DDT ` U H H0Rp@\\CppX 0Xp@-@P@@DDT ` U HH Q\p@\CppX X0p@-0P0@44T ` U 8 80Rp@\\CppX 0Xp@-0P0@44T ` U 88 Q\p@\nCppX X0p@-PPP@TTT ` U X X0Rp@\\TCppX 0Xp@-PPP@TTT ` U XX Q\p@\9CppX0X @-ppt t0\@ ^0@\\$CX 0X@-pptt \@ ^ \@\C5S %R R S R SSh -^L^S R 0/0/0000p'O-QMTh u@ 0 `0 0L0 @@@@@ @@D@H@,@0@<@@@4@8@5 SS$a\ ߑ0 !00`V0S9 0 00L0刐St 40D0800$0S00( ,00B?@$p[p A,0S d @?C0000D00H04$0pCp@0$Cp:p@$0S00<00@00#p*p@,0S  @?CZ㸰张 0|#pp@ 0`#p p@0 \ 0C0CQ0B003/040 0S 墵YT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " & P 4 04080080 0Sb Q> 0! XX0$0Q: 0x! dd0(0$@@[(;@ R 0  P 4P0@-@0S00P00P00ҲPP4\0.S0S 0!{'0P$0 0P(0 $ ( R P0ڶP000Ѝp'VUUUG-@a!80S -PP F0rpW Gu.<0SB|.@P F@i. F@ F0S5!0CS0\U$ ϶  M00L0S \0.S0S /@0S40S t:/#Y<0?o20S X (&040p''"G-`㳵9DP0L0  P0S$00D0H0먔pPP00$Zp[|4T H0 `F0P 0 \:P c84X0 s0X00 00dt |  P PRPS Wc( ?R004(0x |0R S S S3 L0S3 T0Sx3 0Sl3Pd#Q`30VP 00Ѝ10@GS0L00P0 00H00P0L0 0T0X0s0X0 00P0L0T0H0~0 00P0L0T0H00X0t0P00L00T00P0L0 00\00`0c0`00\0^0d0[PPX0<0U080 PP0 D0h l0J0D0h0000000>;(00p$080p$0,p30$00,0.000@0(0 0%0p0"0t00D00h00x00|00000000 0D0@PwD 00@`0S0\0S00S S S0 /0`0St0\0Sh0h00p'ht@(&n&'ؕx̴,&1&$P̕d80p@-P@T @@\p'80p@-P@T @@\p'L0-SMM\0 *+ p!D 0%ލЍ 00 >04@pll0l 0 0  L00S   V&'''$0\ 0S D A'0L0S/0 0 0/0@-M0S   4 @  ;$@pЍX0T0P@ CH0@ B ?0( 0Ѝ@|'''''P `00CS`0p S00 P0S X0X /X &: S@-  S  S/ I* S  S%|@=1A-`@XPTM !\@T10S H10S. 004q 00p'p *@0 0 0) 0@0S00S 0: S@Ѝ0pp 0GRp0x |B?< 0pH00S x''''''''''s@- @P@P `SU00S @JT FЍp0t  Q \0 \@0U +P@'U''p@-P@Tp0 0C0  $D @C-@4M㈩$3 30S`sV4Ѝ0 0C0{ 0XPS !$0S 20Sm 4 㠒;$p|4 *|0( PD20S 00  20S  0 : SK( "0 08"$410S10S61!0 0H 10Sx10S : S0: S x`x41萟 0IR 1 B?; 0 `'Q ㌐@p| , *LLN\,C|00S ''x''''!'(.'''''''''1O-@0S$0010S 10S,0001!0 q0P0S ЍOPa0HQ b0P  0e0`SzpvtQPPU% Ѝ  B 1`0    0S[  L0  $R,   V x'''''(&8&'410G-S$0@010S 10S,0000 0 0PG0`VGc렠pPUG s0 0C0 W jp0$S,  `YpP Z`x'''''(&0G-P@0T$@0@S 00S,000@0`0娀S㨐@pVG 30 0C0 W ,*p0 00 S !p0$S,  Lp` x''''(&@- M @ ߯p ЍT P 0@  QQ 80 0T FP S  P&0p@-P0S``(:@P ;PX ,Aɬ@P8$ #P p'<QNC-CM@: 萟P`? >`T *F0 ppPPCߍw ? @P>w0S ?@'P?oP@D&@-? `& 000/'@-?0 &@- M~P<1[ 堥P ᙥ0 ˯S , !00  A (! 0  A{{zp|sF00@0 wP 8ap ltP ~>0S TX0;X0XhP IcP g>0-S <PXVpPl0S  <RpY@'pz&&n '5IVs@-@ `PPU"0P U (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hЍpU \@0 GP4{x@<&G-~MAM0SP `E0p 0E~P=d!&0`~܍Ѝ~,aP = !0 0E~P= ~,I`Pʳ= ~,@PE0p 0E~PYp  Q `/04 0EP=>( /<&mCl00CS0 0 /G-`XDHMp DTD$0@t000000 00 $0S0V"4`0p Q 30Sa3PZ\PZ9=0#/000 0K#P%=h#0n/V 00D30p Q  #P0 0="0O/V0020"P<"0:/2000HЍp(0: S T. S+@ P00S`0:0 03V-V)Vq 1X  ?56 3 0~\P F ;0L S0 00 0f2qp<0S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U 5 XPV P 0<&(''&H&\(H'P&Y&0m8@((h&}D00S/@-~M0@0S~, P~܍('<&@-0p@$0l00S Ѝ00 010Q <, ].P<&('aL0@- R<-P 0 0 -('D((A-pP@` uP@DTP`VA-pP@` DP@DTP`Vp@-P@Tڬ` 0QJ@Pڄ0  Q @;;S p:@P00T@ ;(0, -( -<&('(s@-R@T` Va0@$00 ?00S 0CS3P3s;0 S9f-00@ЍpPڀ;;S" 00 0"10Q P?P00@00" K;0S @@E;0ES TT 0$0:;0S5;0S 1;0S -;0S $0STڄ00Q Qd-T( L -;(04 W-$<&('3](`1 RS@-MLQ R @!  BR0,ЍQ   RR  RQ     P000S,@  00T0pSp 0Lx0Qo 0,4p T0m0Q/('<&&mL|G-PP`0  ,p@P"ڰAQ"K0Q 0P P 0:0Qp:@ ,ЍP P<&('@-`xAMPh1P0S2 S VPLDB,00ЍV0Ap0p 00Q8: , P0S(0S 0/Q#": ) Pڐ0V 0?3 l0 ` 0+P: 0@ N,00<&('<a(lmO-M 4M S0`RX0E@FPˠ0 0S ̢000 Sr '0S    G00 0B30  0" #T~4"#> D܍4ЍT 2 R - 1[ 0#`#D3# 0S1圁  03p 0  | 0 #vT>4!D #>,1$a0 00$0010p(0 C0尐Z  T0,0( ,0$ 2$ 0  A 00 0# p6#2# 㣽T&&('((D(''(<&C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S 1 * 0S pP (0: S0 0 p10S10S Pw函P 0 0 0S q4a 1 *00 0S00p0000 S(00(000 P@0S '000S x03P 0+P0p02 0Xh*<&'('(p(((D(VH'&((((C-M M` Pi8H#*G ޼P]8#*SC$0`SH 0`E0S2*pt3Pu o3Pp 0 m S( 1**2r0t0CS G)|)p)5)])\)PLG3P0000$2)2 `ލ Ѝ)&0S  R  sS SS YSP )yS)Dq儁)3)P)P@3P00000S,)( )0S0 2P g10P)@PP YP0000)P0Wf)$(<&('ܐ(D(P&H&-& ](Mm _ 00@-@DpOp`&O-L|q| \0S(P1`XX@P"@U(,L0 R1V10S :)@DT  AN0d#0UPTP#)PV0S t)`@`ꓢ"H 2/L0P ! 咣#, 05|&p&'&'(G-@ㄑ0p`FP@cU PppWP<(PЍPT10S (Pp@ 0$03/0 PP" R T  A@P 80 3/PtPPTT00S\ X(R <003/P 202ꤐ('$&Jm''@-AMMP/5@P+ p`p*P/00P Up0p (AލЍT0_"1/0P0 0, 00`(''00CS0 ֿ0 /O-0S$M00`Y P$ЍP0,03/P00T30S ,@C@s2PPPP 0030SY PV |20S Q P P x4 CSR qP8 ," oP57"( H0/S6Ps/ AX m 10S  P0S !S 0l!202;/P K , 81  0S a0S 11004 `]0D0 3/`( 0S 0S 0VP0x0CP0%P!P0403/Oꤐ(('(($(( (`''P(('((@-<@P:5( '.'z@-޺p @@%5 o'@-@᛺p5 0a'@p@-MPp@50S  0C05 `p 0: S@S NS Ѝp4`C-M~pЍa0H03/P0 03/P㼛tA]pP@ 0AS0 @0a3/PE0 0P)3P/P 9P0/SPP. A00 006@ 4t &0(03/\ g\0 Pꤐ('''P&&$(O-MpЍe0H03/P0 03/PsP>D50S 05>P K4%&50SuJGBP 0(03/ 㵸 P 0AS0 @0a3/P|4C003cP H4 CP(40S  P T 0 0  P 0R S = $ `0Sd003p0St00PhP pS`3`0Sd00/S7Pt-, A S0 0  ¹P0SW 0S = $ `0Sd002p0St000S "SD p 0 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P |1 H^ X RP$PP ,1P%0 P Ez @ ;/0S0S P0S 000[\000*4S 0S 0ꤐ(`(&( ($((('((p('`('h(d(((L(&(G- R@p T T 0 $@H03/P0 03/P0SB0 X Pqa0 09p1MP \P: 0 P0(03/P@!!P0 0 @0S 0 00OP@&  oP0 0医t0 0S T0P \0 CX TPꤐ(((p('((D$(D((T0@-0S^PP 00H03/P@ꈐ((O-M MT崐0$ 0G P`(HA-M`P@pP5(10S Ѝ 0RP  0RP 0: S%P P* 0᭰PW ᅯP * P W$ 0@ꔐ(Y2w:(40@-: SM@=0P - \ 00[ P0 ူp 0: S0 cЍ000 t:P/  0 fA-`QFZDT@PF*H!081P @$<s1P0SP+(0 0 0 =  "4S `P*` 0] 弘t 040Ѝ(tS|(tHP! 00 0X(\(&&(O-Z#3(tQJM0 M`p @ 4#0CS0t3t$P d30S үP0: S X P )Z Z30S "0 q"5pS)"0 X 2P @$<댂P RPn( 4`S42T$P PuၯPar)" 00 + ~0S10Sa 4m0C?o2 000! "2SJ>0@@z=0 CᘮzD 0Jލ Ѝ  r p G@$<pm ?4S(40R(4 \ \0Q0]0S0(4 00P 00D(x(`(HX(\(&mr&G/O-Mp@ 0W0DN 00S8 00<0 WPP0C080pG0S `0S * 0R 8 00 x x.  P8 (@0 X2@ ?@lQ*(@0 0嘠P eP` lЍXX   ` `@((((Rs@-Ѝp@ 0@`P)Q_(< 0$ ɬPQ( 0(0@-@MPP00<00S =  J"Ѝ0(G-`QM MJP Y@ #p ᱬP p 00PP=! SR J(ݍ Ѝ!PJ'8 F= $HL0Q\ J(L00 0QJ'8 PTA-QP ,000p@T+`00CS0!pT0 0S0T@ 0S@ 0  h P 0S@ @@T S P (&& ((0 0 S@-0@0R00000S0@000S `ГP Pcp 40Px(|((l( C(p@-PP 0SEp `᧓@P`  @P0/S000000f PR @@@pr(h0 RX R  H R/< R/ $R/Q/ ((t((`0@-0S L0@0T R S( 0@((&G-@b- 0(MS 0SzB)(Ѝ0 0p5"0C S70|20S X00 00!P 0 000! " \PPp  0!$$! 0!ꓭ  X%(4 : S=  S7  S$  S03 0\! 0H! J ,1,!P7 S  S/  S04=! 0400S -Ё ;ЂЃ"040+0 4ѪP>&0d 00  00  X(9(; D(iOp@-8M@  ᲩD 0`P` 0U` @%P8Ѝpnx|1C-lM0@S` lЍCZ`(="(<p@<Wpp P00 0000084ޮ40CSH$0"60"$Ю 0( ˮ4 CR+p ®lЍB>'"ṮS+0  p(@-=XM"@r:(⦖0 ZXЍ7@-@Pp P Q Ѝ00  N Ѝ0@N0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq(0C\0S*/ \ 0W!0C0 0C S*CS*/ P@-*0S@L0 ? SR@C:@  ^:R \000C R00 S00 C@ T \A C@T2  0a0C R"  0C\0S*/ \ 02W"!0C0 0C S*CS*80P @-  ~//ᄐ(A-@,,PQ U?-QQpW `:WP 0Y?`S AlA 0:S@0 R   0`X-@(&&/Ss@- `*0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&0!SP@P0PA- 0S`P⸀p $0P T  @R p00T0p0S ,=@P00PPN0H(Dms@-@`P0l C300PЍp@00S S@@PP$0  @D z"00H(@-Lz먾&0 Rr @-/&@-<@<L0b}L yLuL\0&G-pt 2:h@\P*p`7#4 0Z/00 `P R O-lM/)"_oP9h@P= /000?`GPp` PP@t?t/  @p\?X?A0sR  S  R4/4?0, CR 0K?zP<N>P ,`>@>0 -R.Q0 000t> l>l. d>`>\>>0SHp/8> 0> > 0S>   .00.0-0==P}===|=-=   H-  g= 0@T p8PP\Zy,  0!-1  @L< -=@=<P? <;<,<,<,t<,h<,\<,||Pb2P]E2 E 2 D xUl3 3`2C<2PAC 2P:Bd2 B 2 A 2 A 2 ` 42$21 11p\1+S0020" R00p2lXR0 B+S00L2 C <0}&i0d0T?o0c00CS0 ڨ0 SSt@b0[_ P000SS000[`p]D(o T(ܐ(0p& &&(&P&8X-(s l&<'x(@' (l(& X(H(\(&((( |(D (p(&&&&&&@(&(p&( L(l q  N % ( &U | V &nlj&.(($& ((' (  ( 3'h(d( G 0.H(l&0K {pdmPW0000 SX0 0P  /H(d0P/X0X0 @-P808P'  墧3H((D(o *&A-` @?\, \PA *\.  Q R( [\SPQU  !\@@]^.!Lo \0QS8 /0S 0R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W UU @U 蜐(p@-@@0/SN00N Pd pPQP`Q*C0CTA"30L0AS*pS 1p@-MPMUP/P 0P0SۍЍp.S@T|`l @ @D(%X  .O-cM M 33 "p@3]PW10 `00S  g 0 9Pa 0`+QRV~   @+  T* R`DV;  Zcݍ Ѝ&R* \R%1@\ 0@R R P BR00CR A 0@&P\P   (  BP+T- R* ` V$p0!#MS@ 0 8TS 8TS p 0i 0 x@T *0S0T00  R S ( 0 }( Y&sC-`PMM RP  \SP R P0S ۍЍ@P p ĖP ;㗙P0 P  0SD\S R PPoP 0gS PS" SS GS "0| 0pS sS0S080 R @@@G(A-PP 0Sp=`pឈ@PL P40 pR `@ @ @l(L0@-@0T  S$ 0@(&T1 RP p@-ZDT 4\p \Q Q 0T* ᘊ04P  0S/  00p0S/  `00| @0/S000 0D0 R  /(((A-0j40@TPp 00S0o`0 00/S @Tt0T0oP0 SD jp04(((2A-@0PS' 0`.S0.S0S/S \}`P 0 Q CR S.R  S.R0S/S < 10S510S ;P:4 CSR ! Q0S 0/S0S.00 ` +00C00S0<0 `V">_ Y P:4Co S Q  S  FP  ! C 0C0T T0A0 B!"00&_A-@QpW :A;긐( X0A-@T`D'L@PU pP(&UV踐(@-@0SPpZ `0`@\ \L0pR08  G踐(G<(8( &@-<@ 0S (㱄P ) 踐(<@-<@0S (㜄P 踐(=p  @-o`O-Ma0Sn [0p 0040 S W00p p 0 0@P 0+ @ TY    L  @PJ 0 [Y00W00S 2P; 0 " 00 RQ' 0S0 W0P QP MP `0 P 000 ` ` "04Ѝ0 긐(@-<@0S (Pq踐(=C-M``0S PPp0@T " !@(@PUЍ踐(O-`0- MXHL$  p{PZ 0 Q PQP (0S0㒂@P P p `(A Ѝτ ЍO긐(=GA-0@T `pP@1AT  RQ( QP (0@ 00垄ᜄ踐(=/@-`0M0MSPp 0/S PP ۍЍ(*@P x T ۍЍ@nᢻP 00$$`!#!0 00  @X({(A-P`@p娀TЍ000S$0S 0 0 0 00! !g<00S -+@긐(\(&&&@-0@P@@0@ A R\ 1  S:0 ЍP`^P ppG-Mⴑ@TY `!PApT 0S @T ㍁@PP T00 0 QC DP5]"` 0! A*00! !QP  Rލ P    P] $0 P  0D .Ꮓ( $긐(G&21G- pWP `LY @ @P ᜺P` ᖺPAYWt@T P`P EyP$踐(Td0A- @T`pH PATP ~@긐(Qq@-0C\N \ @N@N@N\*0000L000\:0L0 S  0 - R 0R$R:/0AA-M M RX!0Tq`0 . ^ 00B0/S$ ! 0  -P0ڍЍ@*Q.P ?Q0C PP\P0PC0@0C0  0 P d X 0ڛ P 8 ( 0Λ & p@-`0Se\p@ 1e #@ P_000p 0 h00S  /ؐ(l0-0^0 SQ 0QPؐ( Q#p@-P0Sp p d0P r   H[ @Tp /1&7p@-`@PpPt@PtnP d0 0L0 C4+p00CS(0 0  &nx~ؐ(M-`PpЍ@":J0840K0CS 2  `>0 01  5  d } (l| <tw @|qp  i=/ 0$  4 =C@2Q! 1Q) ($5Q/^)0)40($84K ARKQ  $ q++   @04(4 :(40/S0004084(49)($ q++@k$( (C-Z4$#0CEM@S$030S`` EߍJ(\J(J(J(D ; 00$0$0<0 0 0ݍЍp$  ؐ(p@-@' PP hp@D@-p0-S0S( P@P#[3 0M0` Sh0 BPgPP00T Ѝ@`K+F&-@-0@P   ۫Ѝ@Ѝ/(p@-@ATp@0 R PyXP ` `AP`p(-P@-000  x0x 0 0 h@0S \ X00L0L < ,囫$ X Ѝ@ Ѝ/4(p(((&D(gp@-xm@PlhPP \P pq000S   plu(w( -P7@-000  0 0 @0 P0S | X00l0l h埖 XETf~D 8哖0 sX Ѝ0@Ѝ/4(p(((P&D(g&@-U  }}&0@-MMt@P@Mߍ00/SRPx|RP Up TPp  0RP 0RP  000/(@-  ::&C-`q$M@T  t0p*hAPD00CS0>u@ Pp< @Y@DOoB0S@$Ѝ0P: S ~P 0S ~ pW HW0圀 SH@ 8 0 C@AT0 @00CS0,,0 (& &O-PQAM t2@ l2 00pD4< 0@ Ѝ/R#RR@ :BQ&@ B&Q@0=S 0 "?R|R& ~RR ^R X!000P00@=S? >S 00@<S =S 00@|S0 0@&S0 0@=S0   +R0'  -R0( )%#$0 (}E(m!(ܑ(!@!F!0 @-ؑ(!0s@-P0`0wX0`0S@ P 0R@P@+   2P@# 0S00S  0ST P000 R  Ѝpؑ((x &""}E%"@-AL ^`X sr^0 \b ]1#P? L 0l0̠?00à cΌ SQŒQQP0R0R0P0QPQP !!I"U"f"O-p`p됰0%SP@y0V0&S T4m! i000 @ P@P@ؑ(s"0@-4M!@p PT` 0 P@4Ѝ0@P S=WP@V P@ 0 F?P@( P@9 UVؑ("p@-@P0)Spؑ(O-@,,Mp`TP TS T( T) #T! @$TO "T 0#S@P  +,Ѝ'0DSYA `@V@@P'0ISV'Y00`0`  HϏ U! z!P 0 @@! 0 @PV`'T@@`4 @P @ᛏ ؑ(""""O-M8Pp`t! @p0 X@0DS '00^* PU@  0 c 0DS00Y Ѝ` pUU ؑ(!C-pᐐ`  0BS0p0@SP&! "000 P@@P@@ Ѝؑ(G-`d0SP@! p000 PP@ؑ(@-M@`P1PL-0P  IR NRpp PpEp@@0SP@ $1Ѝؑ("PG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 PJ2H2Sp0@D1PH0@P 0,uQ@12"t &l &(("@P/- 0/SSS00(0@-@PMMMߍ00/S` fp ap  0RP 0RP"p@-`\0@P 0D0p@11;0"SP Vp4 wz("p@-T` RpH0@Q 8 *PP 0pp@(& #G-pWR 0S)P tB000000000CS020S @T  Tt T\UHbH0kv42@000/Sp=FpPJ0S0/p0CS0pppW00_1000pA0P00 `t00H0 lSd S00CS0<10S 00CS00W00 pR0S/S0@D00&1@P  R*0000t/S0S P 0/0CS0 pG0S 00CS0000@0@0@(((# #(t &l &#"A-p`@000弊P 00CS000S W00CS0Pd00S H%@ HW 406 R0S 0O((#x &(B#2G-MC7r0@TFT@P 0.S00.S000/SS?X20PpTePZ( ,`V IPP x` uh/ E`0ELuf@u0-S0Sp1@T@hSP{/ᙊPw 0S p=1/P  `P [u 0: S W &p/PXP pW _0S [p.PЍx &F# (I#N#m3([#g###@-$0Q @ \R@( ##p@-L@u60P000S LTPP 0Se@@dN 101N00CS00 jN 0 LN0pt<# (#(#!& $G-PhR@ @1`0V1 @ P ,P  `I\TQp @p0T \0DQjSh00@ p0BP!0 BS@p@00CS00 N 0@0 @T0S 00CS00 M 0 0SZ00CS00 M 0 M 1 0l1@ @ @ @ @ @pp\@@!&/$2$$5$A-@ ` PR 0R 0S SMp0S0 R N0S  MU  MTMs xM Td@00CS00 kM 0 ALMp!&(X(D$!&I$L$!& 0@-P2 0F(40@-@Q N(@-x0@T   @@@@ @F@00S 4060S NЍ((x &-$0@- R    `(-@-  0@-`(-@@-00 H@-P@` =-@@-  3@-@--@-00n " ЍЍ/p@-P@b p@-@-   ЍЍ/ L 0P< < @-4M,P / P$@%(0/((p@-@ᵇPPPP Άp` ҆`P †p` Ɔ`p7@-PR40@T t0 6 N s1d0@T PBNP0 0 @ 0iO@PC Ѝ0 (&x &((X(B @-`p@PU' <0P&{ `Fkk&Zg{[[̉06S 00S\  Ѝm @0t0S0T.S N@((&&0    /((s@-@` PTЍp0P0CS0 +000 P !0 M5@ 00 }&0@-MP @T 0 @@qp +P   0L@@qp @0 VЍ0 @o @(( &&&@-@P 0S0S 4P 000  ЍX(0G-`S q0P00#p@T0SP'@D1$@00CS0$10S 1Ѝ00S p Uᨅq<  R )P00CS00S UnB0S凅fBU}Pz@F#(((('G-@P,M^P` U+릐 s)2Q0U2$PP20S I0S 2$PPPU J ^0S|2 0S@+T ^0S<"$0 0 +^0S2 R$0S0S G@ P0S F0S F^0Sd1 R$ R @T$@0S F 0S F 0S F 0S F  0 $ V $0?o2$0Mx0$ R  0S F 8J4JJ Ѝx &x(&((('p!&O-M@Pp*0 뤀夠夰`Q@P@ *Vx0$`W T ^0S W P  0`S*Ѝ(\!&x &((P8PG-P* @0䀟0 `0 0R0Cp0W S `Sp00 0 P-+++S p0@'*PD0(00$+0 $ 0$/t &l &(((A-P@耟0p0`0^0S 0S S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R Ss 0$`S S((x &G- M䑟A^`PV $`*pWT0尡p0p00WZ 0S- |1|a3IlI I00CS00 _I 0= J00CS00 MI 0 /I  L^ $`R 0S S00CS0 p ^ 0S pS00CS0 0$`0C0 ) Ѝx &(((0(!&)'C-$M@쀟 p) 0 0`5@T+ 0S0 PU@ 000P x0 0 SP00U$0 @ R^PU $0)$ЍP0(((x &G-@,Pp0ESo᪢' 0S$ 1a1$3IIY. IUI00CS00 H 0 H|aU000  'PD U@q C 0$0  C DP| P00CS000S (A900CS000S U0S0SH0H02HPH(0G-HUp#$x &0(!&(.'B'Q'((((U'420@-IM000000 20S 00S 1Q12rHpH0@TjH1GPP& |1 1@>0S @T H1 "C@IH8GH1G0S 1 $ Iߍ0A 0 000 0DAP00CS0 0@ 0 00x0 >00CS0 0S HlHD0GX00S j@00S d (x &0(!&(.'f'(m'(((w'(0@-$M0000 00P^0oS@@T4`p (000p[ @&P 00S (封>7威000 @0CS0(00S  ($Ѝx &('(?C-@0uM00@H0?_00?0P@0,@ '0o000@@`pPdpTd0po@0hP 0lP@T 00b0Pl 00$0`0S$J'`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T@ xPP H0]7S 'x0RF D>0SG00SS (.00000,(00 0p(0%p  =&0S67S300S 0 0S+00000= 8  ⶀL= , p@ P (=P ,`,P奀(=0 lL=8 V  ,( %P000<<0S 1U0 0P@;/P  @<$ 0 $ D 0F4<4|<0FhP@ =U`Pk pUI0k PUY00CS00 -F 0 ;F4T 00CS00 F 0@`P 00\G00CS00 E 0@IG @PT 00CS00 E 0p3G @P  APP @07L:0P@ @PPHP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP   7S 0C8#8S0)SS A708#8SAP0 Q A!QD8 R 0 00 Q0 -PP -P R 0S0(0(00(00S 48  @  (00(00@07004070<00L"P7 p7H 00R0( >$0SP0070GQhpI 0\'000 000H7 @'008'00(0,7$ 10103/$60 JF6& 6& DL0S J68 `6  @ Rc 4 0  ^ $hDo(6 @, ~ &00CS0 :kP60S ⮒P 60S%,0zS55$5 h0 }K\5,( ,0P0000",( 0" E0$0(0S, $4 50S >4,0S p~t;$040S ,0 @0 @PDT= 00<0$0 0C0 000D00048d \XLP00CS030S &P( 40S)T0SX7PJ38 T3 P3 3\ T30 )ß00;3 0 0S '|0R"C"0 0 $3 BhJ00S0O0p"0C0000OIT28 (2 $2 2\  )pŸ0020 T0S!00CS0 1 R   01D0Sj$uߍ:10S a0!SSuT1 08 L0H@Ik|10@0@0S0  @0ST1 0$ @0S 0 @0s0 R#0S0   B  @0S @0S7S@<-D0 H00S F:X((((((x &x(('( ((0(!&'0!& ((P-&!&p!&!&'(`(!(( '|((B '@,0S0 <,0Sh@ DH0 H ,000ghF@T(0S p00tJ} ,0 0u,rD)FF0/((0 /(( 0/4(0/4( 0  /((P@-@i'P@<0 QP cR   '(( 0S0/((00@-/0M0@0}P B~P 0: Sp  Sd PЍ0-~P0 : S# PPX('''p@-Px@x`M$PV*00S "0`000``0!`!#$Ѝp(( (@-Pd@$0&0 RP   BQ   ((//C-LM*8w8 p(0@<P@ `D8G `0 BLЍ&!&A-@P`P|pWU L(4" 00'p(X(O-pWA R``%` P0S:S S(EĐ@ @0S(W@  @j0T/S/00gt00 R00P R:R:RPPP@DO!"l &t &\(@@-PM/p l먐PK  0 -@ T9'}p0 @~0!0P 0npWZ0S 0 bT 0S 0S 0 S|p @! h`P T T T0@@T >0DS\(T( 1A-@MP`Rk01000  ;p!XZU pA}A Q XxATvAQDA 08AS 00CS00 A 0* 00CS00 @ 0 ЍQ FAeAU P000 L 00CS0T00S D,A*A84/(X([(s(|((!&((((((p@-P@@Pp 0S%SpwP @Lp@-P8@Pp 0RfPp@JL0L-  R0S P P\ 0 &d(G-`@嘀0唐0P0|Up00CS0h00SG(0S0 S 0S00dPPp(d( &(0A-p0@0`P Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S D$P`0W:SP0R@X(' &(A-`P倀000|Vp00CS0T00SA0Sp00L=d@T`(d((0A-PSp R+u`a@T"W p0000 @0 0 e00CS0H00S y`zP `@\(((p@-P$@Pp0@P0J@-L@000@00 c00CS000S@E(\((O-PM/`@ 0IP @@@k ( {P00š0 0S 0S 000V#   P@ :P @cPM R RA R 0S   0  003 0 03 Z0 R"00в0  *pP7Z { 2 @Z 0}?00Ѝ H" R," R8pP B0000S R pbYQ  0X/R0XZp [#P pP tQ#P\ R X R T(OzP0 * R; R 60@@D P R  yP@0000S R   BR 9D R5 53 PX(( &\(!&((((t &((O-`$MPp `x6&t2@P, 0S*[ P0 00 P0p0Rp`#0`2|P& ZQ>01 >@$Ѝb@DT@ P  p R  U 01W VYXU' [10 0al 0aS v00@0S v P 2?W 00SY0 0 S0 P 0< S0X(3( (d(H(!&(X( &L(p@-P|`0000S S@I000 00 00000CS0p00Spp@N((0@-Mt@ 0P0000X0>00XI 00CS0$00S Ѝ0@-Ѝ0(x &(@-yP 0SoIO-`MpP@d/%P0cS @@ <+pPp vPP VP@  RNcS @ :0S2UA ̲P0>PF UBu= P9 n=@=T( 00S$ dB00CS00 < 0 UN= 0RPU E?=0@ T  Ѝ4=@W P` 1000 `@`P1V>0/PW1   [ZU<wPU<U~*c=U Ut Uh UX<2)6)H) (1))8)))!&))X(P()))) *'*O-M,B,Rp0 @0`V% VV:V  V /V   BR <` F R  Ѝx! R  \a[  a0000S(@@PvWP@ @Tp ~ [ /R0/S?0SWW 0 BR  R  BR    BR    t &(4*(x &*GA-(A0S 0PS0 0aqP0S00 P000_00CS00S gP 0SRh`hp0P RP000_000CS00S B((((s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `X@0S00S=STL00 <0 R0AD1U0 S 0Sh &((A-@Rdp@0`SP  R RE00PH @(O-Mr圲@0R00000 0$`40嘀C6 \40`SX@ 00 000CS0D0S00CS010S  Ht`P)0V00)P uP _ P KX10S 0DC}0@0CS0 10S cЍ90S`F`H`Z' Z$ 0S@  @Q0 /PH  p @P P0C0~000@0C00C0(t &(((((G2O-p0`Sp0 Ѝ1ܱ @100   Z :[X0S w@ xQQP  PQ XIPD $Q DoP @800N@P  QE Q@PQ @ T* R RPP P Y @ P@P@ P(l((!&*A-XPX@X`P0p00^0p0CS00S |(((p@-P@_0 @ p(Q@-pP0` 0S*00E@`PXPP `R@ Ѝ `0P@@0`SP0S0O-0R*}EG-o M⬀0p@oFP0 #(oCav000e U00SW-00ED`PIPE@T Ѝ00CS0@gfff( RO-PP0I-SpM` Sv! C R ?Sn @Sx 00C Sg0 0S`0S[ 00S=SVVD90 Q89 RM0aF1P 000X00Si~p& hX~p 00S8 0 0CS00CS00 p00CS0 0 00 t8tpp\`WPQ0S 00CS00  `8IЍ8770000  Q 7嬇 pRg ( 0 0S 0S-00CS00 w 00CS00 v 0S 00CS0\0 00w0000v00~* 0S 00CS050 00 0 0CS00CS00 00CS0 0 00 00S00~00 0  00 0  000000yXyw \5`X000 0S 0`G`SHQ  D0C 0 =[P   00CS00K00~ 00AS Q10 R 00 SQ000CS0 0 0000~00 0 000 003c 030pP\3X H0 0S Y~h 00S0S W Y 0 0CS 00CS0h0 ~ 00CS0d0 p0 0CS00CS00 00CS0 0 00 00~00 0  00U 00 S00CS00 00CS0 0 00 00S}00~00w 0  00n00~00h00ppc00~00] 0  00U 00 S00CS00 p00CS0 0 00 00S300~00- 0  00(J*(((G5 5x &(L(h &t &l(!&O-,Mp 0W00  0&000=00W0 00G$0`0S%  8@P0@S%0(0@5T 500B0x50S 0@S*S W 0GS KD Awd8P  0S @0 0 0 0SR 0@PZ!PPV0S 0   W$400AC0L00t$000 W0P@SDP(4 P U E P @PS~  @PQP0 S# 0P0U0@S30SP 0P@0 0t3$ R0\3 @P @P~@P P<"~4"P-2~  %|2PdDUA @$T 00S @Ÿ 0`AQjTu QA00CS0,0 弁0 K00 0P  00B  0C 000@D1 <10AaW-0000T;0 0 KRZ0#S00 B0QS`0 F00 BU,Ѝ` T   `  R00S@lUv}E(t &x &*((d*Gs*(***O-0M Pp0 t5 h500`E` 00B 00~S P0 0`Z Z$:Z =Z Z6 Z     BR &  P 0 AA Px4 J R Y 0S`Ѝ0S 0S0@S0=S (  #00CS00 w 00w00  #00CS0 0 u l#00000u00D#00CS00 00 00(0S 0  CR  SR0C 0 Y "00CS00 v 00v000PbS000 S 00CS00 ~  BR  Z `T00~00y !00010S00 S0 0S0S04 R @R*R R; :`#  000  BR !  P  AA   ~R=Z0S 00z  `l(!&(t &((x*(|1G-Pf0pApS 0000\1\0P0P1p ` (ppptV0 S000`0`0CS0#0 p0pĐpG  G* 0   I 0  R 000p 0 x &(t &l &((( @-0@t &O-TAT`0$M`FPp,Q Ae P +fpQ  $PpQ "00'''`\(( &4,2=,x &(k,,0S/p@-@PP1PL1D8a 000P0R 0S"00D05#0s  0C?o2^0SPݛpP `Q xP0S *00CS0p\00Spp@  PAoQP\(,5rO(,,(p@-@\P0P00 O@00CS0p00Spp@j((O-@TMp R0 TЍO +ؠZ* P`PZ   0SPs  0 S S S P R00S0S@TЍ0S|22 G! R0+  p  !R-   |" *  0X" * 0sT0 dP ~  n*00CS0(*0 X ]*؀` 0S 00CS0*0 00CS0*0 | 00CS0)0` 0Z 0Z)000u  n* #40  d*  _*P S#4LP J0 p@ h ? \-*Ѐ 00Cs 0`F0j&-\( &5rO-.-3-'-;-D-I-X-p@-`@000T0``V Z00CS0p400Spp@P0S P(\((0 @- S  .^\Q    @S0C $00P0R0S O-PPp10 0%SX P 0@S!!Q@ C$0S 0S  R-S %S +S H1@@YZT$W@1 r9 002#00S 0S 0Ѐ?S  #P T"@` ~ P P  `0@00SJ R Q !" R @ &^-}-\(l--G- a 0S Qq0l0@S @ +)А0Sʬ00CS00 ( 0 )j0 R  0 S0!)\(- (5rO---!&X-A-pP`RP00Stp10P 0S THjPp pPP gP`W@ P1 1@(`V Q U` 00S`AJ 0 (P00CS0 '(0 S 0 000S0 S 0 0-- (.\(5rO .-!&&.800S /@-P `\(8 P  /Q 0SZ//\(`060S/P00S/D0Q<0  40 A!0 S00>(x &(!&\(5rO*.G-`Q0SQ00@00SaZqP000D:@0 C @ @ R0000CS0010S Uq,000 10.0S0100V000200V+ 00CS000S .萠 @0 ZKꙂ! P00 R @\(((x &A-@S`!1q@P! -%00S0T0S  FaT@XV2 \1N0SM U 0S0PbPaV 1KpM ##060S$ x#u#r#V%%U 0S PP0a\aP H XT00V( (\((x & &,4.08 N R S  0S  P 6x &O-`RBM0p0 pP P Ѝ<0S0S "0000@00 !P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р㒺* S :^ 0R Q0 [ r; R-z!  Z B/o" R" \    P 0 00CS000S \  V@z   BZ/o"  "0ꀝ((\((x &!&( G-pPK@P EP1N0St `J@aT @aJpYL 㠠`@0S0S 0S0S `@Y 0 X 000 x & &k,\(A-@ PPT0P 0S vlP@ pP@ ZP@vt06 R0S@@PX` p2 0 P mL. (P.x &!&O-`s$MJ PPY30oV 'P *P 6nU pUV `.`L3 R ZP$Ѝ3P\!ZpP'0?oQ20S P V P  Q6ZP@@=Y pW  42pP QY QnVP  (160S"\  \@ /o"/ S [ (\@ Q 00p#Pu@T R *  W R 0S  RP 0 S0C 0 *b 0 R00YXcX `Z^ R[00V(p. (t..S.\(x &.p@-P^`a000@ R 0S 814Ip J!70S 0 00E1  S C00P0  D@ RQ D@@@Q00R00S 0SW00CS0000S p( &,\(5rO(<1p@-Q00@St$P`0SP00CS00 # 0 9%0Hp sKJ !PJ$pP000V00CS0@<00S zp\(--P.!& &,X-((@- 0@0- (@-@ | @-p@-`@00  p 0Qp\ PU#00p\(.G-b@P r 0 0UrP@Ѝ CR !)0PU0 R 0S\S0 S0S S S=S) " C< 'S: 8!0 S0B  0.Q,"00  }00 S$0,"0^ 0  :0 1 }SQ0 0 \0P $0H "0 U 0"  PE@\(,...( &..A-@s弃M`TL 0SIPU0S 0S t#\#RP 0 BRSD@4#L#:P;9@`1@P'%@PUV0S 0S |Pp `Ѝ@PDP$ 0S P wPlPcP`Q f `Q0 E`PV8 ? :0 S`A >vP 6P 3P 0P -P *P 'xus\(,..\/.........../ ///#//(/8/L/Q/......^/d/p@-@PTpU0PU 0S F@.p@-Px`x0PP6 R@N0S@2@@0S@D. 0    p0 p\(x &A-0P@`Tp R@ 0N@T P 0S@@X\W\0HU 000000V0@ (x & &A-(M0P`p 0 000q[p P@ g[0 @ @Z[G$"0 (Ѝh/G-PP- 0M00S _o1u q100 00R00 Sڰ @PЍ0SF  0 Q S/R mC\ P" Q 000S+  RA ``0S:SV@"00S"@dG/!@00CS00  0 ( p0ST0@ M00(((Ğ(m3\(y/l &(/!&t &C-M@$8T4App``P0S P60SP 0wNj 0^0 P1U00S^0SP60S .0S PqP P{ЍP ^Y8 0 P0C?o20"ꀝ(x &!&!&\!&/p(0S/p@-P000kZ@P)00CS000S TpP@T` `@V00`T0@0YvU0S V00T00p@((x &p@-h@P0000ZP 00CS0 Sp@ 00S (/(p@-P@EPUpkp@-AP 0@-:CP 0p@-P@EpA-P@P0`S~U0p~00 p0 000CS0h00S _0p000000C000CS000S Ll &((P0 @-Y 00C00/0l &00  000   /l &(p@-@tPt`0000S0000H0 00CS0p,00Spp@00C(l &((@-D@ 00040 00CS000S@(((G-qA0@0000V 0YP0kPSP) 00?0 000E000PS V 00CS0l00SG E  P0) `0`00(l &((T 000@0A00CS0/00S/(l &(p@-$@P0 0C0C0pl &(A-`0P0p@0@D00CS0l &(( A00C 00 0C0/l &(-A-(M@@`DHpPpPVP u gT(01 0P @ @p@DP`U(ЍAЍ/T (01 p@D0 P p$0@- {XP@ t DЍ0S@4O- 8T4M@ 0@0 P+4`0S$ 0P 0 T |0 0 #3Уs PP# @Pq pX@ rX00 dX000\Q0\Sw 0SP Q2 0S FSf Q P# PT@ P) BP TU @  BR 0 @ä@Q U BPR 0@ @ä@@ K l P BR 0@! ` ~R   0 00  9!TApW    pUPPK0 0[*0S ! !P4Ѝp"P P00S0K T@k U/ X  B R 0ä%pT((H0 (N00D0t &(l &0m3A-P`Pk000WpW00CS020S |20@T[UU  r0@000w @ C@00x @ C0 @0 0Dr000  w0B  x0B00  Cr0P 000w P C00x P C0P00E\ 0 :LA01 4`ЍP(00 C R 00C\0 P #SR$ 000mPP mp@00CS0H00S ;UPB 4T.W0(( (0!&10000O-PMf`@8pP0S 0S20YJ U0S *SW@ aWP HW@` T @Pi Ÿ  00 C RS`   B P  j& :WpOB U0: a:#P¯T@3UQ `UW 0 Um``qp\bV  d]V P 0SHA01 00pЍ U0 0CaY   `VP P(By` 0Sp0qpl 0㽵 0P1$1 (111 2B2201?2!&292[2(t22 BR00/00S/@0S/ R /0@-@0000C S  RR R1\ *0ЍI343000C S0S//p@-PP @P  P l P TP@P 000C SPppppa3f3j3QX0 0@-^ @P U@R000/x &p@-`@`P6N10Spv@TpUUULU@U 0 Cp@Px &ؗ(r3G-`PR@]Q6 +@pA(0S 0 - ?`V@A00CS00  0 x1@`CQ 0\!SX @TP<8a0 R 0R-  @TP@00CS00 ~ 0 Q <P @1@XT@Q@pQ )PGGpW, @-f5x &3x3!&333p3333<0 \+P@--|x &p30S/p@-@PPEPp@p>o>A-@1SB@D`pPU 0@P00` P>(O-PPq00U`0SP  -R  RC -R0SD @0+R7 `;cP[ U00PoP0S P  ``U @-rP  R `X, @U@0PP ЍU0S ЍOy((p34!4x &A-PRB00і 0`00S 00S0S006X pWBP >P6p60S0S60N0S60N0F0 0CR?o20S  0-S0F01QP00SQ 0S $0P   ` 000S  00^0 PA( R   R0 0x &(34X(P0 @-X@000D00S 00CS000S (((000C S/ @-}6P 0  (G-0p `R PU4\ 0S -R Q 0L@C10?P@! @,PP P@@b PPIP-U0S 0@T0:SF 0R@1T0:Y " @Pm@ P0 T 0:S  @PY@?:\00|@Y00 X A@0 0CC!08 2A5@ Ѝt4w4\4A4H4!&s4P@-HD0P  Q 000CJ Ѝ~4(( $0@-S Q*0S-QQ -Q^ R0 P :R0S0 ^ HPP0@:T  ($(44G-`R@ 0S P@ -R\@@$0P 0S 0-SM@T@F@D@0S 00?q 0@B00`FA!0S:0P:0`0#1@P0 0V:0 000CS0 10S 93,3"@0Sp` 0C  0XZO0a`F  R0 0CS0H00S @0S ;(444((5p@-H@HP080Sp0u`0CS0` 800C80`\!&( 0R @-@T a; 0 B   B /@-@0S@p@-@P0S0ڈ$00@2B ! ! !!  !!p@-@%    @\!& 0S/xQS  00 S/00 0/0S/0/}E08 0/=P/P/0/}E0 0 0@-\!&6p@-`R`@PIP #t00P pd0 Pp0-S0S0 0pV ($00080@p(ܗ(6\!&O-MRp00&p R XT2T"Tb@P  0SRy RR00CS0`1``@a10`0@Ѝ\Y.R % P&  BR 000p 0 S B R  Y000pG@D@  B>@ Y Y  YR  Q P Pp P  Q  R P000<00 K &6t &l &(\!&0@-@M P0` S @p0 Pl l "5VT 0U@ Qx0C/ % 1x0 \!&6776@-M@P0 00SPp@`T*vpPT @T8PLP @0 P Ѝ@l &t & (77t000S p@-`P@T T TH p<080@p$0 /p\!&T(7؞( &D(70@-@T(p@-d@dP\Pp P 00008  P8  p@ &\!&8A-$R0@T @ : R 0 @q 聟8 0 00CS0!0`)V#V V v vZ A  `p! 0F S0 V0@000 @\V. |V ;V&P0 @ ;P0 @ s@0s Ppk&P0@ d@0w|P0@ [@00@0@Up P  00P000S0  >\!& &((I6G-pj00@ T T+P,0S)㰀" {PP @ oG@`P  0RP `FFa@@T 0  \!&8p@-`0$P P l 0R$, (@R   RPDPw    Q  00000S@p 0 BRp@ b080@ p\!&X8@-y0 000\!&@-@oP"p@- @fP P @0 000p` P 0`@`\!&O- 㸑`P0 b P@BPp0 CR00 S 0@@0XX U @P@W W. V. 0@PpGW PV VoP 0000 V wT001S# 000h001S@ \!&6G-JM05P0@005 00 P400D0$/a`P  0S }7 #4 0  4 a$0000 `SET4 ` 84$ 4$00CS0! 0S$@PUE3 0RPPS p.0PS Px +30S x3|@|3|pX000 0S 0 `PPB P6 \P p(300p" PP0000 0 0 20 B#200#"U0S"P R \00\0@0 $P00CS0 P@0000 @("00CS0 0010DPtڿ o@@k1000S 1 0 A0 SFp!倁V@0  0 0C0800060 000CS010S)0@0 0 0 0 02 P B1 0R f@z0PEu`0PUZJߍ200CS0`NR H{00\!& (t &( &(l &(8O-௟M"/0ϟ@/0 Q_  `00202280 00/20S@0S@H" 2 pWdR00S /00CS0.0R00S 0@0C0D0000Pl210SZxPTP"PF 2P%p~Dk@.U0@#S00 p6 p>00@ S0p@ A0@S7p@a0@SaWp@ [\ P0000P,'P 0@Y00@S p ['P9 pt= 0 0CS00C0~000p@00@S0p@p W00C0t00j`0@? @?o2;R0Sp z\P\Ppx ?PpYW6;G S< 5:0 S J@0 W0C *0?0'3?pp000 S0 0C0~000@0C0p$W!*00'60'3?00 Q ~ B  ?pAp000 S0@0C0~0@0•3W5*00'90'6?00 Q ~ B  A0'3?00 Q~A• ?p Bp 000 S0@0C0@~0000C0w300'<0'9?00 Q ~ B  A0'6?00 Q~A•  B 0'3?00  R ~ B   W?p00'?0'Y/UP0>P0 |P!000P$@@0 Ѝ@P0 ,  ]0P(0 &P00 0_<P >P &P 00p0p\0 ((0 @0(0-P   p 00@0F\!& &t &Hl &(F6((49<68998P9]9x9(ܗ(}E (9t &IG 0{P B@ 80 <0p }  0D 00 B{[ #PA}P@ 0000@ P5 }P'w @ 0  AQ'=0AQ@=0@Y0%[y :[4 #[5ptO|0@ 0 PDp0K P AQLY 0@ Qp 0Ap85Dr (Pp@<YA+ Q:p%pp02Q1S 0GS2@0  W y 0W0`2  !m!d@Q \@p[p}[ IoQ 0#p0CS0p p>@'P023Q  w000`"0 !5  $00G-`Ѐ0@T@@0PU 0@S 0 0   B/o"X`0 0pS 0 5x$ 0 0 0L\!&H@-.P20@-aM0$ 0 k1< 001@001|0000zZPI1| 1@Q  @@00: dt 0S $Q. 4QG Q 80 1,4  0<  ,0000 0 !0 0 0 S00aߍ0 t0 `0 H0 D0 H00SZS,0ƾ 0 (x &(\!&Ht &(79G- Up0 000 P    x5P$00p8@*$rP 0 R 0`     00S 0 00@< P0, RP 000@ 00 00 R, R]P3 00300 0000    BR   0`0 P 0   CR S0  P P`  ``t 00008 @0C 0 ^00]`0 SlP X0 R   Lj000`0S0 R Ӻ0.0P 0 R000<0  P 0@S P 000z /`@`!00P0`e0 P.    00PU# T 0S 0@P000S0P0S@0S 000@Ѝ$00pp\!&699`!&x &A-QQ@``p  @0p0 P 0W@ 0q R$@@`FR ( X% R"p0` 4 P /2`P 08 000C0@04`Ѝ Q  0Sppp0 00 00 @p 0\!& &99A- @0P P/ 000 `P ]000p0V@`Q`@@P 0`0 U000 >PPe``0SU OP\!&x &9p@-PP @0 @fP P 000 00Sp 屼pp\!&9  P/0S/80 P/0S Q/0h(A-@Pp`00p` P@-` DPz0@ pT@ظ PP Q C Ѝ @PC㣾㠾᝾㚾 㗾 1 .E(;h!& 0P/h(RQA-pP`%gDVU``P``V@ C`0 R@WDP PԾ/ 0}C0 h!&9;S;A-`@|pPT@Q00C0U U `-@P 0PRCh(p@-T@T`0P0000B-00CS0p00Spp@譻(h((P0p@-`@TpV@PU P CPh(|0p@-P @R QP C0 bP V`C+/ 嘻ph!&o;p@-@pP0 S0C0 T  DBP 0SB,0O@dA0 T @@p@h!&gfffh(p@-P`0 Sڜ S B@P t0 R@U Bp 0S 0 S B@0S h((h!&p@-P @0Pp 0  0ph(@0@-@ P  R ,@B0h( 0 P/ R/h(C-M$P0 U00000p#0C@S0` HB@P 2@@婽W  V FB BB2 R@Ud2T /o"Rm .Bh`0"0B@P2V0S' `Bp@! CpkPBgP1 b 0: SBT00``!l`P!` `V'oPP . 0傺 V U0S00! 0 "1P @$- 0A00CS000S 9Ѝ@rT  0P- 8X(;`(;h!&x & ; ;(;Rp@-@`PP Vp - x"|ApPV μqApV ļ- 0P0 p;<pG-` PppW䀟@  PA p0S T Y  mGi  x c0@ ]V L WT 0S @V@ P!&<<<<<<p@- P@ Ap R  Ap d0 Rp @p @p @p勹h(h!&<p@-@PpD0 0RPPp03/@Pph(O-0$M@@000`p@A 2 p @尲娒V 0S2" 0S2" $Ѝ@0Sp2 R@00CS 0SP P , .@PsݻPP jT @0SX jPSk@딡0000P Sm\1 0R  V@pP0C S {,  Q ?@PP 0S( 5@PP0 RPU )@0 600CS0p00S T0 00`Yg0Sh((!&!&!&ܗ(=(=h!&(O-Px#xcxsM0@P P00T#4p,`U8@D\T(Sh 0Ta000pW` *@p00S0SӴP0SV0SS0sS vS [UPp0+S -S TM ᯴@ Q0 R:  P 1   +PT 0 @0SA0MЍUF p p0      "TR 00媺+ r   %5S ??pl+ 01?0pY0 M I0 H=P-&X-L=<ܗ((= =Q=<<v=<!&===A-PQT 00CSPDq12SK R@ 0`0CS00 `0120<S R 0q0S 0CS>S RS|l R 00CS00 - (; >)>#>p@-@(1 R ! R TpPDo\P R R R$ 1S!0 ޹PpR!P P " "\060SQ 800S00Nᒹx(T(((x &@-@P @ )PSP>@-@P (TP 0 A >(>Qp@-@ 00CS00 P `d P?U UL?Up!P0P0CS00 `>>A-@Pp0`00 Tl 00000CS0L00SAk0S 00S '@(x(T((L P0  /Q Q0 S//x(C-Q\bM@p1qpWp0S10S 0SPP20S^ XU[T T TP160SPPP0SPG1N016 RB! R>0SPP0QF Ᾰp? 0S0 U@Eo ]p X0RUZS0000 00D>S+00 /=YppW a01ЍC~TPx0N R T  DR 60SЍQ Q"!030x((x &(\PO-@`P女P p៳P ᚳP0@DpSppTPA T即P@DP:P5@<ჳP,(4  u@P@sSa0S 000&T 00CS030S N@@T00PpӪTW00 T\W! Hs@P 0E0`P 10STb@ T@@VPT @bP1 R 00STA@ Tx@P@UT X@Q0S 00S 4:"@@TppYW `ԡ̱PEPe ?P@1 10S AP`0-S0S`TPhUCW W0S8 e?0S: 0@ V0 S R0V00 `1 R  &T` 400CS0400S p>>>>>!&>x(((>>>>>>!&b?>|?G-@P0D` opPp U@DOoBW@TG0S 00S 0@0 @000CS0 00S )P|(x(((p@-PD@`02S@20CSp~V02px(40T0P?o20S 0S//x(C-p@`1010r!Q0@S10C1 ЍqXPU X21QPŶ`%$P 0S 'x(L( 0?!!R/P/x(p@-8P\2Sp@pmj\Bpx(0-MM01`"R !R X"R   1 1d"1!d2S ,NPh1, ,NP H!0,00N@P 1, @T0dw<`0P, U @T 0S PI00CS0 ! ^;ṵ00 0$0(00D>S 00 :"!031x(L( ((0@- `"dzx(p@-@H'P.0PPp0C/U00p?p@-T@TP0 0P0 $0 0000CS0p00Spp@(p!&(A-@R`P`p 6:0PPEUp WD賵0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP00000 00CS0h00S sDP`00000C0 (((p@-@P@0SH00Spp@00CS00  p!&0p!&0p!&@-@Px#Ѝ?-@-  Ѝ Ѝ/-$0@-  ЍЍ/p!& -0@-Mh0, @P(0 00SZ0c1 @00DЍ0@Ѝ/G-@'` P$ 0S! p20S00CS0?0 " v00CS000 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' ??p!&0Qp!&@-0@p!&@-0rS|?@0p@-\P@-  Q%  0 ` Q R @P@DR 000S=SA00@0p@pt &l &(0@- 4@ 00C000 0;Ѝ(=@0P P PR00/0@-@HP^ ^  R0L00}EA-( 㴀 R Y(p`@pW p0S 0QPU  0S 0S   3/P@P00 (0Shp@-@ѥP/Ul 0Sp'SPVP@'ᣣPP,p@J  EFE@H@`@c@f@k@A-P0@S`p    3/@P@PX 'W "p0@=S0U 00 00CS00  0 00CS00 | 0 T r@!&v@O-@00pS 00P㜠`V  X0 c@PU* ЍY   [ QʁpaP`0p( (@0 S =SR/=S/A-`P0S=SPERPU@'ܭ\0\pV!0@qpT 0S PVpp@( (2A-`0@S @ PPe 0 `%! i 幯  `aЍA!q X <,0  8/0`!0X000 0@!,0XH < S   8/0 U U0 Z00CS0x00S ЍAB, R  Y0#L 00P P Ѝx &x@(((|0-GM00l00 0NJP @0 80 Gߍ 0 0  V ((A-`p= @P VPp {PV0DP @SO=  0V  @K"`ЍA&0C@\0-GM00IP00$0 0  Gߍ (p@-7TP0``: <@VDkW0V`0 0 p@(@-!0$MP00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    b$Ѝ(@(X(x &ؗ(p@-@XP`000T 00CS0p,00Spp@L@((s@-P@T@ WPP0 P00Ѝp@s` EP 0 @V00000 00PЍp@(lAA-PpU`A0  0@TP@ i0@00` ( @-@P 0S   3/P 000A-P@`T PP 0    R   2/P @@@ pP =Ạ@@,(G-pP`0rS@P W 100S V@'<nT pTW`V 00S p`V410PU0 7Ѝ 0`=S3 P& `W000X0  ɭ@V 0P U V000 V 00S  0W P(P`P`pA (sAA@-` p9@P6 0 Q0 PQ 0 0   R 0000   |0  w00CS0 00S Ѝ(m3(A-`Ā@TP0U0  媮 VS0SpW   0 0 7/0 :00 0000(X!&x &A-Pp@P `0`&`PPEPvT eTP fTpxTPW X@V X@A (PP@- 哬 fAC-p0P000ā-S`@TQ .@ 000@0CS`0Wp10SS ЍC@ Y@P=FP ~0 @0 0 0  0 00 00000 0   0 00=S X0T 10=S100C0\QP 0P00 Ѝ((X!&x &( ( p@-@PTps@p@-$P@ XNP@ xP@ IP@4P(P0 P pUAA (00@/0 S0@/s@-@ხ0 0P`z0S v0"S U1r0h%!*0SX Pᯫ0 @ R T RЍpB&B0@-MMP K4P Mߍ0C4P@D 0RQH0PP00@-MMP *4P Mߍ0"4P@D0 SPH0PP00@-MMP  4P Mߍ04P 0RP 0RPA-@`4PI0 0SC P3UA 3PPPep3PJ! 0RAz@- 0-RS# 0S00 04 Ѝ0SX00T0 S00080 ,ϨP$(B<XCCCB0@-P0M!S@0SPЍ0Pi 0SfPUo U U U y3P7 Po딡^3PL1PEU@P b  P  P  P  P  P  P P   p0St00@G3T @20(S0)S0 0XBp@-@`P9Pn 0Sk0 "0CSe0 o pPPQ`@MTVF@`BVT;`@7V@0`@,P%`@!P`@V@Heh0S p0!Sp(S0)S0SopmBp@-@P垧PPE瘧P*0U%P0opMpp0\0!S@p  p(S0)S0S 儩pCCC~BC@-Щ0ㆩCD!&(0@-0 00 xX(!&eD@- @ R1P\ * 〩ЍDO-`M@DVPpF0-S0lSB 4S -Sx `E@Px2 000G @PmpGW Pi 2TTHn`0%Sb PP`_pW 3sS0S`3pV`/ N0SpFPPW1 000 P@@@T`Fp FP h1p᫦@P E@PPU0St@EpWpGh`0 0f 0VP 0S  P1r0*QJ0S lQ0@ ]ߨ~/pXu0  ἨZp /lE&LEEOE)E E%E!&JEE0@-DMص0   0@@DPU$/ @P@E0 3  % ! &1 PL,  YDЍ0=P (\(2/$M"M'M!&,M0Mp@-+00S 00x 0p p0p@0   PU P@P0P H0H P ph Pp(((\!&,(h(!&!&p!&!&!&p@-80@@0 0@0PU@000Xl0A  R 00CS0H00S p@@C0PCL(h &d(x &(((P/p@-@PTp000@A-@`pPT0   S*0 @A 0000  0000@ MM00C \ /p@-@P 0`P@  0!S00 0 000@0pO0 0  0 000  00 3  0 000  MM0@-@PM  0  U @ 0 00P0 0@Ѝ0@-@`PT@ Ѝ0000px@PP000/0P/  R /0P/- 000/ဟ( 0P00/ဟ(A-@pP 0` V  V @00CS00  0@ 000CS00  0`ꀟ(!&A-`@pxT [TP'T TG "T Rɦ|1  p\0DS0@@7T/T @0`00CQPRA`ET@0P@0  aCQBW0CACQ70C00CP@V `R|儦h0 ` \@RXy<0  @ @ @ @ @ @N(M&uNN@-P`p@P \P 6/*0 cS 0<0 Ѝ0S0P@00 #100#7Q0S0AU@MS0-S@6/P^S   C@^S@0?S0ꀟ(&0 0DX(N!&p@-0S @0AA00p0@S tPP0 0CC``00pG"Pp0`0PPEEQ 0ۥ00p耟(NOAOfO@-P0`V) 00(  0 000p@ 0lA Aᶥ@00T0,A Aᥥ00 Ѝ耟(&uOO@- P@pๅᡡ `ⲅ0P h@h0 AAm00 ЍV@@T @ 0 AApꀟ(OAO@-`0@T/ 0'R"RPP0 Ѝ@궧 P὞ +0BpP d0000 0HA A@00 Ѝ,pPꀟ(&OG-:`P`@V@P #@0`0pF ,匍p@0P0耟(P(O-0hh,M0X0\8P P1@01%㐗Pp PE@ LP Xp ( p70PEAU,Ѝ0  000P@`V7 0S 0S\V $`7P00CS00 07 0$ %V0%S@600CS00 i6 0P`0p*Sp`0.S0@*Sp@Z`ႤPȽ`p<½p@0xZ0WZ%Zo A0J R %X0J S00%S00;눅\P ] [P \Q 0p\\ s00vG t 0 tD\ \LQ b '\ \\ "\  \ M\^0? \@^0-000fnrtvaet .0P030  C 1 01ᜣ똓`P d P`  db  Pd  xѤ s0v0 t <0 ӽp B`0 0@ 0 t0  帽#l cZv t0 O <"0P 00t W 1|j  1v t  j 0et 0^h0P $0'S"S {YX0S$ L v t   0# h8ꃥ0$0$  Yt 0S#v t   0Dt 0NVBT0 Hۢ ꀟ(!&-P&/PAP6PaPNRN`N&wP(^PPi0C-M`q 0P` Pp +@P 04 p+@PC 0p W  ) PuY <Y?PP0( 0ES  P Zژ 00S00H pJ^YPH0?S0 -S00H0,Ѝ#PtQQQQQR!R07@-@0 0 X,-TPQ P , Ѝ0@-00 - PRPRRA-p:ߔP008a[@P3 0S0 =͔PP Q[00 h`cVxᵟP 00 `8iVT᪟P 00 <ᣟP, rh 0$00SЍlVᑟP 0 0oVᇟP 00 ဟP Oh 0(0 Q 0SnP00CSH 9h0 0 0SSSS9S=SPCSISPSTSZS`S0K00M00P0D0 0C0D080;800,0/(<0Q8 00,,<008 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@0@-d00$ 8 Ѝ@-@4E000@-@4=000@-@(0(S00 0)0,0Ѝ`t p@-@U(PP ٗ뱘GP[`8存<嫘@婘D姘U\塘`, 84(`O(V0,0phS@-@48U0,0@-@48<0,0&+uS@-8i@+|S( R o8 ", 8 <  < D ,-D  , /(0S ]@-@80@0<<@00,0@-$ s)PZ ЍtS@-f)PZnt S@-[)PYot S0p@-MP`0@-S00(000 0P  Py)P 0( RX  0 0 S40,c03/Ѝp(STTA-@`PpQP-U@QP00  P P0 -U  `0p@-@Px @0P ,pT 80$P< D0TP$ <0<Pp\UPVVWp@-P @0S *00Pp(Q+  0 BR @-* M- 0 S^0@Q 80^  ? 0  / /rZ((jZp@-@dP`V P*p `HV4*0* *0(uZ|ZZZO-M`pA9P(U d *TP L *XP < *PW ( *PU >* P p T,0p vR S [ Z YXW0S@0S 0S T00?5S[ZYXP 5T <@†{ RS [ZY XW :S 0S0S Px T0pPS X WU<P:TU $P)bR@ 0*T 0S Tz[TuZTpY  TkX TfW Ta0Sl hT\@0ST PTW 0S< 8TR ( $Nv 0T 0QS TL[ TGZ TBY T=X 9R@ 0T 0AS |ppT9[` \T4ZL HT/Y84T*X$ T%W T :SxT0S pT0ShT aT  ZT SSpKTX`\DTWL H=TU 4PU(2TUP T;S < SA SUS S  T:v`XS&[& Z+Y0X5W:U?0sP0SSUA &t$<ST[ TZ TY TX TW TUx tThh BPUbЍ0i4"0d @(T   Q ! '0P녡t! P0 ' Uỷ ṷP p[\,\9\E\L\S\[[\ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ [ [[[[!["[([)[0[/[5[6[=[<[D[C[L[M[U[T[\[][c[d[k[l[r[s[{[z[[[[[[Z\e\a\[[[m\[Pi\[[[[[[[[[[[[[[q\x\\@-R z(z%\&40@- ,SA0 i(i%(W]&s@-@`U0 00#S@BPJ0S 8  V00S 0 UЍp]]0S/#Sp@-@,P(pY0P 00p(W]M@-PRP@ p` p 0R" Ѝ 0"S0SO 00SS  00@O&@-TPL0 p@0"SUЍ^(^@-TݓPL0 p@Ȟ0"SUЍ^(_p@-Pd@0S 0S 0SS <<@ U   S000P 0p(%_p@-Px@Ql QUῙP L0 P      pp@ @D_Db(0@-@MPP 0SPH00Ѝ000 0@P0 0 ]b$(ubO-PXMp` 0S8;$ ,,  P 0S ߍP? 0Q 0S q@  R R@  R@[T WpU: 0S D `9/PV?`0(bbUbb@-0S S S8 4 ЍS$ Ѝ8cdLccc7@-lP$ R`T;@ H $0S p0 T  wT Ѝ0(d(7dbdp@-@P 0Sp@0PS P00ሴ00Spd@-rD@ D`DHpP0S#00& d&C-PMP` 0S00(p0 /pIP" /Q0`@ 0p@9P T0 p/PH$0@@ 00Ѝ]b$((dO-0prPen `=& TRP2!&DB尀D2&02(  -&, )&0 %&8 !&4 &#4R D "& 4S  & 4S & 4S h% 4S hL% P0S P0% T0S 8%0@8Y  ЍO贎0S0 a``0 % 0 %0TS !S1d7  `%0TS:3  0Th $%0 %@^P&eeeeeef fBBfff(G-Q| ,@QhP0QP 4QP<PQ(80S,00 80<0S804 <0P;PP;P1 QB"8`8X0apSp R t <0R\P 00< S8P0S9`(YQ z(RQ s@P0S0 BS `a 0ah0S  0 S* 0Q*ha N8Zfffg"gAgg(g>hkhhTggghO-;$M p* b 0P$S  ߍS 먲@PT[D0 00@P뉔 4ᨛ0R YSA ("$0f0Qjf/ ᖚ,2!S1Q% RR 䡟 0!,21S 1b"!b$!R! R,"b"!4b4# 0C?o2S  0 pp`1R8 R,2 @P0 000(4"48#8 R* 0S 0p P 0S 0 p1So   @#1S  f/ "01T T|%H ((hiVEW}}hWEV7ieqiiiԡ(P&A-P@`#pP %R 0R000005S P vL $0f0Q4 Q(d ((i0(p@-@,tP  P$p@M0@-0S ,(@-P  0(O-@MتM:` 00@  PG  N`P00 x0Sp :ẊPP(X @008b40SPP(P垕P+U0P u(P X p90 ,09P,0S  ,02P _ P pGGqrpmPd,- XfPPyR L, 4^0PR,0S  S;ʑ ~0;l(p1 P,00 * P ,00,0PU 0S,00e P,00   T@ 00,0P, 1\  88 B@2P(U@ 0SX;U0PW(P( -P(  P(P00,0P,0S ++RP0 P0 -Ԕ P(00,0}P,0T0 0 ;ᾔ P (00,0gP,0`0 L᭔ P (00,0VP,0X0 \᜔ P (00,0EP,0\0 fዔP tᆔP (P0 0,0.P,0d0 tP (Ph5 0,0P,07 a P (P 50,0 P,07 v0P P(P40,0P,07u 0 w@y4 9 P (P40,0P,07^ 4' P (P00,0P,0x0L H4" P (P00,0P,0|0: PaE0 S0S  'L0Y:3 QYڤ0 q&0H 062|sT(0S1 -(PG 2X( H3⎯00(00SH 3#   0 R L0 2000"0,0(  00,0aP L@, !X Ȁ˕O 1 0,00 (0 RS P (0S, @pݍЍ[ $00  QP$0 t$0P1 0CH 2Ȁّ00S (0X H0S~81X{ 0S0 (0 RS Pf (0S, 囒 (0SUt x R(jdub j%jDe-jUjdjj0(jj[jejjj8(H(jdkk$(d(f&k]b$f\^0@-`pCPU V  PQ<@P h Ѝ`P!Ზ<0 0@ VS(fTl;$00S @-閗00!&p@-@5S4 0PSP p@*Pp0S 5S 1S /NPp5S X `Pp@ LPpd(( PpN(0(M~ledArdAl7@-P@0(00(0;_5S * 5S( P00S ,0S005S  Plh0hPH5S Ѝ0@ @mP0(WEVfdlmdl!&\0(gdl@-@P f/@0( 0 L!&(md0S/!  -3@-Pc\ 8P 0S S@@ ΕP@Ѝ0@ Ѝ/&@-0@QU:@`  @!&Cu0T0ۍ Ѝwԡ(P&d.Brp P !4SE 4`SB6 4`P=2a0C" 20< S :B0"SBx5`|%.BCpj P* x5< B B0qptB Y0x5< 0RDBf 0BQ<0P Bx| uoP 00 00S- pP0`(V& R s S 0|0 0 0`P T&ލЍzzz!&0P  B0P 0P~P0@p@迣6p@ 0tA@`;p@U@<娣8Pptcidyara.rbmngnts$'0D S/ 3C5C$1 4! 8<0/(0@-,A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@( 213/P/8(A-PT0p(,`|@x,0T@@DA?@?@@(@-?00@0 (20,20㫄0P!P30(> 0R//G-0`p(,BP ᎄ E?@PPfW ,20CS(20CS GW0(p@-M@`42S%^ F E 82<"@? 0(2,"8Ѝp@31妢<"82Ex`p@#☢,"(20mX"\Ѝp@(@#& ?ft~s@-P`ᡊ  0SЍp00S@ᐊ0"S1Ds@-$Mc@38 ́k00 0&A-P`0 p @Tʬ!A /,s0d  ? qp  RЍAL`0S`@D@,A Ѝ@#&AW(A-0@`@ @pPph1ČL0\ D0d^\^( 0npU(p@-P0@0S( ᶈB01p(O-TM0x 00$04pP ∰ 8 @A e00,< (0,0S9 3,(23`N 0$ 40N40 D@?D 0> 0p  6@ D00 #dP 2d@ $00<p (რ ` RL` $R0 S 200#1-R0% XLL`P@L{,0P00S (2 \|P! 2 U|P 1 N|P' (G0L00 SE a08 g2(0hE%KU`1>NL!\"?C$50㹂P@1\"R@ x XR@x  X20P@x0 0X20UP@x0 0X20UP@`L` 0U$0000[ 00S  0(0$00 0/ \P @TЍ P @ב(@#&x(&0&?-7@-@m@00CS0 7AP Pp pt?0 P00CS08!A0 Y@o Ѝ0@Ѝ/&8O-0` pf?Pp/B$0e@O 0^~qp Ѝ  R ЍO t` 0S 0E~qp `BE,w  0S @#&(p@-P@2S t`0n/(2_1!41#41U @0&"UU  p@@PC @@Tp((6(G-@r,,`P >` VPmYTLE J$5n,Ԇ0U !VU ! [E@s_Ps X2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@s000(A-@PXPAds 2Fⱆ t B B$m00C0(O-Q40 ЍQ^H DaXR XD 0 0!R 0:80Ԣ #ZppWPPUJ U @DQ ČUȌ̌X L X0P0Z 80S yq 긒(O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q  32 $450 (, T02Sx Y< ЍPT 21倰[R RS$ [0 0 2S Y YP=Y2p00`@p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$l00C0@@PAy`d1S  P0148<   00P2S. Y  a14a8a<0#d1a#h# 4"RNX2 PDT- X )  0Q Q5H $ 2S !1?  ! $<0  !1?  ! #<0  1SQ" R@ʉߍ@ x QS.82SbV<#  8pp  000"  0 `p!V0 002Rڐ"  "ph2R Ci0.I 3  0 0b1 RS  0Q1R 0.Jx  6u 2S0[ 0"P- x1R Ci0.J[ ?X0V 2S2S 0 Q20S*F0)S  @ b0)S  8 0#R00S , ꠠ0 f0--C B   j 0S;'!PDt:(z Q@#&g@pmYUC-M4RUP@P@\Ѝ(0PPB1P@dadaTPS HЍC  0 S 0(00 ,00(  ,   00+ 0@PT0`  0W0S $8p@00W(0pS,0 @0m 000 W 0S7X\" 0y{p@@SR 00 RX00 04` p 0S 00 00 0p2P2 S2S/  8@ 0` S 6! R0Y0 @``!R (0 \ !A(0D!H!L@!$(,@l21S  "/0.0010T0 3`2044`5 8<0 T @`@ H2(0L2,00800 S- 1S* ( V000P,  00SV0!14!8!<!14!8!<V(`,)(,00L000D(p0 S( 21S$ / .0,40 81 <V ( S  PV 32 $45(, V\(00,0p@ `00 00 0pS0S00 00 0p ;P  \VU6 0pp 0S '0S 0s X2 0 RS 0 ePTo_P$$00D#$0 #(#< 0'4 0'80'< 0 0` p=0 @72S` BT0aPX k0 q 1<A 0G@@p,2 0C00@@T` d(2? 00@@Z0`Fa ?`1<A 0?``+@@D,2 0C00@@`;9(20? 0@@G/`Fa?`?``0S\ L02S@P@V @TTJ041ST(˝ @`(%DILxA-p@BM42fS,̗P42SN  0PHU42S 0S 嵗1P0C0 42RSfvP:套42S]1!$1(1,ЍA0S` SP`兄d 0 4rW2S `p` 0_P"PR S0SЍAY@D 0ЍASP 0Ѝ(͞ޞ8((._!CA-@T2 @PzP |zP wzP@ `p@T 00S p`V@bzPD00S @@Uz@P(\#&A-Pp`j#@E#B#000 0@@@A-p@`T xxPP#( 0@@#@C-M M04((P@  ThT  zP'PLD(z000,4P@(@P "0UL4 4#sH` PF @44P4S@@044T0F@@!p0|`P;$P$ $0 1  <30 <(00S#|0 `CP60p0U9 p@9 PB 4 R 4#\ <(00PS<(0 0@܍ Ѝ0HSʈ"P0S -Sq@`a=nP00@@4P4 R 4$A0!SP Wy@800  0 R00S& F@10HQ4A<0C4~0S0S}0S 0S C  0S C C C  ,\Pl4#i P PSd   8!($`#&_et|0/|(0/|(0/|(-@-  X  먾&G-P`p}@0S  0S X| U WTY0S 0SN}@ u|(v{-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  F@-M Mq@` @/PxPݍ Ѝ`!rPp=0D@@rOP0: S0RP00 0&PP P81: S P% S  R  r&PPp>.PPPU r^PP$0@P|(и(5@->0P  44 0 Ѝ   (8G0@-4S 3/ |(@-|00 @ 0 $'||@M|(@-|@`|||@@-p PL`@@0 7/0P S Ѝ v`00(O- MM0|6@  @  @ 0p$000 (0-P=,@  ܍Ѝ 03/0P00  P @$0SP (0S W0SU SUtt %0000,;$p` ,0 *p u50@0Y0C @4 `V+> `  0  0 000l4   ` `  Y!&    00 0 ,0vP,0 0S `vP pW `V|p@P ZC Wp` Y40S5 #  @ 0 0 %00Q00R00S  000 xg 0 S   Z0% 000 0@@0 00R0C0r V B G SE SB `V` 0S 0S_,@U 000 üG-0@  0^P Q< 0 PP%   0P` 1 pЍ Q*l !URQ L l w0 p H0 0W40p P  0Q0   040 04! !$0 0 0( 1 0, X0U`PX NP< 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0pvn00 QP   4 0P "UP| yUpP1S1S1US1S 3S3S3US3S, { pP0p* 20212 1300p 0p*n00 QP i  2   0Pp00S1<01@040  0n40  QP    0PA0O  A0TP 4 0R   eYX`V P0Er 06#++R`HX< $0S,0,  RT0CrD0"#1P0P  0QL \0  0P 00P00h00dl0d@*TnȽͽҽRRaArrAaU0dþܾ=@-p@`P 00 P0PWm 00QP 7 Ѝ 0P< !@ !0 P09m 00QP 4 0P@-@L0 \:0\l00l0Ѝ |p00p0l0 \ \ P0 S |D0 | 0L 4  1 $P00wǿG-`XpP @ xP  Ѝ0!0呗 0lXY D X0 X0 PпO-@,M0p@$0l@`P Ppr?$PP @,Ѝ u 0 RLŸV^S PP8 PU @4p2 P ^ ^^^@ \ \\\P  " @P@CL0!Sp sppP0 S* &0 P p $`l  Ie 0L $ P 20 2 p(p," "  @ "  p@! P0 S@  2"!"0  0p@"P p p0@/ //O-`M@Pp0P0S Ѝ X 0H sA 0B { / 0 s qp6<P0p@P x q$`02&P 0 00 DP 0 0̀0` NPk { `0xP` P0 0D `P  72R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0ǿPO-0p` \PP0S Ѝ$P  qQ 0 @T 0Q\("Q@ PQ A BST" R t D r   0 TS000  R ꤐ0 0 mI 1P [P  I BPTR2 Q PEGO-X`0Mp@PP\Ѝ _s0Yl0L (2 R0 r00 PP" 0 ST6R rH 0/UP% qs  0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX 09#! 0 i QP 00 PпG-@`PpP0S00S <q/p@q9WP$0S! 0S 0S,0( $0  P0S 055P  PPpl Q #P l0p<0P0Q*l0S 2Sl  hXPP 0 RQ@0 P 0@-XP?`P@@\@#T@TpW @@T`L@(O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ00 0i Q P P0 W:00 0 i Q P PLJ 0 P<0T 0qB@(^EO-M@L0S<`@DHp SgP PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:x@(0 A-B?$@[`/p0S l0ES PC qp@@0T?  C0@(0 PK %/@(O-`aM 1V( 0/ SP0 S@0P`,0@@D0$0 0<@D0& R# X0p1#r#88 (00Nh800 QP aߍ0P@<`,0@`D0$0 00 Cp`02# ꤽ( PW00q2pG40HH04 SD00S    408 24000(00 h800 QP (100  RR R0(10D0@`PP\; K/TnbPP05P$, 50Ph00h00U U0@IP0U*0RPd0x1STx!0@P %4xQP0%8%\0 P0PEd0U03:T@Rt%P t!dx1PZb" : 00t12P0P0$00`P P014 (40PI 020SP0 S0 $ U 0 0` 0J000 000 00 0(@ D00S8 0(00d800 QP40(R(0 |PI E@(^,3n@(w-Jl <SjG-@p r W pP7\aPP .Ppy( PnlK/mmD08QP0Q:" 0PS00  Q pzxPhdP80 "8 R 00 05 !$w@(5ip@-@5%SQ%5 %SPQ %UU QQp  0 0Q0 Q 0@(A-`hPp5@ @ 0% Ņs@ŕ\@(O-OMPprP b5S5圢@TEOߍt 6iP@ ET TT 5d 50 ! S$5"R$%P0S4dGP  RR @`0d B2" 0c JQP d Xd0P Eh0K/0h0 ql0@! ,qrd (001 l j  [l  Wl,10,1#40L0sK?000/1001001#40>000310 00 000T0 CDc(%,5QP Dd d0Pa@(p(9QT@-@ P 0 5@(0/p(0/p(0/p(-@-    2O먾&G-P`p0@-4S 3/ vp(@-Cl00 @ 0 $k7l@Dp(@-1l@7Pkk'l@O-M$M`pP`&"NPX1 b: S/k0P  rR l00pPP W UP 0C P"VGR V  VgPN P P W\1` 0`PIX1: S<V2"m;rpPUPV9 fPW00``2! 0$ $=PPt P5k0SH3]`P S R S"p`P-p `P`!\1 S R U+APk`x!|0#"PaY $JPtpUd( FzPP XND% ܍$ЍJu}F F F@ 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0PHL( $0 $(j XX jddhhllppttp p@-4"4 04"4P0@ LLLDDK@@KHHKL`LPPTTX~X\{ \`ip` pi p@ip@-`"Q@Upf@p@-@PKKKKpA-P@M4Q->CK->?n}C@X=X\:\79>K9>:>CK:>CFK 0? AC>KC>mGKF}KE~EnFxKGuK 0X J~pXV}m  $$((,S>,PKS>GLKFIKHHLLPPTTXX\\O-@P`Pp !4"4!14"41  $$((,,00WС\5 S L5sT`0$ $ 0Q`V,OzTvT`XrX\n\`k`dhdhehplalp^pt[txXxJ0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P b"9<Q08u@5ppL0p  0Sls` fc0 0S Zc  000 St:0 02P0 @S$0 `0;9:  \08%@5  L0  0S_h 8JX,$P20SO D{0 0 0 000(@$? x0t 60 P 0 HU 01S0 : 00(!( (}zh}{ h(w N  I 0{0P000 R0T 1AN PKHPE8 @2x0 y1( @( 5 P2h5@3h)))\)l#& P)4@)O-M`@ ) P0H: 0 0@40P$? 0 62쒟2Q { B("( pqsἢQ0< ,#42 0JR uXQp 04  0R  @PЍ( 07I1  0 4 Y: 10S<000D0`1 0` (0 I 1 010S 10S 0V` `$110010S Zp1p1000 I E8C80]\))l#&)#&))O-FM MP` X Va딕p@&: 0 x5 RC@"0Sh L50S00  000S Fލ ЍOz00 _1000D0{4 H0T00X0400 4QpQ\t` #  5`Q"0S, D L000 0 HP" $0000S y0  0 3Yl.P3 d.P0! "0K 0 6 @ 8C80  0 0S y  P1 !!2.P РL00 0O0 H f w 0I0 X0 l20G0  000B00S 2jp0!G0 h0G [0 Y0C0#  4 S 0040NpPA!)cyt1p 0p F 0 F0  kh000C0 0 S  ,q  0xs00 p   8C80>0000 0 O!0xs  p000S VP))Q)l#&lMj))) 47NC-@PM`HXpaY 10S t10S 00 0U P< ЍC(@D`T> 1 RP1H v0A  P PI H;0S$00S T  0S x0S G O@ ЍCeT-P H0 ЍTX)P)d)a)l#&gu) 0`( "4`#/p@-@HP08 200@ 00 .00 @>_p\)00S4  /) 00S/) 00S/A)P000R0S<2O-@ pRMPhD R0R0aď080S  C/ S ! R 0C00 0@ἰ? 0Y\5t!S` 0 000 ?@U (  R8 R  0l0\ P `0/0/0 0 VЍ  [ T R  P0D0 0080=/)\)T)T 9P0O-@P:1 R0* 0w됑吱0 `SxP p* 0 T C:\50 00D00,"1p R 0 0 !Ž p 0D`0 C c00p0S   0 -0xp 0C T0  0C400,00S Ѝ)^)\)T))#0O-p PQM P*T PW0k:8 `\5 0 0C 00O,"2@ R 0 0 !Ž  @x 0C`0 C c00 d0@C CLA c30B$ 08 Q,040(0PÏP08,10S 1 PpBU809 رPWE 80i,80<01|!0<S0<0<0Ѝ U9  P\E?`EE?f?U ? R T` R <(ట/? 0WTFWV  P Q RF 0X:P`0FQ   R)~\)T)))))) 1G- 0pP `B   0 0@ 0S 0 0 80PS `P` 8UH0ZP000PS X`4bYQ$,$ (,`(P~P8\)))@-@8P 080)G-ܡP0S100 B?pyW PAP` 0@`8N@Pp1 ?qB\10A0I00 00 0 V0 (p"(p p1 p#(,` W Vp`0PQ&d0SnP 1@0  XPP00Ϡ^P0d000 A)\))))))P0p@-P @? B800P( 02!SRp)) p@-X`0SpL0LP0@1CA0S000p))) 0 0 /)O-H0MS MP` 003/ ލ Ѝ 40 pP00 +0H000 t /0 @ S 0V 0A0X0|3!0S' l3Q4Qd  0   0励0>0Z0 02+ 2R2 t R<ʨW;000 Q o ! ZH"$$c+2P$" " Ry{!  {  t R1* Q5 1000S1H Q B/o" RK h!B0 \ +BL~D(P: 10SP, P Ct0 10S0Q 10S 03/ 000 0P  0p`V0Z\))))g#)Dhv)0O-SRM0M 00#4@PU( , : SRލЍ|t \`(5R\<R P  RSU 0 0 ,Zq0 B?@`@Pg@ 00S 03 00 XV8ő @5D0LT 031 a> QP$  !  刡 Q01:` V `3 V `!  P th(0`S @P0!?0 0S:R 030  `J(`!\Ő\  ? 娣 ? |'0匳 @X x3R0Z SZ d3 R #R L-<3 R '$3  R0\ 0㵯 =0 20 00C 04$0S4L3 2$ 夂 B *?2)p20S `90 0 0: S S-  S5000000sS 1 00108'1 1Zp 9 6*K 00 0ˏ /0X0 ╿70T @ 0`; ) $!000<00S 0C600) P( 0ˏ d a 0T0 C c;  뫴 h))\))T0)))U A)))p))O-lM2@ 0p`<P!\P  ? 堒 ? m&0 2Wt"t2 0R S \0 S 3 S D)@X V(20p`D2QpQ\tQ`Xd   X 1 R, V&00X0S 0 0 `0\ *L!00ST06 0 S0\ 0㵯 T<0 20 00 04$04L3 2$ @  *=0'h00S P8 Pt& PlЍSq l\))T0)))U d)))p)))O-`|2t2PU@Pp00U0 0 Z00 Ѝ0c ?˿R04G 0gC WV@QVg T0U A0 %00100 @ Q @T`T0p0T S @`B 0S @ ` T 09  0U2 0 |%P 0 P0 P`0@S 0 000T000 Z%[P000mi\))O-P,4Mp$DW`W0 Xa P0 c0 C003 X 4(!P  4Ѝh9+a p00p0S 4A 400 0? 083@430000!T  : @ @XT00T S @w0S @ & T 0 m 0t%0`00WCc 1 Pf (pP 20020SV 뉑  400 0? 0б 0 O0 OY@ $0H  10J(Pj 00 400 0? 0 10S4 A0 0000 p0 @0S$0Yd0000o| W z R$p m0 ge00000 <$pWh@)\)@-U T&s@-@P `⻽0S 0S 0 o ЍpO-MlE M`PR0S 0S @Mp P 0Sލ Ѝ000S  7P I0S 0S s0S nw0SqQ 0Spkf 0S\e<0SH_0S 0S(Vl 08Sd s/2#' 00 " "B 0D@? !? 00? 0N 0Nd!! 0N0 pP\x0SQ "04 0 R0  0"= 0 , R( 圠*,4ï0A8?S% 78P0<P0Q R0" t=0S d8PUs @0S @.@PUn $&0SP@PPDPKH0S  `圻Cn* l:xl$|0S ll0p00S00$P 0,0UA:F000S 0S HD1 H0S 0S$0S 0P  -*P   00(0P 0Sm P PP PP),Qo9Tv7X )g0O-PH0pS`M W0R0: P 0"p`7 "0 S 10SQ kЍԱԡ 0@ 0 000CSY?00 1> R. x!PP!0  S  @ eP   . 80< 0 @`80< P0 P0  #0 S00@ ` R Q\Q\)P))) x))&`)00S4  /)00S0`( "4`#/) 00S/4)O-M,M \@M"[:$0: S`B[ ` p/P" /P 0 0 00؍,Ѝ`0 (/P L X/P h0S  0  mP J0S, R: z: [   054%00! ?0S S :00/0S 0 S :V00#03*  R00S D:0S7 8  0>2(:* 0S R #P0P4`Ɵ @U9U)9Q00f0 B?>7pQP"x90S  | 0  0l  0$ 0P080S, Q:V  Z9Pp⨸ U0 00(p UxPP0X ZP (0000@P㾾P8HYDP"]$0 S7Q9 80S5  V0;R00*h0S- 7('d0 ( #0 [P d70S  0` O @(+860S 0h0!60(%R/V+: <V3#\Q RnP   hPpQ^q U PE" #p#]:U PpXh RUPp%Q_'qP tPE! p 10S0AU 0 " Z; 0S 1000S x50S 0S 0,  t ?K 0S 1000S 40S 0S    10S0ꊡ 0000 04 $0 S 00  000 0R$000$0 #600S440S L4P P u@pt30Q00 0pQSLtQPXd00H00S1 0S \30S? \P  0JP2 #0 \00&&p2 0@S0:000S0840/<0a0#QP8`

hR=\NP 0H0HP0`0Ap`ZKP1PU 0\785  @5D0L 0T 32 b< RP1Q 00 V 80&03/ UV 0 H` P00S ,Wh0S@ H0S8  0 # P0L #-Pgh)))8)h):[)))\))T)aP)p)p)P)))) 7))))j5O-pş|M@P,0S%40AHDLdP T0AX  N5 $00 dtP 0@, R<T5@|Ѝ 1o\%呆( R  `  0`oQ0P P0_ S /  !.0P?00 1> (@` 0 _%Ϡ<#\ ğ Q  0  D ?0 N#3 0R< S< 3ȓ0`S0x0@S ?0, d&J 0t l`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S HV0 S\00T0  @T`0VT? @`1 0t20兑A0Y 1XS D 0- ቻ0P0  $. M000Y 0;* 0 0VT0Q@`` @ T\@@R0@3T5Q`1:@Q`$ 0@0命 00  P k00VT 1PS 嗼  P 0R`* A kM)\)T)gx)p))0)))))&P)d)U :)Si)O-`pܐܰ 0M @ 0 0  BRЍ PPU  RQ p @ p R RP Q @p)) 0`( "4`#/O-lMX M0X0X10T1 LL1LPp 0,0SlЍ0S 0,`@dH0 `300ట@ 0D RpT0#:J`P 00ASpQ 0 0S\tQ `0S @P~`)\)))&)) 0000@/00S4  /)00S0`( "4`#/) 00S/.)T:O-M`@@V MP`0:0S 0P *S *`0080< 0/[ y HP X P ) ( P9`0S 0S `)P P00 <9 #R0p0,0S01000t8(0 0 4"400< 000800$l 0P @ a  \`* @00C0N K0000S{ WH0PuF0$S 0S '00dP7`} /00S01P,0008H'0 0 4"40'0p 0pp00ppP*0S  .P_ 0 02`W"PS ` @  2 280< 0 80< @00C0 0 00 0Q.*0SI  IP  0"pWWލ Ѝ0S 80< 080p5 0< S \Sd0 00$000 2^IP 0S 80< 0804 0< S 45d0 00`S $`  B("( p ^2 ᴠY2P@080< 0 80< (00C0 80R<.PSR$ .R $PPmP3P`080<4p3 R0* 000ZSP. 0 0p$Z P0SHp0AS0Ss 0p32G0S40000$P 2 @#R0؀R 000 E#R0uQ& d20SX20SL 0 (P    P000 0 0 #R0 R | 0 l~R> +v 410S& 5>c#R0 š!ȡ0S  0R z؀0P 00 00lPd0`P00C0Z?#IP8[ ))))QSl)p)T) (7O_P)d);H3kO-WM M'0ASy0G PPl7 8TG BP 07 00^@  6$-P 60S 60ԆF6 >9X ~Ip0㨶`0q60Y0:6 R W8`PaVtPVzWލ Ѝ!  R1[ 10SJ0!T  0 S@1`0 ? @00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0{ {<0 Pp@\))T0)))U )))`)x)00S0`( "4`#/)O-lMX xxE`p200,0SlЍ0S 0,P@dA0$ P000Pp1 0@1  0D R`T04:1AXpX\tX`Xdh  X  @RF X y%P 10S  0@P7P 00S  0| 0S  Q\ {{00= N0X!  X  P  @00\))&))T))=COWO-M式M@PL!n00 E0t0?0SX0S $5S\0SVPPWX0S $Yk S Y Rd?娀pW\ 0P%T਀X僀 H\D00!` 1B`01$dQd0ڈP0C00h01`l0R!B1d0L.0CW P0=SLq QT00H   0S 0h$5p> *+L>@>0S A0 0ꔭ S0B$5111`R B- 10 0S8 $~0S%  0帐- 00$%BR㩑0`S<B11@%L0 _PP  B PP 0S <P *堐+<<0S 0 02d0pA?P0;3A?`0 =<0T0.L0D; 0WHQ RX0>F@ @0C8 84<ϠQ bT{ S Q,0 SZ?^@ !P< T;0S @ A>+@B@  CoP; @@ D000$:J* +: :0S Z30 0؍ߍ0<00

 !>A! "$5S85>(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0.B0 $ST0< T%B$!0S\0P BV=SL5s35`!~? X00S-["!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0$3!΍0 h0DH0lE 0#0AS0000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX㧁 X姁0 8PPK,2!~00<0S. dl=0 ST0Tpp101"P Rh"!>2 ԐXd=p=0 0 =E=000$5S `0|63! 03080H ` H D /D VQ 42!.0$00` S`0?00S0\04 0o\)))P){))U )))7&T)_)))X))8 )uT)%)\))))I)d)0)a$5S|2!h `0 ppWS $%S0! !42D0D  ,x  x |0  | ("H Hp L3t !n r! T0P3 L!T0 R H  20 0000D0 MFP1  'q1*'110S ;0 020S QL GP 0< ST0T STT9P hFUPt2 L '0< ST0T STT'l"0 020Sy0 S\0P S\ P BF'P 0P S\0 S\0'TD\#0 08 ppS $S00S`0" S\0?00 S\0?000p` 0Rpd 0W S`0?00 S`0?000p?!D0Y8 0 S\0D000S8!!H &H Xp?!D0Y8 0 S\0D000S8!!H  H X`0A-0P`@0T:Ѝ8MppGX @A-A0 5 P0#R%(r`! 10" q0SR 1%0ai0 a*&t1h10S 0 00SP03Q0S4 sX@ 5*< 5&000S 0 0@TP)UA$t0UC P`0 0S H P80 0S \)P)#&?)))W')u0/)0/)0/)-@-    )F먾&G-P`p3@@0S  0S X| ᪺U TxY0S /0S?@ h)-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-M Mq@` @PxPݍ Ѝ`!rMPp=0D@@rOP0: S0RP00 0?PP P81: S P% S  R  rQPPpPPPU rPP$0@P)) >[@-{0P  44 0T Ѝ   K )^m0@-4S 3/ m)@-:?00 @ 0 $>.?@s)@-(?@.#>>?@P/00@-@0S s @ P)1Q0@?o2P  R7 P0 P0S 0 0SS 000000/ PP  P R ` -X XQTTT 0  000  /TTT8 )))))T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/))T8 T 8)0p@-000 0 00@P22=000=000X0X0<0<0@0@0\0\0p $H3H3L3L3P3P3T3T3u/v$ r$h p@0p@-000 0 00@P22=000=000X0X0<0<000@0@0\0\0p H$H3H3L3L3P3P3T3T3u/<$ 8$EEP  2$4444K4K4h &$ 5 5d0d00000-P5BP5H5H5=Ch S>S>p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//)4O-MX hDhhdhP@quP@D@:0 0 P\cpKЍ ?60p  P\HP0S 30S30S tl3l#0Sd `#SX P L0S @90RS  c*5#0S @"\5S2 0\"0C ?o20Qh [ŚX2 0s#p0d p4 02 ? o6:010S=,A!Ϡ\<#P  0A ? 0Sd0S 40qh "0S (t!\5S\P h10S(\TA. H!0 00 0p 0<&0|&0P47p0p 60pwt>0 P0p$2S# *6P *6P *.mVXZ hY 4[ 0SV?관X V. 0N:  50 <\;P$V$ Q4C ?4|PeP 2S|3%8 S20#"20$#20PB 2SAt00000' @00ag`02P$V20A\2@02 52C`6 `Fb5 0 |[4H ? 0`P,Tt#0\`P`Q=S/0 5P` ( 2RV0 SSc 5*< 5 h3 \30S 0 0`20S 0d3 0 S` V 10S0DS@ 0(y2= C0 ,0"t000 00C`r'? `0(" r0S10Sʸ10S0=S0S PB܁q000F ` 0L%000X30P%,8da *, - D10S {T0 0))b)t))))))) 7;Do T;X TBjT)X2xOvh)P)4r))X,_#)Y)))))))yX)\)))#)H)))))))o)))=S$0S, `0 <<00X3P%0*0 00S 0 00S? 0 >0S a{&PDa 5*N> 0:#: 5h1 t10S 0 000S$b V1Pa00*^1^ 10S 0 00<cQ6dPXb 0<0*>l2> x20S e0 0r0S0L%r0L%r0H00q" T 000cH00STPP$c* 43 @30S Z3T#0 0 00L40q#  c400cL00S 'Pc*330S 1 #0 0 0x4 R.0E q\ `PVR d0SPt4d*440S $0 0 0$d0Q,%R0%45 S R! t0040SPTu*d5p50S %0 0 00u(0S xQ$ ]0S0< x (%0Sv8Pv*S6S$60S z8&0 0 08%<5HSR$ / H00850<SNiPv*%6%60S sL&0 0 0v@%D5LSR$  L00@50DS%:P|w*770S D'0 0 07 70Sx,w0S0Sp0L5sl0Sd dh(000(80L50P5?T5V> X5-0$0B0^1 `@R$@@B!!@H0 000L 00*880S  )0 0 0h P^x P8YQڨ0QTڠ r0 0S Pi*k9k90S )0 0 00S/ 2( O0S0QQ&d @0 0S }Ppj*9:9:0S `*0 0 0 N0S N0S EFN0S-(Q\KQK RP+00S  E~0 ppVaF !` . R ` N0S72 N0Sb]<Q| N0S N0S N0SH  8%L < @%DX<0,5S0SO | ,x000p<0,5<0(5H000/85L0<%0/@5D%4*<<0S ,0 0 0(=0S 4=0S(@M*P=\=0S 0lmh t= PA P<= 0S= @ᦧPL Y  4p@TW.  @?00@1>0A@O@@ᅧX.Pd7  4,@ᔣ>P* ^ P.0;00 0 S 1> >5 > s>pm?WPppY$?  "008 @DT@H4L0d Lc B b"30`@P Y) ?0S  8 H4L0d @ B b"30D60S  6p00^Pt6垻@ X6PP 0Z0<& 5000,60S 1S 0P6  6@ iQ aU @ 0`P@@  04 8 <%c#!$c4"x%S X50S `C\P 0 0 o ``0  0 04 8 L H$C0 5L5s0P500ߍTT) ))0 \P/Q/ 0   Lq,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*3`30S 0P 0ThSXS"TsP`UU00Q AP 0S ?@?(`P"hR0"00S8 lr003Pb0S* x?0S* 00RE>0X4*7 2p610S ]0 00SFYP10S F1 PQ`1* X1` H10S W00 0H10S <F,1 P0*0`00S 50t 000S 0dP` 0Q 0^G[)))))))P)Z\))))))0))x)))))T)\ )5O-PPMLp8 R<@B0S 0(3 ?P00@TaVa` 0 SQɑY\ N \P  ?``  ? v0 ;-,",2 0Ri Si r0S 3S  '0 ? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*0`00S B` ` `Ѝ 0_S  $  B$ $ R$  B  \)))T)0)))U Ux)))t0A-P`p`ATR @P<M0S @ C,1p0A)x<0 0 1S01/ 0S00/)`0 5 /H0P 3S P 3S P///\)^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 h)\ ))Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS@hp8Q Q 00p 0爀ቐp@0` RP/! 0 P  C1  1 @- 0` xRo/ 10#/C!000P/ @-A0` |R  /  /C! C!/! !/ @-,A0` |R  /  /C! C!/! !/ @-9A\O-$5SX @ lPphU0 01X` 0000$p    @R ![ 10<T+EP 1 @C 0ό2 @D R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RMXr@ PPl sP\` `$pP P9 4 Ʊp +0S  vߍ<0H(00,0 00004008004004 04$0D0(0P ړW[  ᜱpUt ᖱp*h 4\! 8 `* <gp 0p $p p p 0,0p0 p `) >p 0`?`a8S/Pb   00*P*00r 1 0* dd@edA{zd@A-@Mp`;@ @p@ݍ P0@0@᢯T00 ## O-M$M`pP`"NPX1 b: S/)0P  rR *00pPP tW 弰UP 0C P"Vⴲ R V  V%PN 墰P P W\1` 0哰`PIX1: S<V2"ሲ/rpPUᝰPV9 (PW00``2! 0$k $PPt ℰP5^*0S 3]`P S R Sp`P-ܮp `P`!\1 S R UPk`x!|0#PaY $ PtBpUd( F<PP ĘXND% ܍$ЍẮJW_mF F F@00S0`( "4`#/)G-pX10P0@ʟ 0 t X 3#15`05aà121 R0` b0Ppp!0R00S! A% 0%# 0!ZXl000Z T00!ǁ8P,0\)p ))P))) 00S/ )O-,Mp0댡`P@0V000,Ѝ00 ?U0$p$0 0000 P$0S l?"00P0  , R*0( $ {000{,0 0 0(Q `@PpP0,00~d000$00?@000P$ 0S p\))yP)O) `r^FF^1Z)})p )G-PQa A3@S0`` M` 1Pr1100`g00 0000P0PU 4$.@pyp@YU 0002 0~@P  Ѝ0尐ATP   0S x=    eP@D4P80\))h))P) )p@-P0 % .  @Q 0S p# #3 0# #:>0 T0SpP8P㪫p\)^FP)CX:R/G-P `$ 0p @V` 0 @`` V`@&!D`( G-P`0 4J$ Y0000008#8$#48#8Y\dp 0q0! ## ?@Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-@p0P2#U 1A Q" ` R J` U9# c! SV Q V3  P! I` P09# c SV!Q V3  P 0  P$ ` U 0 ЍnJ 0A-1àQ`P x0xo QJ"0Sp@@ P` pFQL @$ @PQ0࠱@n} p@-@P40S:a80Sh0h 1C"0C800S   000PP80Sp0 C[C, 2 ,0S/`0@-@0  L<,֒0,0080S 0 0 [C!0@ƒt )1 ,0@-S ,0, C!@TP @豒] O-p-\MPU`@8 U810!@3 @#S41@D2s2@Ds1@DS@D50  00 0P: U0#03?`[[U\,@D `0P$0H5Q @O0$0 hD 0 XR @)"<p!8pL0(0$0 0H(0 0 `,0`4  0 4 KB@$HP$0  P\40  (00\ 0Pܫ,05S00SUSP3S` $ 0 B@:!`UQď `F0"00<040@00 38p4` <`00HpL`<0@ RS80 0 ,H0 PpT`k@P ,P`3Ql 0Q 0CQ <喫O@ $@$\Ѝ0,03p(0?D00T P  HpL`%VW :0, `S24040S@p( D0| 0 P  X Z (2( mBV(H ]`?400 0Q 800800p?(00T 0`RZ@p(0 5 0 P 80S$1$f/1C:0C800S   0N` 0SP THpPL`P@ ?T@Pl P0T`V@ !!-P` !T@x!00P0T0$0Bt )LBAW: NBAWd  G-0,0S 0 B! P᭎@`40S*Ѝ00qW! 0 ^@P   i@PpF A-0`c,0@St0+ CPpQ H0H CB@ 0$P@DT@a C-0`c,0(PS0W Cp@Q |0| 'B@@PEU  0P !  0 P P Ѝq s X0sC-@0Ђ D`P 004 0P 0IЍpt ))DX0sC-@0Ђ D`P 004 0P 0Ѝpt ))u0p@-PQ `@0P Rp   T0`! ٩@P 8o4Pu3)x )t )@-,@P,0S "A00x )@-,P ,\  E Ѝx )p@-@Pnp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp))\)27@-0S S2+, R0 ELh `Q tpSPC aQ* Q( H<FP 4,B 5*< 50d30a3210S G 0 00@ 7.Bp#x3@ Ŝ & 0P xXPA 5*< 50d301$10S 0 0@ d3S+ CQ+aQ# 0AS"P @0a3d3*|0p00S 0 0@S Ѝ08T)t )\)0fK)))x ) @-o9O-M`p0@  @bcc 0$0Fc# pPc0S@P7# 00" $qp3$ՎAtUhUaU bU X^P4i0E S00p$ @ 80 (P 0 @ 0S ,00#!( ` P P0V ЍVp FpxP`8  pi P`P0V:P0V ZP p0[0T$$0 $! Pp  @0 00$ 0S Z(0,  $ 8 Ep  @p|0 00$ 0S Z(0,  $ 8 (|p @0Po |  P0 Pq 0 ! P49&'E`tG- 0pP@P` V  _ 00000G S`00000O-mM0@` P0@004080 0bW, AW- LW% H8屍4寍cW iW0 p `$ṗppH40S 0+mߍ8 4i0H4: S@ @0(00,0000408`0P gP 0 0! Tp Ӥp 0Q=  0! $刡匱@P4 0V$0 0/S u<<Y7`5`"0 <E6P0<0$׊`P  P< ly w <V<H}p n/B  < n?n/ ߢ0Pp < !$B$0 @#0P!S 0pSp`Vxp 0S `0S  R  R 0S( m0H $8H@P`$pF0pM $ 0pF >p>  T 0S  (, PQ S RPQvTH&hzd@P8g}O-P-,M@p`$P("ᄖp($0S0$020S'$3pO P V 00E 0P0Ne 0O fP AP PP `pP$p,Ѝ`P 0`P , ?o  0x0 00 ` p 0Pqp Lp UQp`&,AUSG-@pP\!p`:D10S:  p o09 6X $$ Ap+ P%W00S $$ 1p YPPU `fV rV GT!P$$  p$&  @-Ho9A-@P`pP 4\ X幥T DD ᳥8 YU  A娥A g0&50 P/00#01 0"$#0O-@PU \  p U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G-8a8q@ @ 0P^ \ ^0᳀ 0S@ 0S@ 0S@@00\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PO-`$0PA@P 0z'0 0Q P ჊@ Ѝ ]P-0@-  Ѝ Ѝ/4A-0 P $@ᒁ`p'0 0mQP Ѝ  P404<A- R0Ѝ耟P@ eP0`p 0S 0SS0S$$7# BS 0S $  ` P P`$0  ` X-[-@-00@I! 0 Ѝ@ Ѝ/-@-P 4(嘣 忕 PЍ Ѝ/0O-MPp`7@PЍ P yP 4S \ 0ᵉT0P$3Q$ P 0S 4S $OX 4P S $ ዉSGڔ!0  p`000  0 0  0 @3P 000 00 0 0 "P 2 T`嘖&P%(0,p 0p$S4pS ڠ 0 p" x0 J0 `0p"P` 00P0S$O-$MХ@pxPP? 2R 4S  0$Ѝ0m Q Q0   RSRQ"  "S 0 0c000 00  0 PP̈4S 0S,  0B0 000 0 Ps0P0 <00SS PẐX  , 00`S4S 0$R V P0 RS  0 0001P\ H0H 0000 0   H;pFUSoO-P$M`pHLp @PPg@P0$4%Cdt(, 0840; Opd`o0 S; `?p 4044s p +cpp gp@ H4* R9 : S$$4SB. Wp $4Sc(d,T0 B. Dp (d,T0 $$0  P0p% 0l?$tW(d,T0|4$t0dT 0u (d,T  0p"4S    0 0p4 $  | Jᭆp J`mk 0P PFp  0Pp P LP' 0" RpP5:$Ѝ0 S0gp 0$000. 0S*+hi/ "0amyd@d@&Bkx @-@P 4B BRP zp <4(  Ѝ@Ѝd@@-@Pp P Pi4PS 4 <iA-p P@P0T `{00 Xu4 Fp( @p$$ @-#$ QS40ŲEA8Ѵ#8"( 0 / 0T 00 /$4 0T0 / $4 0T0 /G-`Pp @P1P` PP A0` `A0000⥠U:Ѝ 1000H0H `啠P10(0 ጠPU&0C$$0A@-P@-@ t`RdЍpP P 4 R 0 X-9UeO-p!PR0_otM`@R(0S00S "R0l U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 60[ 2P#  7/p ) 7/p 40 T m0 $8P  P P  UP uA-@pP`P 5/p 4 5/p 4 lC-(00pS4P Ѝ$d@ 0   l 0` 00 ( 0`WP O- 0 0pPz딐@T`  P `VP <  0 W@X- p@-P `@0 ᘞ@TpO-`P,M p@FE50     R  0  0 pl PU0 (P p0 SE ,ЍO-PQ04p@ 00` ЍP P0S*  E 0`P      04 p p#p p04pp  c & 0s@-S`@ P^0 KRP: pЍp%   iQ000 BR00P0S X-F Us@-`V@Pb `d`R^0 ?o2R0S Q0SM00 ЍpX-U@- iR sR aR p` Y p@-P@^P (`Pp OpX- p@-@T 40`PPppX- iR@-- 0 aR bR LR( sR% tR@#P 0gP0S`00ap`(a0 / X- p@-M `@P` P00͵000S   ŜЍp  QG-@M` QP  ЍAP $pPt 2B0 00  0 p`P    4 O-$MH@`P ,`$ЍPP 0 0 0 $ Y># P0*nQ P0 0?Y S0STP pY0 P pE00 PU 0ppp $ ᆁP 0000 0 pqP ᩂ4  $\ `  0V,S( 0$84 0p| $Ĕ%{!#,[PP  {T P R*L0Sh 0p_ L004 0 000 0 PM 4$$   $ 0$$@p7 O       00S 0@-C^M E@$؛$$E0  0E+P>+Ѝ0 @x("(!Ὓ"`#XT 80 ` @寛P8嬛ꤷ&P d o          0$ 8O-LMP`p4  1D0J00 p  0S& ! R"!LЍLRR a0BSS0D1 0S 4 0P $ @P  8 塁@ K䰟P  品 T 0 a0@   T  0@ @ P@ pT @ &kX-b d f  &v  A-p`(P@P 0p`P @00! 0$0@-@P$0S ?@<O-4O-4MFTX0$00\, %  0 -  0 0% 0$! $ 0   $0 0 0$!$ ,0tWH 0Sh     R _ < R  X 00S(000( `S$0 0 $0V 0EV0B$0 0$`  T0 0  dQ! 0( , 00 0000@0p4ЍT0 0 (0 0 0( 0 `00 `V00V(00ppO-MأPp E J@`FU>@`;0S؀@ `@` 0@ `'  0r  T0YX@`" R    0R 0 0  0 00 0S 00 000Sp0Ѝ A   @ ` 08 @T` T'U@ ` Q  R0P MUpP0 0S 00 0 0 RU Q T0Px n P0 @  T 000Sp@ `0TuP/0S//P/0P/C-@ P Pp ` R Q @Y R0Up@-(M@`PiP<(Ѝp, `PP0  4@-TTP@) L0 @P6S8009(@0TH&<R R R D@-R R/////T Rp@-0@P S  \ ppB \"St t@㧗h0d pppppp, !$0pp<Fs| )TO- 0`@P+P Ѝ0!S R ~0P(Pp0\4SP 00$$,0PJK8 S } R RP304S ڠ0"S1$0 @20  40 3/p 8 H06 0($  P P 0$ 0 0S (0, Pp?WEVSs|s| )~O-0,MP`p$0 #ᾇp@20S$`pP 0 0!  pT AT fT @,ЍsT00$[p0 0 00 0@Oqp 4 `00p x0804S 0 Q1!1 X R- R02U1 0S.d RL!L@}@1R R8 H0  pp0pW$00(p,0` 0S0 00` 0`Z]p ep{ 0oo`@   0Z p@iDe&T|X8s )xdyA-@ĔQM PP ကAn`` p pHPP ?ЍEp,   0 )))))G-@PNp% U4 d$! A~ p $$ 0 P ! `" $`9p L 8 B~` H00 y)*)%*Q tO-M@/PpKPDEA =9$R 4SЍ4 R $ RQ W  S P $ 4RS  0I  U08pP  0S5 P; 0  0T`P ,  ?o  0J0 00 `gp \ 0&p0H*\*s*** + +U2+C+p@-@M@P`4  t0<000 p L00S @ 0p'@Ѝp+& +  @- 9O-0TMp #$$0@`40#ᎅpP>20SK@0SD00e@ DP 0SD0SA \^<40$ 400#qpp, 804<0QP$ 0I,0, P bU@ qU H04 8P0pPTЍ$$0 $(`Vt0Y`0X0 0000 WX0 0 0S$ (0 [ Pk$00(0 00qpp 0 QP Р 0 Z!p , C$p p ,  ,&9,+*,Z,{,O-C` ILM$@P0$0d%ᶄpP50S D)LЍqP sP @0p0$  0!qpp PP`0$0$$I90P00P 0 00 00h 0K0P(0  0 0(0 040;P 4P 4  0,0$000' # 4PS,00 VU$0SxP0T ᒃ!088 X : U S   0 <0<0P (, S0 R S ,0, S00,0pU000U0   00R 0 00S[W0[ 4SX 4SU $0S$ 4pW4 4` P 4\ "$`0 0S 004 b8 $ 0$ R40H Lp 401ST> 0S 0` 0T 00S!Q `S$NP$ a@ P PT{pT T 0$ЍP`./&. /O-P$4TM⓲xp哅(@0  @"`B |@0P|`TЍ X  0P`ꀠ @ 000 0R010| 0*P @P0| 0C`l1  00B00 @@0P$ 00S+0"+ /0BYQ Y 0 $ 0⦑0P|  V# `F0,0( +z,0 Z ( 000S$EK%U /0@P0@YT Y ///C-\MP0  Rx`|p )X% 0⫩P00͵@ @    0 08@P 04 ᨑ0S ᢑ ^\Ѝ///@-0@ n 00 01 0:Ѝ/P `00CS`0p S00 P0S X0X /X⚒&3S @-xMm0 $8|@y @T xxЍ//t2C-Mq`PP0HЍCD0 0?(<p XV p1N-I !80pp0 0  P  @08 0@XWF QX9T 3S   PP>w8m0 $ P 0p UU Ѝ0 0 ppPΐ1S1SŐtЍC运2XQ' @ iⶐ`////////00 0R0/0<090A0/F0p@-MM@`Pᚐ 嗐 唐4S x厐0S h剐  . 00CS 0,!80% t܍Ѝp A!0h0 0 D [%P S 0P tF# BP=@P 86vi0t0000/0090000O-YM MpPm @`  H   Y?H 0C[?H@0剐 000 `00T    p n Q    _ g J0.J0 BFFP <#0b͏0Sq3#Fs#F?f⿏"袟jF?⸏n ⳏ$0 0!  <#咧Pq ➏$ĕ 0S,T UV:#@叏[ 0000p P 偏 m0( $8u/J(0 Bs0z/Cn#$ f@^  @TYލ ЍP!F?fR@!0FI  [ 000080 P 0 0 P3 RC2A0 A0A003#0# 0S 0CS 0L 800, j  j001/ )/d1l1p1C-MMPpA@Tt ݍЍ0S@ `  ;$ڎ Pp  0$$ Pp 0$$J/H0 Bq/H0 B kP Ha@,⯎#.D0 B W D@⥎m0 $8D❎⛎#PD  1111O-`((lM0 p@`"`%  ~pPZhPI46( sX%X)POJxU`U HU& WU( AU |;lЍaPEUP@@|p o@@@@ @`@LdP V`ҧ#000 0  Yz0SP Vx0 V0 VP0=0 @ @<30 SEP4q  0S$008 $P 0S0S \^0PU  { 40>S1># r  SP P @(`VL?XP?#?U`1?`#!XY3V`3!V⥍YPWU 0(0  P |ᐍ00  P Pᅍ Q: ,|   P  P X1  P UP1`P00 O   PUMHA )i/2)2&ht@2 ) &12011[2k2_2o2p@-PM@P`4 z  1L0$00 }p T  5P 00S  0WiR TR LR a0BST plRs0BHPЍpTRp92&22 s@-0$M\q` 0 0@P!!`C$P X PXЍPP X00 :P/`0PS 0 t^P$$0SP+ Lh ^PP ^P (0TP8h0 DP $0 q 4 QFP 4PG0P 4 Pjn 500pP0W00000S 00 0(0Z^P dV^0P,0 fPP i`P i$ mPP0;4 ?FP 4`P `P @ |DPv H vDPp @0 SD00H0 RL0( 0|` 0qpT  R$4,, 0qp 0` ᰃ$4P `$$᥃$4P`V ]`P' ]P# 3a&]P 9f0P$0 $}h`P$}hL&? ` 0qpy$p DPp5 o  DP 5  DP 5 DP 5  #DP p5  CCP P5  2CP 05q ;CP 5  FCP q/  CP r CP 01S [r/s?p'(Ѳ Ѱ  CP s/l CPu$$$4P~,eP (480C$0 g`P  g$$0` 4qp\& p0t< EP\3C<pP 43< 5C$< EP <P2 CP 2 xCP  rCP 2< SDP <$ 8 7CP# 8 Z* 0NY$ Bp $ }P$4`  0qp($ gY$  800(0 000K(040P08\ p$,` 0$00P00T0  3X/0`$$qp@y$$,$4P0H00L0p`$4'#`iqp[$$$4P`<@<&,<X-D<Z<<<= =,=4=d=>=9C=I=M=======Uf>=.><>K>X><=>>>>>>?0@-M@ P  ] [/p@ 4 pp$0Ѝ0P?'ij?@-SM@P, 0H0P0X0`0h0p0x0000 *T  \ $ 6d l 4 pB0`@pt  0 DL`|`p D Sߍi@P?i!i@-@    0`( "4`#Ѝ10S/!p@-MPM@P% PA. (01P A!Ax-P 0`0?oS c` 06P ``,0 0A. 00P0P A Av0 0A. 00Pl0P AX XA\000H 0̤4քލЍp))????????s@-1PP  $P  @`TЍpwP  00SUV  Y@@@0 R !1O-M@ Ptpp" `P"߲ $  ZP? ^ZPLZpP ^ppZP ^ T@P 0"h 0R00 p!P ! R% R/ RZ  '0P)W, # u@P_ 0S\hQY @ ߁pNl l]Z T nX (t0eW 0k0S, @ hἁP@ `ᶁpd HQ L 40R !01Sp0S 3/p\ |] 8 Xᗁp \ [ 6@ `ኁp Ѝ-@V@^@k@s@b@@h@@@@A-pY@P@YPPYd`P [!Z P KZPc@dT @- AP Ѝ@A-MP pb@@P00p`ЍpP   4 (p !0 A@i@-@p @A-P`YpP00\P@?0\  FA-P`YpP00\P@:?0\  Fm@- $?P00 Ѝ@p@-8M@ P?P1 gKYP \0 Q0s0S00-\PP  Y@bDl >  \4 PoY`bV8Ѝp@ARAi@-BMM@  p 0S 7  /  (0厠(@0S700$0/ (d 0倠(@0S BލЍ<儂@ |@i\AAAp@-Mt`XPP \P@ T0V" C\  , p㸰ЍpRAAiA@-M@   pЍi@-M @>P0C x p  1Q0r R08C80 1p`ЍBBiis@-`P p@@@>P0\ h-@PdW>[ PL ! DXP, CG/hЍpICBbCSCC7@- P@GpX 1LX P<0<( CC0,0 iX@ Ѝ0CCCC7@- P@#pl #B 0TLW P808 30C) BB@@X@ Ѝ0CC D@-M`pWP P00Ѝ![P@U se@PկT0 7p7į0 P@ PPNgDDi@-$MpWP00$ЍZ`De@Px0 l0  pP0╯DP P`@ p06㎯vgoDi@-(B  ЍDD@-000 0  P~p `e@Pb| ` @~pl 0 PR00bS 㨀6g~U 㠀߀Pxi DDEEs@-@`?PP  Bp$ ,x0k~Ep@-` MP@ WP fZ ЍpX    Y  PHW@`D,Evi 0@-,M@ P0=P0 -  p,Ѝ0 0R0s0S 0 $0YPP ( W@W`D3EBf,Ep@-P?lp@@@VPL0L. CYQv P㠮fpCECbC7@- T@P<P00 Ѝ0  p ;D^TE@-lE@-M\ @<PH0H+. t04 0o pv^ЍEBiE@-M\ @<PH0H-. T04 0O pV^ЍEBiE-M0( 00; P ,ЍibD@-@4V P(0(, C%bV@CCC00@ P/a CRWC/A CR=C/@-<00@- M@ 0, 0 p ЍiDP0@-M lP@ @dp {<G   lЍ0@A?DEE@-@TPP ⹭m%`LR?0P`0.C BP000 t0@`Vm` l0lR/C B@ @@@@P0<  _|03/`F$&DF*F&EF//// 0L0L0/$& 0T0T0/$& 0\0\0/$& 0D0D0/$& 0d00d0/$&p@-@pP x00p00D S 0A0CSl0$P>Pd 0@p$&@-p0@) 0`P/ R/$&O-0 4M@@ !T 20( D|ďp P(0$`!pSp D@T PoS@ڐAP`@ KptpP`[T000 [  | R  P Q R. 0S $P\(P  1/ P zz@0S {p "SR(0 SP㌬\ 2/P W0@)JHɚ;6eXHcHO-M Mp@p U pP< h( I`P  0Y000 rr/} ↙ {[>J0pV\ w {p Q h} }@ p 0 Q (}%_X[ O`00@0 0i{P}: 0I 07 48I0S;X`PU 0 3/P:㸢 "rCr000S:0 r05r0S X<}  4} 03/q ØI0.zNpI0SyQP" E%J` 1 `E PIE @P0 l1 LAp 1 LJA@!1 ,| ``#%J_!1 IA @@ |1 A!1 MA@ |PPU_ 03/P0 3/ݍ ЍHHi~iUIJI$&iJi$J>JVJ@)mHpJ`IkIJipHJJJJJJO-@PpP  p T )R@'RPT! ݪORH`P \ڪPPU @1O0S )|a\_\ zW *P.Z  #P'  :P! K0S 0 L0S 0M0S 0 N0SO0`S PPV {EJXH@)JP&@-,MP@pP eR`P( ` up0S hbP V8P00@ V0( H,ЍX X)8i(X!XQX@-P@0P 5cXG-@%RPP0 7`@ Y㌀qUpcUPP  fppH  H@@@a@{XX2)Xs@-@~Q@P200Ѝp?UP1U@P <` hPau X)Xs@-@TQ@P0{ UPU὘@P L` ?Pau kЍpXX)XA-@'QPP0 |`@TpTፘPP p< BFJN@ YX)Y@-@d 7PP0P CvD 0 S8800 >00Ѝ#Y-Y)꨾&=Y0@-M@=QP8QP 3QPt.QP d0P P P P"< P6p$'Ѝ0 YXX{X)7iY7@-@dz P HzDP P! (z Ѝ0z @EYYYYYA-M`@PK upp"P  (     8xp' (( pt"̨<@T d8Pbz\2PL[z RU T Ѝ0 PA<]_@P㤨 $@wp NQ2z t 0R )z k)y yPp `H`z` Q$R@z ymLP:ЍAV`P\ 0P R   1 y 0 RSyy $ y0` R P U 0pD`L PXZ8i(iZYZZZXZZZYYZ[[[Pp@-P`@SOP V  YP`P Y`YA 00p@OTpYA-@T .00`PpT 0p @-MPP00Ѝ`0 000p@ 0 P R0P 0 p 0 `P0G-@(P00`(  P1r0Pp*0X!U0"R0 "00"SЍA0P 0,  \p 0 @0@-@P Y @ZO-`,@pP(0V0S 8\P$P$P 40S 04S 0S(0p(`8P0$0S(P_O-Mq00W $0^00Ѝ`QB QE 00 R5 PP0PXU =0&P ,,b8,p4@[T /8@P00 D0800X5T (W( R R["00^P 000 ׳Ps0"CQn BQj Qf4!<5^ Xpp\PPX Ჰ  $P YQpV^WF  0 Ep? 0STt -PPX!0 T8!100#R0S 0m8\@pG 0 YP@T 0CS0 0 xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@D@S @00@D@ T030ZP@]Tl +  Q@)0#30 Sd0 00#00M/H0ppP41S (0Y CM/Zs_i)_p@-`M@jp 0+SЍpLP  8  } R #yD pp o01S k0/S BQ_ i_ 00S/@-@r)`A-P@`TpyP @ 0SP \꨾&`A-P@p `PW`X FPH0 000 0 p`A`<`&:i@- M @ph Š\ /P00 Ѝ0, 1p㭠d`x`9i`@-(M @p  ❠ 0P00(Ѝ 00S H .P02 , pw``x`9i`@- pp 0QSЍS   q``/ 04 8 <` S $S HH @S/8 S $, @$/ //PbPPPaaa 04 8 ^n-\n5e bp@- M@P` Q4P aPp@@L Ѝpi8e@- 8@*P(0/ ЍCe0b@- <@*P,03.  ЍXe0b0@-MMP "k@PۍЍ0@L P P+ljP@LۍЍ0@j0S0S1iSmee@- T@*PD0D/  IzpuЍe0bAe@- T@*PD0M/ j ]pXЍe0beO-MM`@ <:P04< lP7EgEJP47U(0'S`@0$00 `F@( 0R |'P~$0S0'V$0ʨ).0030070 0;00@00E000$ m(@!0! X l0 /C BRY  0  00=C$0Cȟ"!0``F ^u ȈE0080IcCP S@BA`p$ D80X04p` Xm!0@"0,0,0SD m0( P0B'S(0؍Ѝ 0$0'S   BS>C0C'S Q:ǟ "!! CR  ##9C0C"!% X'S8ǟ"!2.B$ǟ>C"" ǟ"!/B Q 0*Sz S &S  2S% S`r 0S R )Sx&0C'S000S 0 |Dd|0 l0, 0 B@, R ,vSGl` X>l 0R 0l`0S l0S e0  l00C!&⩐p`YP0  @lp l0S VE 04 8 <$S9tG@vl0S 0 nlu gl 0 G0cGApG00Y#q0p`FT`[! i a`V1ׇ!}BlxV-0S]  }X 4=4I 0.l    #P# $P# #ß P l|3Kl#S0S XcF @l0S$  kS sk0S k뭏 `p0VVČ  " 0`k V/A@k0S 0|Hk Hk 0pHt~0H≏HAH00Z0 `F[ p0g&V 1 !^ 44J 0k    !PT! $PH! D!l P 8k41KD  @S0 ,Sx0 iff)g $)aaFge5eUgc\g`ggPgfg"hffaPgfPg4e fg'h%ff.f3f8fCfNfXf`fhfpfzffffff0@-MX Pp@@IЍ01$d@i,h@h0 /D-&/-@- M,00@(000 P  Ѝ@Ѝ/0@?o21  @@@@0^-@-  cS_S ЍЍ/@-@LSkhl 0S/@-d)-@-  CS?SU ЍЍ/-@-  5S1S ЍЍ/@-\00S 0  0000 0ZRpЍd)l@-@fHffp0@hopmm*mp@-pMPڬ2P0 PS 0P@ 0 0 00 0XRp HlP@@ ((@,P0P4P8PS300!0310@- Mx 0 QQ@P \ zMLPP @ , 0@@>QP 020Ѝ0H-&mol)zo@-8P @,j$P A ifmo&P@-d0 !X !T@0 60\ (0000/qqqPh0@-d`  !TD0 60\ ,00 00/qqqP-P040#^4<\$0000/qqqPD0 40#\00Q 00/00qqqP-H 0:# ^4 0Q$0000/qqqP-H 09# ^4 0Q$0000/qqqP 4 <# \,4Q00/00qqqP@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00qqqqq$0@- 00?fP Ѝ4P-&A-P1@p`WЍ P 3M@P p7@-0P@U ,  dN Ѝ0߃rA-@0nS0oS@p pуP`\PPHN0nS0oSOPPOPP'r@-`0 her&O-M MA0P @ }@- @vC0S 00S0?  )Ѝ}p@-@P P0 #0/Sp% p@%&};}T}@-, TdTah}&O-`@ Pp(,夐렰0 0000 Sp0@DTq oPX0 +}P@}8 O3ꤷ&X-P-+} @-M@A> 0@0D00 l0M`p0S SD K ,0㨑 0`.U?p@-@PღP0 㙑0/Sp(% p@$%;Pi@- c`뀀&O-`@ Pp(,夐g렰0 0000 nSp0@DTq oPX0 |P@W|8 O3ꤷ&X-P-@-M@A> 0@0D00 l0_pm0S SD f>K ,0 0d`p@-@PP0 0/Sp$ p@$ȃ݃@-[B`먾& G-` $p嬐0@P0 Rp00@DT oPl0 #|PTِ|  `A+GX-[&@P@-M0A~L` @ 0P 0@?_p 㭐_\p@-@PእP0 㠐0/Sp/$ p@+$ޅ @- b_0&O-PM@ P0ndr`T"wRp)@20 R. +x   &  x `!p0 *00)0 &0_ _pM HuPfPMP- 9P GP p1g@PUP|0 0|00|0|00|00|00pt`x 0O{P@{PZ,0p0Y00t0V 0;;0x0U @\$00|00|000ЍX-& ؇-MMJNP0 @PG00 0V^pl0 Ï0 0N/0 4 F000@0Ja^ q7@-P @@0Lo SϜ 0 ㍏ Ѝ0+@-@<0P @=@-@v>0P @C@- @@0S 00S0?  aЍHp@-@PEP0 [0/Sp" p@"^s@-C0@-_8l0 0}0000000R }a}^0&7@-P @i@00PS\ 0  Ѝ01p@-@ \0P 0(p/~PP, PJ^p@F`)SO-@H `p0hH +\\\%PpH50`FVQ< 052@FP50S 5 40S4 0<0074a0:8$0000000t4Dt09@0;H4giPE04P 0 4I_08(0@0080 yPP『0       +  @   '  & B D# R8#  $# R# , @ ( "  )            &y20  y000$0 ty000 0 P y080$0 ,y0:0<0 x0:080 x090@0 tx000,0 x000000y0909 1R@11r00$000 00t00,0w00 0xz00007000+ 4 z Ѝ-&P(.&^&))X-)\ )"(1;E,.&A-RMMIN@XPpD`00EL p`u눁H00p$L0[p0KS 04  RP  H0< 000``S0 V0S0`000 pp  iPPQ8#0!D0D00V 000 0  P0b"!4b4#P0P4Ѝ 000<0())-0-M 00H 0@P ,㞊j zg ЍLY@- \Yr&O-PM$  0p @00@"0"p0@@" pLp20a0CS |2g@xbP00p00@p F! 0uP9tu P \0S R    @zPz f!!L1 _ jP 70S R  d  /z @z'  ᕌp0 p+'Yp h 0[4S08pS @p @Ѝ?BP-&"<X-ے8CsՔ/0@-M MCN@80P 0@ 0E#(00 02Xp 㠉 0 @5[ 2[ /[(80P( 0([,70P , H![0@[ލ Ѝ0@[[@FP7@-P @:0Lo SϜ 0 U Ѝ0L@-@60P @^@-@>80P @d@- @v:0S 00S0?  )Ѝip@-@P P0 #0/Sp p@ 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0PX( $0 $( XXddhhllppttp p@-4"4 04"4P0@ DD @@HHL`LPPTTX~X\{ \`p` p p@p@-`"Q@Upf@p@-@PҲϲ̲ɲpA-P@M4Q->CẲ->?n}C@X=X\:\79>᧲9>:>Cᢲ:>CFឲ 0? AC>ᕲC>mGᐲF፲E~EnFሲG 0X J~pXV}m  $$((,S>,`S>G\FYHHLLPPTTXX\\O-@P`Pp !4"4!14"41  $$((,,00WС\5 S L5sT`0$ $ 0Q`V,߶zTvT`XrX\n\`k`dhdhehplalp^pt[txXxɱ0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P#` 1R  0  ?<#΋ 0 `x 0㽱`0 C c00 d0`c Ca c0b0 0  0x  ៱\41P0p$Ss $$TGQT`P@Uyl 00 ЍO St hhȀ XȐPUTP,))U PgTTt0p@-`0S[\ @pL00S000000B0E0p)0.&|0P000/000/B10B1/101/ U갤&O-pPUM  dϠ 0@Ì `0 150S  C0 R0S3@`Ѝ 0 R` ` 42 b< RV1QV RQQ R  $%R /  l!. 000 0P0C030S30 0C0 0003#0 3#00030SQd  0@ `?4z0 ST0T00  B 0Pu SX0000W0,d00? 0 0@ `4?V 0Q댠 ,1#  0@! ?80 00C000 rS! 4A࣐8 0 B0 080$ 0C  $$ 0$080Ϧ0C40040 08 ROʌ10S  a dϠ 0@Ì `0 1%ÀQ,  "C^C C!( "^ !\T 080@o0T0@` !  R` _P/  1> ( ))U P0.&ե&O-MMO⾟D`, %5_Q0uPSi`50)QPx%?D0Shh,/nD ?0?D4hPp؍ߍ 2@ŒD 0L 04;20d04 0{0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#80Pp0 0` 40S7{ 3 0 000p0  8`  Z X &0Z``a 0,oF Ϡ\ß ^/F022292?"""0Pa 2@őD L 00 /4;2cPO 0"d00 0 o 0p,2 0r 0` 0W8 Op`xSi`10;PO0/`&22220OD05? 0 04s0hl 0@DE0 L04;d00 0@ `4 <02$2,242( 0 092?  0@ 0@Dő L0 0/4;$0 OoO 0lh d 0@Ì `01m0.&))A/&1&o))TO--)MM00=0?0,8(0mOD0D`0S> 80pW:,0 0 0 |O)))))έ\4 P@P`Pm P@ 4 cpOO3 EVp@ `3T@  :SP@ * :P (`0S0,5 Sx0<0(5002 0,%S0022Q04nQT 0QfQLtrt" 0 04 0A TXQ> 040A 4OQ5 0 4QFQ, 00 Q*=Q# 00Q(4Q 004 Q+Q1 @00T00D-\3SB1\Cp寍WXpX1X0SH Q X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001P @4po0 R\0 a $))4.&8.&F))yΦ'R)))T8)c)0.&T)<.&))) Q2! dS,QS18$Q<4R:|P @0\5 ?>C0P4p3x00084$0%<0D0t@000匐XL5P5|G   ?8`F ?   ? pm8 PEpG0!/0 p!"0 p4%p8$``05<4Rp`;P!11 8400$0$ 0<pS_Px8S @a`@0 ?@`0APP* ?-@P`(6#R0:B`@0- 00 0$50SQ 0PӘ&"P0 ?00 1>00S`0 c2#, SZ QZ3 ?00 1>!00   B^B0Pp0/2"0$ 0$ ?ҫWp1Wp#T0p10G 0K ?  0PPB@TP`P岫 嘀 00B1  B1 R ` U"B !!0 R0CQE0E ?P0 pያ똀 0 1 B0S0`0US0  B110S IO/e @P`x1| 0G<Ĕ84CP0Sp84<Ą-0$5BPSQɑ,pRB@L0 0 000060S|0p ?4HL4P0@0 6@᧬p9' LK@00 Q<=}D7\5?>C0P奁%4tx0]p7(T0#2! a, A3 31  0@`0 04 p  0H$4  $ ( B, @%LV.  R*h ((E < 4(r X @( \ H( ?.@Xt@+@B@A.@B,-8 Hup妚 @40 pK ,p8d A YZQ  Z0 {X R A/  pW <$?.t{4Ąß  Rï80\@$D04 0H4( 0ĀpP2 R 5#< 5423倂r0S.Ṁ됺 ~z000d0S CQ c6Rc,`P 'z'z {'+SN @<0 z0犸 00z8'(Ȋ (+S,M 00 SP0\h!P !0@ 1@儫0 pQ0C&0S`@ RM PP0 뀠@t7 -J0jF 0@k`K!00S>)^F),)&ht@P&q)@lTU Tة))))0.&))8 ) `00S<  0 (#0 (0+ V.|00S  R 0=S,0S10$0 1H@(p  KPP04SP0 0R0 S00C0> S< 0,0g0P0lA 0,0S9垶 p开8嘥ȿ+" < Q \%`R 0  ᐡ, @400(0 0 @DU@, 4A<2, R40@ `0```0T0](tb 0 3p ` I20 P$5"S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%R`# R0C00h0$l`0 R#00B1d0 R*%됃U` p 0 0 0 (0 0C0 (0(0 S 4`R` { $%R l 0! `04 p  R2d᥾ 4RT T  4P%QXԐ R, d0 0   , z  8 @ i`Q ĈH0+9H, eP+Ht 㴈H00S ,00C."\ ^  00 0?d 2 B< b10 P&K$01=S,00CU i010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0  80 C  0C1448000C ST0C0@ ph`l48 QT* B!44 T: $5Sl0h @0 pp^:S $%S0! !H`$p$p(0W0x0S ,4 H d,04  0,4 $ 00`  Vj0S   0帀0 Xx0#`0y X\H># P 0?d @ `0 <j 9\%R 90SP Q``ƌ` $$S :`R` $%Rl 0! ` p   R2d :RT T  :P%QXԐ R( d0 0嘽 啽  (   8 @  p;R` /  `@$  $ ppS $S00S@0P뀐 HFꡖ 00@8p`0x(1导pYU0I@X!@@000T: 5@$\ Q 0@08(0 凼 (0d0O@N 0NC n 0p 10SD=0S0 000S.I08C0S= %>#\Ő\   0d ?0 @> `2<N  $ I0000P4>0S4> 0,00C0S0 \>0S I0S I>0S 0p I00@P:*0ELP>0SN`E C>`?0S303040404 0#pCVW*HxV.GP`oV.GV0S ?0 PS?\5=S,??^ E?᥺0 0S 04 [ dLĒH 0@Ì `04 1,$0S0S 04 C d ,04 0F 04F)ݍЍSmfG-`RMXr@ wPPl wP\` `IP P9 4 Fp 0S  'ߍ<0H(00,0 00004008004004 04$0D0(0P (W[  FpUt Fp*h Yw\F 8 `B < 0 $   0,00  ` cFp 0`?`a8STjPb   00*P*00e V 0* d@edA3zd@ΪKTeqA-@Mp`;@ @hp@ݍ P0@0@DT00 ## p@-@P᳋P0 v0/SpX  p@T $=R/G-P `$ 0pp@V` 0i@`` V`@&!D`( G-P`0 4Jy Y0000008#8$#48#8Y\dp 0q0! ## ?@Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@p@-P`pPPH a@P ,0, u hP@p0)Q0)O-4MX00\0p0`P`0 ,0Y , 0S P 0 umS2aSMS ASB0Cd0b0CX S0SSU0@0T 0DS d9R$ 0 "P T 8 0U$UQUDT P 0 sS@ @ @U00 @@@ X 0x0  Pxu0S00 000 040 P4Ѝ輫۫XO@-|,@ $GAD뼫&@-0 @   ᇽ 0G-@vP| .lPE`0 00000BoH0UB?E ᴀ`')-)P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p`')0P  C @-t co`/Ds@-PL@` 008+V  @tЍp8')`')es@-PX00SL0@`ă5#000<+V @tЍp4')8')`')h10 PS/C-@PQM@MP`6`@f$a b1 P0p9 0 T:@6S0O@ D6 DۍЍC+ 0P \ 010 S a8!#4a4# 0^ ;0PT& 0+ۍЍ4')`')8')P')<')G-@B`p )PP$"*t 0F04( 0 06# R 0 !)t0 80 0 !Rt0006&0?06 0  B 00C0( 6V0:!`p`Vp 0ᬡ0$&? ड0(0 6 C c0&0 $&?፡x0`L0SV&% 0: S u&0 d ЍG+< ((`')3&A-Xa00S FT:p5)PP  0 0 A1S0Sr+ P @D A01 S js0S @2106&0H+0& 00C00&101 00C 00`')O-CM`(HPiB?O8fK  08630:Pp` uAo ~` *Af j⻷p26+?H0p0t0x0>f&1 #?1# 0RP*d  v0 lP0哷PPP rbv0)%`P V!%P 6 \ L!PU:< U+:0U: Z'0 Q'0 h℀"L0SVXU:: -<')`')@')8') 9c3&3&ȴP')H')S3&QN2')X')J')b0')4'),&ht@P&<kpyAat~3&A6&Է5&-)`')8')p0S :W$: 0 N6 Pd 00P W:   㓠 p001p1Pu1  !9P  <`U&D1X!6`0U00 h hⴶL0S `0 1 #'$/%16>jH0p0t0x0l=&08020lP( f <冶DL<X2 `p2& 0h>Df0?o2U+u᯶&0#੶6` c2H> H0 HD=CߍXAG-`RMXr@ nPPl @nP\` `P P9 4 =p m0S  Cߍ<0H(00,0 00004008004004 04$0D0(0P W[  i=pUt c=p*h n\ 8 ` <4 0f $b ^ Z 0,0T0 P `Ƶ =p 0`?`a8S`Pb   00*P*00?\  0* yd@edAzd@+¸θA-@Mp`;@ @_p@ݍ P0@0@o;T00 ## p@-P`hPPH 1Y@P ,0, hm @`P@p-*l1*@-`pᒶ  @P኶00S0?0\ 0S 0 9mS\F\GL0 \ gL0 SDKT ЍE%KUJ%FZO%A_0 t@-,HH@P @R?88h0 , PI?U@F<X&?A-p`P@.P V 0 lG-`RMXr@ $mPPl lP\` `~P P9 4  <p 0S  ߍ<0H(00,0 00004008004004 04$0D0(0P 4W[  ;pUt ;p*h l\{ 8 `w < 0 $   0,00  `S ;p 0`?`a8Sډ_Pb   00*P*00Z ⋠ 0* d@edA$zd@<EVbtA-@Mp`;@ @4^p@ݍ P0@0@9T00 ## -0<\   RS  0 S&0 /5*Q@-$ Q:zO-@-MMh V0d00h00\00|00p000 0L0$0l0(0t02000040<080H030<004P04040F00G00H0040P0050<0p 0S00|0000000S00\?00H R00S <t0S nPt|0p 0l0- Sd0h 0>0i/?9pD |0@ Sp0@0aD 9P npD 0@S/qb@P\#9pD :P (RTl0S 1 : S  R 5   ㆯ`P`0z W`r`Foobr rPV   vP  q@DPH 3}pTrd0h 0 0d 0Dh0d0h QP  h0|@ FҲ0S@040x0 0T0X0@0`0,000$0 X0R0 X0R@00@00S@0S100{ S0T00RS 00R0 R0S0T0z /a+a`0P00 pR  W 000dWW 0`S`SV Z T @0S X0S2|0p 0/>0D0 p| 萝쀝pcT* ppv @@0S ?X01?0#*@0bph X0S*Yp_ XpZdh 0[J U  U* >05[R[:L0Sd `!0SV 咣PX` VU L0 0` V I`JDuP04!$ 8!0 l023pR`P fl5&>CJ3 0< S0|0| 0$02#|l0j U00l 00 00H0 30R8 00R000L0L0S0 U@ $ 0004Q t R t L0 p 0H0( S P0S (0dH9H00 (0800\0S# U0( R030"S Rd h0B$80 S  4p P P .( (0S U0( R00S $4 0$00000,00#40*40`00 01@01X01T00 U0 @  0 <0$00(0x0,040303)00000 0$42?@1c4 04v 08#$0 #(#< 0 0 7 =Q p0Q\0S0000to00 0 R  P pT ,'? D T3pc P^ ( \`74 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |CQ`000S  0! UQ0R0( lR00S LM(0 00 25 010 0P B24 01(00(0S PPp@-P`_PPH P@P ,0, %e WP@p5*m9* 0`( "4`#/   k B* {S@--Qi A 8 /eAD00@- 44@4P\P 0B"" =*-@=B'I*@- 74&G-@P ` 彬!>0KP V0 0  ePP GtpP`0*X 0d0S < d0 جV =*\-s@-@lP 0  7X X0T5LЍp *P `7$ 05=*=*@- 04$#$04IQ   5 ЍA- M`  ⊬ P^@1 P00 !0 05))51 (5b7pQ`:5Z7A5F@UWPE: Ѝ5.p@-0M4AP`  L 0 0 010R  4   "!0Ѝp@5R  $   "!R 0S1$#$ 0("( 18#! 0Ѝp@f50Ѝp=*y  @-u1pc>*P@- 0 R * 0 #  @0I*P `00CS`0p S00 P0S X0X /XN6&p@-`Ῥ@8!RP#<10<10 .810CS81V <1S 0<1p0 h偞d`0蘬Pp <10C<1(0 810S81=*9&P&&>*0@-@-4MT 4AQ`4d4hQ 14`"R d2RK4 4d2SA t= hk0:P{PSH1A k> * +['Hk;[E{7 ; (+S PPP 4 0 @@zj{ k[@  k[+S~44Ѝ00B:tk{{'*k[+Sp4@@?-C6?Y@?*=*X9&8@*X@*{q@-ルk0d2S1=*@0@-0S0@d2Sm`2"R29&=*@-@ 081 T 01tD t4 t$0#-S<888xS`S)?S DS .  <(8(Py*0C @/K+ C 0BK+ ؒ00CS00PD*a0CS00 e  ӢPK 0@P< 0@09  90S90 0K +K  ?hI  ⬢PK 0  PK.  K    $(  ⒢PK P 0K. j080    v@Pjkk 80SL8  l  ^PR_?0<0>080m?040>000>0,0?0(0?0$0?0 0?0?0?0?0?0 0?00?0?-0I?V0 ⴠ  "`PK PP H70SD'0 0C!0R3 $70S0Sy K  @PPPh V⇠pᄠt0@Pp n pzthP@@0X"T  0T\  XpW LpS  0QSL0QE0P@k0D` X\ X0D S@0S( @DU2 PP PP<K 0P@0 K. z/K>< 0/ i. @@jpP @v XI G0S$0 0C!0R3 40S0S 0P`0kP `0zeP c=0 ,C0 0 S;.000 ./+ 0  d0d0@3 ၔFS p 1 01 Q 1 \R \>?p@1cDD0X(H`D# R  D.  Z   Y   \0T0Sp D00D0, L0 SH00H0H P0S  dA  РP0S>$ = M   ⻠PcݍЍ @  :Ta?  ⦠PP|A80S  0 P  "h  ␠P 8  ⃠Pwy `B   uPPi@t0SC i000+ KKDD[pP+`N+J+]I+&6cI+:&%4'I+bI+I+gfffe}@0@-0iS03S !==P+I+`N+\@-@hh` 00 P @4 0   xU+yU+@-`0@Px0 B0PU1 S2P T0p0S 0@ SB80( 0p- Ѝ:&I+I+P&C-PD1`0B8! Y!tMR!p@  10S - tЍ000iS00S 00S  d `P,W @ 0 i P ᝟P000 p 0p3 W@000:&I+I+P&I+I+:&`0@- B@T0@T0@1 S2 0P   0S :&I+G-lQ0S ``Q @P 0S 48F4a4qP0 0@0C!R! 1S1 #Y TpЀؐP` U0(@P 0E!0R30S u | X,0S2 @TP`00 $ @I+P&I+I+I+I+xU+O-0B$0 pQ0US P`P PP"% @P0 D  0S= 0S: P05"  UE  (; V S 0S00V0C?o20SP@Yb PP`30S  v,x#0ES0000D30S ЍY9 0 X@00020S ?P"0 @,rX0000  000SH 0@ , 0 0@0010S P0 YQA 00 0X@I0000S X0000000S~ @0 0 n RT 0@s0S @ 0 $ @ 0r@WH00S \0 ,}L (+4I+I+*P&zN[&xU+`1A-0S PP@`D1 T0 :414a PU @T*$PXP@`0S 0D !0R3 Pp U 0S 0S  |M+'P0S0S `0S < 5+s@I+P&*I+xU+I+I+Db0A-0S 7|P @`pT V @TL$@ 0S$p$00E`@I+P&zxU+!G- 1RR0堑S @Pxqx! 0P0:ЍS @L`P$ 0/C *000j PP@:SR  0*v Q ]y`P0td0 r000 i000I+I+J+P&N+I+&4J2O-0S b00 @_1P+p P@ 0P0p0Z: P0-:p R02:70 R S U+:SR00W 030"S P 0000 S' @@   W0:0 SPhn \ X*000P@ ЍI+P&bN+I+J+&C-MM$Q@P0S  @p T0:ۍЍ0S 0 CL000@T`PP@p0 - :Y %  *000PU I+P&I+{0p@-0S P`t0 U0p(p@TP` 0Q0F00S <@I+P&I+A-p`P@P a)pFpDorPT 00 0CR?o20S $P &p@-/0@P᷄ 0Pp SRpU+@-80S$$ B0A A)&mI+&A-P0`0pO0000 Sڤ/0>+b P0 P<VP@O 0 0O0?U+u+:&0@- @00埕0@0Ѝs@-@P`P @TZXX (?0 00?儕+"+R  + G$Ѝp&$0L<S/ @- Pu+>&2O-@`CMV{ qP@ `0DUCߍ貀TX B/B0 S4((.j@0PS  b8"#4 b4#04!40010S 0S 0S0000崐{'{{g W:0000Y&*Ȑ0S i0 0S `0 000R*Q p`:(0S L `X0S  ` I+`o+}+I+P&D@-#p @,i P#0@0:& l3O-p0]MS TTPcPC L H0D#&00RS  #05 B &np2"!CUURPP "2'W  0"&00RSZ  x0x"&hZnp\"d HUPD"L  Hp8@B@@@r0SPY : SVH `P؀/0 10L<aS$ @ ( D {`  8<P  8H\  T Ђ X ` {ŎP <|'0!00hH/0>+b P< 㭎P P Rc0?0H @P RVP%PD 4  9'L P AVPDPt]ߍI+P&I+I+I+:&5wu+>&VN+ U+Y99De+&B& @-$@0 00: SN+G-@ q `0S+ ~"P 00S P0 S00P R HRڄ00S t&  Y`P 0 Y00:$00S ( &I+I+&+DhG-AM`P@m0pP004 0AލG/00 08/P1 00C 0  R+ d TT&0  0 D hu+&A-MMp 00 0/R @`GGPP 0S P@ۍЍ D 8ẖ`D @P 0S !P`u+p@-0@ @P  P@p@-@!@ 3O-tM0 S 댣00RS|3|  p3p#0$hC4#S\C0TtЍODc %8PL   %+%)F0`00!Aoܲ@`L<` %L\0@ lXK= hpWW#X0 @P L<0@(e0xSiSPfP 0)0@& 000 $L<0@ Q.sp  A\!dfXDcL TTtЍ0 0C0H10S 0Sp&0` S\(!X(!h0SS  4840d0S X00\ `0H0P!xm`p 08% I+P&I+I+>&I+:&'&gu+I+I+I+>A-MMp`@PPx 0p=h!hc @PX T$L复 < 0$ۍЍ aD D< PpUY W  U`k 0 p0P $듛k  x$!0S p T0TP 4 $zR 8 [Ep&u+I+N+@-2P@-H@4#S 0 A  R!0#S 08 @H!:&0A-@P` 0 P0:t 0hp ?0@$a@00S$`V SRI+Ti+I+ 0S 0 0/ R  /0S 0 `0p@-@ PP0*D` ?0Pp UTp$/pI+Ti+0p@-P@ 0 P0: 0Lx` ?b01S 0Hp@< $ P\@P@ p$0I+ATi+^@-MMP@T 0``p/VVP   ҕP @T@ۍЍVP @p@-/Pᘙ@P@p00/00@P 0S xh0A-P@oC/p 0TD@D{ZU pD@DPXm+G-pP`04PSp@P`0PP0C0 T`4 $ D@Ti+I+G-ᜡ FPTpA`Pt0&(0C0@V$Q@$0( 6Ƙ00v`PPEPP lᩓ @$@@(`/喓` 00 @ `P`F0P p0@0 P $6 Ti+I+!@-@k00$ DTi+0@-S@ 0S 0S v 0S p0 Pgd T` R 8dD0&$ FЀP 0S002Eb~Ti+p@-@`PP50S ? 0P0 @/^Pjx0P 0 00p2O-p0lMS Z|20SHpP"PP , T P1"L0@`000@Q 0*` R 0@*b@0Sg@01 $10 8%1 0`008<\0@ A  p! ZQlЍ 00`V@ 0 /06` 0 @T`$ ~000 0 0$00(S0,00S0(0 0S000$0S0400 @0 1S0 0 0@I+P&I+&I+Ti+I+I+I+3C-0MS Yr 0}P000 ;000Ѝ  PP ^6 d `c!\ 8rP O' 4 $T!( @0@D`P P 6  ;! 1RQ rQS! $0SP P0h<#0 P`1 D1L1D10S0" 0 AD@(CD(P@\ (00(( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t> R" I+P&>I+Ti+Xsu&I+I+!;N+I+I+V 0`( "4`#//3(/")!'c' ^D00@-@MT[0Q@X0T L0LP  @  Ѝ0@Q@`o+IN+&0P @-~ ~N+&0@-Q 0@T0 R ||i0AS@ }ЍH0H pPJ"( O :&J+`o+&B&mA-p@@P 0 0S( ` `=} ``o+L0@-  Q4 0P ((" " Ѝ`o+N+2&@-0xP 00S@%*S` ]P@` 40P  $ 0 Ѝp`o+N+&]0@-@0S 0$P B5/x00SdPP 喌qpH0`P@Ȗ4 0@$ ЍI+`o+I+N+&p@-hPh@4S 0SPP * D D0P0$000R0p4/`o+N+I+s+0s@-@0PS  40B3/p00S\0 pH0@P`uM4 0`$wwЍpI+`o+I+N+%&p@-P,@P@ppP @\\0p@-XP0SpH`@P P  aH@pI+B&`o+&1A-Pa0510qS :pX@P 00P@P)$DP!0P  B@ 0  P 0000@$AI+`o+I+I+&t+G-la! W` \ 000 D! W 4q4$83(S$1$A?@" 0 Q I!Z/ , W,  000 `2 D W 83S@t00"0Ap !-ⰾ00@ JLLЍM+P&J+L+ &I+]@M+lL+O-pPEM08aSP  ,,p(3po0C @ 0T*0 ?o2W03S 20S " T  V0S  3Eߍ0S3 00"0 90S 0t"! 0dD7V V V-   B B B0 0 {"p+ 10S 0@  B B B0 0 Y   B B B0 0 KX![ HP 8 P# 0S  V    V p0S E   V     V tl p +T D I+P&7\I+NB&av* 0P/00S L1B&`o+P 6 O-M M)$ PR P  50S@ލ Ѝ90嬕e@T h500RSQ 50SM\5pE9S)0D0e000E0H0D# L8b0@$]B 00 (4 S B⏲@P%GDCB9S; B. 0 4B [T U@ 40T9 49 dj #3NY0 0ƅ3B E300 00zBwp`Pg(4 S B]w0305 3 R p 0#p   "00KCb(@62B0 05030Ƞs3303Ƞs0P 20S )Tx婼0040 S X(L#R Q0cÝ\V I $ UB l~U f1 )a#090)S )0S(PU @10S1$10Sh 0 X `y 0W090C/W pC0S 1W 0 'pWJB:B6`FVU 4S 04}+0 ZBJ`o+J+I+N+&I+B&I+I+P&I+I+&lKJ+s+O-dCd5)SW0pW_R44y`u0SW  0PS9 S00P0S 0S ѻ09 R V?o20SJUMU5D R4 pGW`pVp``崻\2 RD R: R; 4<婻820S>,P: %+ x909909 Ѝ0 +"+R ! R | dEUY0+5p`PlP d<S T(N`e 0S O P3  800 ?qp V00S |=0S 906;#;S X%uO\+x`o+I+B&I+P&&N+I+7I+@YJ+y+'0 O-RBM M@xWtPP 'P P Bލ ЍDW0S870S ,,00 P 70Si ] "4"42hrhr004488<<HHLLrrrxx||r9^ErEr:^ErE"4"42"4"42T%0A &&Z 0 0 8%%P30S` P V0A 0 ,#00 020S  20S620S P 0 Z 0 0 8%%20S , 0 m "`e00 0;10S 403/  !TCZ00  0T10S00S 0 0 8jg00S  0 4\ 0 3/Z 4   0,bKN+&I+P&I+I+`o+:&Z[["|o+I+KPiYI+s+\0^A-1(   0 !S@ 1 1R 4S8 !4q04pn0`@P1 TP0S  R-* SR/ AP/ $!0 010000 QP 0PU0 $N ?$P Ѝ0PB0P;C0d0P70S050 000 @ 0@0 0J+N+T;`o+I+&@-Mc0S ttĴpCpS0S YLPj8#804 R03 r 0500L rP5"0C590C990C9000rtPp {0S d2l"h2Q09\09 <0S <20C90S(20tSV2"CbC 2 .P5+  0R0%S P  L;#;S h;004 t0@%S ) 40+C? R 0 0B  0S  ZP 00S )XG0STP=S 000ЍI+P&1`o+B&t+R&J+I+I+J+I+kTy+II+M+I+I+Z` 3I+UsI+I+-@-  P( ЍЍ/ᨾ&x07@-@0PS `P cH0 < Ѝ0000S 0  Ѝ0@I+&I+P&|0p@-@PU 0P c;D 0<gp000SP [I+&I+P&p@-@T`P T0:p1P 0S 0@PI+p@-@PT0*pP 0S 0@TP@-@ 000 0  xl0 dT0 P<0 <$0@ (  &}++4=FKQ}+p@-P@P @0 4 0D !0R3 pI+Z&p@-P` {00CS0B@ T 00CS0B P yTnTyDop0 @00  p0 0 SI+q&-@- T >'L00S @P@0PTЍ@Ѝ/ᨾ&I+{Rs@-`P@00S#,P c;0 fЍpR00S/P N&h0 XL00S8T A0 `| ?I+&I+P&p@- Q@/ ) #P *  P  P  p $P d P0T S0BP , %p@T0&l,0@-@MPPPP<  (0P Ѝ0P+0@- M@ \0 008 ENZ+ ۍp@-@0S mt00SPdP 0@00ኈb <p@04000Sp p@I+0&I+AP&A-/`x@P@Dp/Ѝ/SpPP +0 00(P0000S@-@0S  0S 0 000h00S@  P1  <@044000S @+OfI+0&I+P&@-@0S 0 000d00S@ P 8@00,00S @I+0&I+P&@-@0S 0 000bd00S@  Pԇ 8@00,00S @I+&I+P&C-0M.S4`DAPp0/SS  ΰ0 Q0V ! ,⽰  4ⷰ          l  Xz Z00@ 4,>ЍI+KR[dkr{@->A-`Axp@P`  P P>00 S00ЍU00+p@-BMP` 0 @E CR V uP{0FS`0  BލpAS ḀP0P S00@$Z=_+A-P@`ក<0 ] pᖀW =A+@-,AP= a 0S>P  P|=0,PP `@vPL 00p1 F0S6 0 00@10<0 `JV105 S:; S0*P 0PV 0  0P 0N  P 0 G Ѝp_S-S pq `00P D0, P0;C+18B]& +I+j0@-CM@P0, @ 0   DCߍ0+@- @ R800+@-$M0h ` X '@PHpP$ЍPU D 0P<+@-$M``0C/P@   8p  g  c $Ѝ+@-XM,@0F/P  XЍQ@-BM4@0    Bߍ/ 0`( "4`#/A-pP0`V  @  0!Sp h f< Z0 `0T  d00 Do0+p@-@PU U t 0< t $ p@Xw  P&P 7P P @/ //7D*-M M? -uۍ ЍP&4`00CS`0X X0 X /&C-pQDMDЍCw@p `hP !W200 u0002@0PS0C000@ Rp@T3 W+X( U U    ᶃ  0 .    ᦃ  \ .0HHE p8(= p WP&[h0+8+@30@-P<0TMS @Q TЍ0@# 0!Qy  0"0CS0"P FTЍ0@a  !0S SL03  ` X"d0AS!0@  0S(TЍ0@R       00P1P2P3P4P5P[0hP1 20345PfP# TЍ0@j j@P=(<$; :9876 P0P 1jS$ $ PP  Q Q } z Pr m (h   x\TЍ00+0YxH_~O-@R)<0S 0  / 00+ 0S y S%D0S" @p k07S g<Ѝ0SH0S<Q 0@x08  0lh x 0P@8N 0+8\ap@-P!P0@00 P ;P P P % P*@ P*@IF0   soU#Q0B000pP:P1:P*B4 8#8S 0S@@D0+P@- $6븂0  p|&O-88#`X0000PpP00@S'0P@@@00} P0G00 WL00L00 Ѝ@@ @XX3 "X5 >0r`0 0L X aL^WLAL^7L\ R    V 0C0Y/r 0P0W0 S L0 S #p z  ЍOxHp/00wP WL0S P- P[W ~GpP PP 000 h  80+C&PXp@-P(@P }Pp@4B&0S R  R Rh 0 @-  +@- ,*0 0000 0 # Ѝ P P P 9 & / O  -,MH 0#Q S3#: ,Ѝ X  P7@-  Q| ,XlP Ѝ0 @P .qPP |P ++0@-@QPM (1a! 4aDaS@$0d@Oo@@e% e4eT! 0S01 P Q T%< ʨ @> ,HlЍ0%(T h \- %T @ 0" P" $ @   +     t0@-Q `.@!:@:@QR  0ꈈ+ +0s@-@ `R  'P.qP ,k0S ,k|Ѝpp0 !PU U H 04Ѝp@#Ѝp@C&+ +3 @-@T T 4 0( ЍЍ@/Ѝ@; +"!Q p@-P@ T p@<   p@0  p@E H N O-TM0@0"0 0 p0 @@@$(@PP PP 70 @@wP``U\TЍ`P0  EX y R@x   ;y0P fyS ,\100 0S0C000  Q,P 40p p0 0pj R [t`00CS`0 X z 0@T:TЍOX0 X @V l   &C& @-00= Ѝ@-0  5 ЍO-4 P@pa T00SP Ѝ -Q P P P ADPP@D`FRPP @-0@ 00 Ѝ@?@-a  &@- @-AMQ M`@0Vp0l%a`Q`\0j ap0P 08\0r aAލ Ѝ0aR S P00 1Q?t0`A H!R 0Go@P~99 59~<T0 <D<@D;THR0Z0 !pG 3x+ +\ @-~딐+0@-6S x+ @-~~~~x{~pdm/}@P\" TT@ N@ J4x, D@} p +? +@-~ +&@-0h@  0@ 0\Q0CS @C&p@-@Pp00Sp8PU``p840#U :<XPp0P4P8P P 2XPp`P -7@-@0 P0b 0P0S0! B Ѝ0@Ѝ/O-dM@`P }찟P U0E 0 S (dЍp | J ]  ^?!0t 5@   1}0  ` .0 Y0BP |&@-@`Pp@"!0# U 0 Εph 4\ ĕP@TP(#P  Ѝ1-,M}P0$000000 00  ;0[&-7@-}`P`@ T@ R 0@  i000 Ѝ0@Ѝ/C&D+p@-PP@ }0S 0CS 23 0 0p}mp@X T 0 0 }a, ,Up0SpD+X+ A- (`p 0 pЍ P '4@P 0 PPpЍAp01Sd0d  0T2`p 0 0S Z`( FP `D+C&61;C-@qM10`Sq1SP1SgV1 w묁XV .ЍCVU 1S  L1ЍC_mV8[p0S* S S  {X HDH EV)ЍC?  ; {X   {X  A` TT ЍCVЍD+C&6P&HmOSVYbh4 0Q 000/ D+C&rG-JMAM1Sp=l`0 FP0{ c40 F0 gpp 0 S JލЍ;X P0{A7J. H00G1$L  $H`00P0 PupB| Lq0S8j1!0 D+ A-pTQ`1S1S@1SFV1 t1SV +AV1S 0A ^lVZS D@d0S VAM0  pF1S X?Q 1S<7A VD+C&6P&mA-a M0T 1!0!sr 00 0-04 0*00 0"D+ O-`bM0弐SP@ |pTp= ,p1{,0 YpYЍF  @[ I0S3  g,{0S@0 +poLpT 1S!1T p 0  T 1!0 00 0     !00 0d,, 0  000!008 0d, , 0 D+*<Y0@-,M8p0P R/ !!jP\,Ѝ@`@ @y(0`0$$0FyvPC&D+X++cG-XM`"t@PQ% 0rS zP @0 M 010000x0 0P    RQ  XЍS @0 + 0P@+h(A-8Q夁X@`!1  0 0AQ!pRS4V0 r1SV )AVS 0A ]jVpXTPDP@XU HLA 0FVD+8C&6P&b0@-P$M@0000 PPp$Ѝ0 R p |0d0 0 1S40000 0vD+O-XqM 080@ D @CT Ѝ0ZЍO7R`" 1!0 0 @@p Y PP 0 @@ p R Z dd 0T 0CS0<0( D+X+Iq0@-P,M@0 08 0 PP_p,Ѝ0 P  /!! 0Q P0P-; 08lQ(g bvD+C&p@-`M@0 0( 0 ``p=Ѝp R  /|P10 01SL0L /1S*MP !"vD+C&6G-@M`Yp2 0S 0 00 (0dP (P(0 %"`P(` P@P@Ѝ`(Pv$PP ( $0 PPp@ЍG.(` 0v ( 0C$ S  0/v%Ppv00Y0S Y 0I0t!0,Z,pH1! < 0( (`(Pv ( v( V((0$ 000  00 0 000  00 0P$ 0 0$1SHs"<!!!! hD+v0D&C-M⬀`` (pvW0P0 000 0 dPPQ ЍP=@P/ PP 0  PPp!ЍCx 0R $ .0W400(00 (P 0SQP v 0Pp0!00(lP0Slp1S\`D0S U 0 $PvD+0D&0@-P,M@0080 PPp,Ѝ0 R  .0 01SP zZj{e[fk0KZe[KK[K+SvD+O-MtrM00`S@ iPTO 0P H-J@ u  Y:@0@0E /p.oPٍЍv  p  Y  - v "QPR0% !*1 21 0T 1S1!T0 0*T 1!0 0*P^p 0 D~T @Np  0 DmCD+,0CO-JM{ M`P@4p03~<0.p0`400pc?c8000S0P0S@pTlK+!W 0X+ 04@pW8pr4S U08pA/ <0:0 Ur> r.0 014@:@#TRT 1S-  IR:1t Y00 ! d \z@}403p0wG, A`,`|pG y, ` ,`뀀pG  y, `  ,`pG  y, `| ,`pG  `y,T ` H ,`pG  0y, ` ,`pG  x,`,`pG  x,`,`pG  x,`x,|`pG  hx,Ps`D,o`pG 4x,f`,b`pGX (0 ~,U`,Q` 'HwQ (  Y\'0Q00S? 0YS; XQ;X PED0t4H01L001Hp`00 D0pppMpXL010@sXp&4 0#Q0X00Cs 1SPdX0@sYG4 0BpYPE pW.- 0;/ c4_pSu ,_,갠Z 0 R(0 R CpP s 0 0 03AP7/%00D0 Jލ ЍY@ 脟 RH 1H0 pH0S# 0 0 @3S H  \8p$W"RZ 0 000@P0@3A4/d4IpY 0 0 @3S$1R 0) 403001P 0 p 0400 [* Y St0 S P40Sr 000   $ $ 0 `p8`0㛣#0S P   B ( P R0X0,( n0P$0 ,(  s$0H0 pp.p0p?   H0 ppp0p.;㨀H0 H0pps0 Sp H4pP H0 pW t00H0 pH0 ppHp0pH @P0P pH0 ppp H 0bX+8D&_10D&D+[ + ,ARd+iC&O-qM쿟`=P`c@P U#*0T?SD00_딟pP0.0809p R  `1`STyOP`  q00 14Pq0 ,@P 0S qߍUmr 8ͻ80U  0Sr0SplmPY yL- mP.U mP mP040 mP040 mP m베P040 <mP}  m PU  }r 8 n80U40<  0Skr0S m P!U~  ^r 8 ᝼80Up; 0SLr0S1!R00:qxmmP#UW L 080 Rk aBQ@IKKLGJ 2  p  Q)PHFDBpr 8 F8 Wl   Rq R0!P  : <0<00140KS0J  X01S 4PU U0H?o20SU0H?o20SU0H?o20X0S l q 8 8 W@   Rq R0S*  %00140KS% 0400qAk4PU4KU* 2k~q 8 8 WX  Rmq R `0  0140KS0 }{S01wXu40Sq  Kv 0H0lX7' ZX` 0sXp0;p0087\w0@QP900.@D @8A-p 4@P8B,\8 0V80 R@00@0Y-1 ,`040 0@4pq  @c40$ 0@ 6@[808 p@C1!0  p' <04 @1@S 0 o 0H0c?DpD0H 5pW[HPp0 SX Zho-0E1 d! n`0D00 0``pps 1!0`1 00CS$$1t' = `@P qߍOtor4S 04x4(0 0,0c?0040(00p`000, l4 Zp8Xu,q RT=00D3` pk@P0=S 8 R`  ckP 0=Sc 8 R @`  VkP 0=S 8 R  `qߍOY( T W04@00, 0@WD@)0S M1S ^Y   pP PU- ) 0 0(00,00 03A5/00P9T"Yi(,p@\PW0,S(P  T'&o XqpF o0"S o 0 SX0T R l00SX S SY FP00CsL "l 0P LpT00 T0ppHXA0 &p000&00' T0D+C& *|8;WYwp[8D&3U+~ lX+0.hpT00=o0SS@@T T TK0P 0h00L @=@0' @00& 00.0000h 0jP:\0 .p XN qߍOn0S\0 pP000 0000( , 0I0s@-n@ 0 P= ^p }` P @ 0  C 0"&t0p@-P@T`i P  p@4kp@in +K#P#p#@-M @ P( ;% P{ۍ#p@-IMM @`P9IލЍp VP0 ᪸0 pᤸhP 0S 0S0 H0S  [P###+@-M @ PDۍ00 R  ;P#+H-3MM pPPYW @D)iP 03#iP@ sP 04iP00 S 5P P00 S ) P2  ix `Pa `2P XhP ,]PP00 U,00P`f$0SPX QJ0 PJ |P 1J @Pp10S h 0h 0dhPPPUX$ PHmU  0 V, )ZPmP`ZZE_oR 0WPP$mU  4S J $P tᐷp* \L07P####+###$$C$V$\$$&$$$O-M Mp`;j/p p P@@p #p p0W1p0Z?:0S ލ Ѝ00W@P @Pxq(0IT*20Sa00 00D1Z7 0V98 Z RP l1Z.  @gPZ 0 pV㧉 0Z 3P {lZ.  pZeP mlZ. _KZZP bl 0Z. _C|d%edA+ %p@-0M` 00XPP0 P@XXP Ѝp@ 8P i 0 0P : `ЍpK%0 S C/p@-@PeP`eV pp@bgpO-P-Md `\0N`QMV<,Ѝ`JNu0PH0 H 60PD0" D0S 4DH rZU U U;x0@e|6〴x01tx00Sx|UP@0\ 0S0R0SX0 0P809 H0PDp` 080Xp*0SPx ?@e3S00 P 3S00 P3S0P P|0S|P 0000000% @08|0@P P0‹H0` @T0,4PD00CsD0;\0S 00T0[S40Dt,0僄 b  0` p ,0 ;@ p H@l0@x0ce80J~S01804Pod0S 0` S_ 0@04L0@0p?h0?l0L0?p0X0S8 z@0竸z0相SGx ?d|08 tx?ɏ 0d {00@0 C0t{'{dL< 0Pdt 0`P0, 0P0@00,04 h00400 l0@000L0T 0p00T0JnU0 00* pDY@&&&P s&&&l& Tɚ;&'*'J'Z'd''&'? 4 ;$ p L<L    p @0x C?4; $ p 08 0|0 {0000000 P{'{x,ʟ 0c 0`c 0 P 0ST40T,0[Ⴤ0S00僔( a p 0p` pz $; pr ,00 @S4004$; pd I0 x 0c 0`c,00 @S40 0Pc0 xP0S40Tt,0叛{ჴ0S<0O 0 b 0 0`K p 0 p4$;@ ? p <<0*?ᚃ# 0@1 p ,00 S40嘰04$; @" p 0$n A,4$0 F0`|0P P A8{ {'{S0$x`Ɵ A,4$,00 S40 A{ 0 {'{c<0 ?ᚃ(<0P 0c00  0 P c 0P c |08%Y@&(@-Ui }}W(&A-p@4`S  P:T0DPEE$UX  dPV00vdP V0-08  P (3MDPE@D@+x( (p@-P@Q0 ,0 pKdP@ R 0S L#Pp 8T4 00, 0p$u#D&+(r,(j,j,j,(@-2800S ,0,0 p \A++(P+G-MTM0S0 DpW,Q44Q`@`$0 Z0A+">P 0  0ۍЍ0 000nS ?S aS ppS qS|0 | 0h 00L0岑@0 ++(+(&+)&N))6)[)A-X`0S L00S @P@@0p0pP00++++T0@-@@b2@00S&,0, 0S00{&+++s,T+RC-PtM` <ş< @ !Q RP ğE R`S at`F0Q ğ ;   T-P ׇ Ä CR ` 0S $ Lf@4 \ P00 4ß@Qk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\0H P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+R`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 L00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =&&r,r,n,j,+*PA-@@P@T 5- @P`p0Sd`0 @ FP ,04 0 0@A;*D&+F*r,j,J*A-@Pp@0S0P0`x0 Rh Y R0T @ 0S 4!P@` j,`++D&l* j,((P@-,0 Fr,*P@-,0 :r,*P@-,0 .r,*P@- , 0 0 Wr,+Dj,*P@- , 0 0 Er,+hj,*P@- , 0 0 3r,+j,*p@-PAM C0 0@00 0S0! ;P7 0S409?PP0 0T00aS` 0`0S 0`T0 0 0@0S0@T@ @0Q0 00S0&AލpP4,L0 P @0  p;P+ + s,+s,r,r,+O-1M MP,t4 1ݍ ЍPX$Q;P D4@@@/ ,P_ 40S d_P 6pPV /3 sP㞏0S30S 3Y30S7 0a@P0 |300p3 0 #X30S0 %Q03@OoB0B%&Q 30S 2 ` 0dP0002`P0 0R " Rd2 T" R E@P L2\"00@2 0H,20S %W 2@OoB0A% Qo10Sk 1pP0001p^, c0  AP0S0=,`V 咟Q 10S 00S2 0@P- 0! 0000 |00S % Q0@OoB0`@%Qx00S d0 0P00080`r,+++ P++(++r,s, s,++s,G-JMMPp 70 0@00 0S! :P+ 0S(0=PP# T0  1 1 R0 0S0QW`5 p1 0Sd1dmP*L1 @JލЍP @ ! 9PJ/W#Pʡ0 'd0S @$00 R000S0 00't0P06qp P0ST00@+s,r,s,i,+S+r,+ s,++ 0 0 0 0Y s,+ 0 0 0 0 O s,++C-KM MP,*2 Kލ ЍP"h9P l2@@d200PR0/^P 82 0S@(2ʌ- P0 Qo` 0S 10S1 1 4@P -p1@d10S x6PT1 {0pP 818!0001 00S YP- 0 0 0.>?0T por e&t@t0Q00S x0p0OP0 00P0pLr,++ s,(i,+ P+++e,r,s,s,+++PA-AM l)0 $P'`P0 0 ꌀp @G Nx @0 0\0@@H;@C0+I8PAލ0S 0 pPr,++ s,P0@/+P@-))0$ 00 0r,,+Pp@-o@P P `hP XP )pU ,0Q0  C0 p+++$,0 @- 0,,+r,P@-((0 00S/0囋r,++6,0 @- 0j,p+r,Pp@-0o @PP0B c0S 0 [q0S P (0 0pP@tTP@MP 6P(00 ,2s,++ +,,+r,+y,0 @-[ 0,+r,0 @-Q 0,+r,@-(@(0 F 00S0  +,r,s,0 @-6 0,+r,P00P0SA- B(0 !0ЍPAaq0S000+0S 0S1000PPP00P ,L9`0H 0QD084 r,+P++-++X++ -H-0 @- 0k-+r,0 @- 0t-+r,P00P0Sp@- '0 0pP`P@~P# y0P :50P xal00?o2`SP@8 8 <0O0S000r,+++-`+\+-P00P0S@- '0 ЍP 6P 0Pd00}S`00S T0T/0H{P80 0 00( 0r,--++-.j,a,a,p@-0PP0000:@Ppdp hp@P p@6'3@0@ 0S 000r,+.+e,.8.P00P0S@- 'P0 ЍP8 Q6P 0 P0 r,+].j,0@-M P&H1 Ѝ0P0! 06P 1@@*P0 q1@P*0@0 S 0 00S P |h@Pl0  Q\00S P0 P 0gP000$0Pr,++ P+].j,++@-P&0 ЍP 0Sx 5P 0S0TP0@P00 ( 5Pr,o.w..j,e.G-@pQp`Hoobp&[P>10S|1ЍGT`pE8C&T1 Ѝ@77V@ 000 1"T9pX M(`P 0S tYPq6|0 @0J `T AZPppTT TV@T 8@P @P 0 ЍGB.i,+r,.+.A- MP%$2 ЍPR0S"5P 0 1CAZP 00|S 8P xP 0|Zt1@p@f) XP#LQ@o`010S 00CS 10S M)0 0 S  4P0 T.>00R   ]tp!1"Ql00S `0 00P0040@r,+..+ P+(++++@-PPM MD%@p1@ۍ Ѝ(`C@PC@@T( Sa/@P@F]+PI00S pއ00CS0 =U000 0w2 p0  0 e2KP(t@dr,..`+++/0@-M0P 0$d1 Ѝ0PL! 400CS0,P@/0S0P PP P@X ]T0S0 @ʴ0x @P @PW \U x0xVT0S 0H @W \,0 -r,@/I/Q/\/n/+v/+p@-0p@P0 p@i$\0\`0XPS 0S00S0p@ $00pr,a,a,+//p@-0`@P0 p@C$L`LP0S00Sp@( 00pr,e,+8./P00P0S@- $0 ЍP \3P 0h$PL00}SH00S <0<Ɔ00P 0 r,//++/0j,P00P0S@- #0 ЍP !3P 0l@PL00}SH00S <0 劆0,P0 r,/0++O0j,p@-MP`+ ^H@T` PE+ H0ES(+ H@0 ۍpW0;*j,@-P#@0 ЍP( 2P  r,Z0o0@-Pk#@0 ЍP( 2P  r,p00@-PP#t0 ЍP 0SP 2P 0S0,O |2Pr,+00Pp@-)#@0 p4@0PP0 3Pp.r,+000@Sp@-#D0 p8@0PP,0Pp r,+0Pp@-"D0 p8@0PP,0 Ppr,+0QoP@- "(0 00S@,r,+0QoP@- "H0 <@0S 0S Zr,+@-R0P@-000P0S "P0 ЍP@ 4d @P@$U Zr,0n/p@- M Px"1 ЍpP! 1P 0"p`1`'0S@1D0 0S 1( JP&P0 0S 0@T 0 %`"N@P U d@ A0@ F0 @ 0@3/H0T 00S00%r,0+01!1T+ +:1!,J1s,0 @- 0M1s,r,0 @- 0Z1+r,PA-PPPPU㈀ !00Ppp@h0hP圄00P0` 00}FT,0PA sFr,s,+t1r,r,P7@-A P000t00 Ѝ0P!0P%0SʰP 0 00pK00S@ 0 S  @dK@00\+7F0 S +<0F4 0Pr,r,+1++n,j,1P@-00?o2 P a!0 0@0P 0P t P 0H@XR0 L< B S00Y0 +r,++1++000 0@-S0 0 0 +14+r,<+000 0@-S0 0 0 +18+r,@+p@-@Pp@0 @- 01 s,r,0 @- 01s,r,PG-uR@`p]P\T- _.PPgT`( X.@P`_$$V; W P10S- D1D!@1B0S 0(c`PKV1P1@W 00S 0 0B0S D N$ K$t0Pp0@PPl=P \8P L3P t Ѝ+++,+0+L2$+(+22+ 2 @-s0r,P@-Z |0 pjP \00}ST00S H0H @ZP40 , 00$ 0r,2++22j,a,a,P00P0Ss@- ' 0 Ѝp0` 0S P@P 0Q R   L 0Ѝp@ł$Ѝp@r,i,+S+ s,222Pp@-(0 p@0P0Ppr,+&3A-P0 "0Ѝr0S2哂P70S10S 1兂a0@ ` iD0封S Cc!!b"  A   c# P0U0C00CS0<\ P?00CS0@8 P7,! .PS0p00 P0 b" R  c&0P UR PE 00P0 0 Sp(0L0 0 Sr,+++3+e3+++&Z333P00P00@-SM  60 0Ѝ0Pl  s.P 0y*qpP@ 0 $0$U@00r,++3P00P00@-SM 0 0Ѝ0P @.P 0*qp L0@0P+4 00S 0000r,++3P@-(0 Pr,3@- (0@P0 @d++ 4P00P0SA-쀟 00ЍP -P 0k1`P PPP 0S0PQ@Q@@f/ p3C HB B00r,+..;*P00P0O-SM  _0 ЍP  -P u @P@ 0S0@Qp`$/|0 `@P0B0Р00000 @0 Cwr,+..s, s,++Pp@- 0 0p`@PP |@P P@}+p @ @000 (0@r,<4t+x++R4A-p`P @Pd0 `AP '00.4 RU0 Ap+}4+4@- PP   R Ѝ@P   HR  S@0S00 Ѝ@`pr,4D&+o0A-0p`P0 APPp@P @A/P 00 %00r,+}44Pp@-mL0 p@00S40p@,&(@0P 0pPpr,i,+4+40@Sp@-Mh0 p\00SP0p@HD@0PP80MPp Hr,i,+4+5 @Rp@-&p0 pd RX0p@PL@ PP0< $Pp r,i,+05+\5O-MMPPQ 3 ٍЍPʴ#EE3,P 3cp@Y 3  Q`P@T)A0㓄(p @0S (30@ @c0S06000p`J2p2`0S@$S \S00@# 0!|"  0 #" @00B   BR 0 F )b/A0 O`0S@iR0@S 0 F)bA0O`P1#h1 0S x10SL1h`10S ,0 00CS0. k E @0 03/00S 0S 000CS0 S0  )t@00000h0 6Y 0pS7 r,78+++B8!,&+Y8n8+8+++@-@P >00P 800P200p0- lM X00S QUH d0n P000p ++8+X+-lMbT00S 1UD d0N P,00p +8+X+A-@P p0 0C0S13N `HP@ 0 B RQ@  0 0C0S13p@-@`P:8EP T. 0S!PR |K.pp@G.H,`I*P %EP008 7.S!0R8888p@-@P |00PU uN xSPpm00p@-@0`PP<p0 /0St  h0 S Ѝ00S 0C @P2h+8P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  B&G-pP(P SR@  ,GPP0   #GPN0 0010S / ^DPe ~+`@UDP 0PS(2  `Po+:`FDP Pg+P :8DPP000S`UK 0S 00S1 @RđRp0 A\ FP0 0 U 2+.+++ 0 011 ".Ѝ @P* `> 0S000 + 0S S St0 0S 0`S@*H0PU *,P8#9+9X+J929:9+8+8 - BR0 R  P R O-M M@x PE$@RFP0DHLP0($0,8D (00,0DHL` 0p 0S 0S X 0S᚝@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;-R@P d9P X4P H/P8n0 i000S V PU@ /RV@0S >P @0U0C?o20S b4pWp 00C00p0Tp pW L>pPpUP 0S >0P00 $ 0R 0900RE+ =Z0048<03 0 >+3 x30S7tZ  )@B0P0 $3@@):B@0P 0 @)00 @`h `00PPx P00@sPS )P Y0@ 0'T00SPeU 0S} W +XT=+X=+X=XP+ G=!0 0p4P80L YA+ P05=E>0000HP1@@DcT@@/GB0P  00P+ 0= 08 04@ 0R 0S00}S{0S @0S 0S@0P/PP0Y80<0 @+9i9m9~999998+9+X++g9j,;++;$;r,:&:+O-kMMPd|UZύLHD`\X1 !0PX0C6Q0B? (p8 DA(XH(La\(PQV?ⰡT㰡0E?o20SdQ` 0S qPVV 0S#UU>0S嘛|0s0s0s0s0S0s (8>0S0 /#PPq(n(=0S 00SU o 0 0 /=0S !~P' UhMx-6>O00*0S !N*P$/T>TN0 0 *00 FQ =0SU=@ `R( (@@,0 R\KP|<0 00|S $0S (<00SH=0 {v00P 00S0xsl< r|00 P 00S{ T<0SV00.XK\ o< p< I:b,k,a;;`0S00  U j:/ 0S 00S 0P 0S} 'o`аIMpPp 0S :%O0PUIY :IBpPX Ἶp0SU 0S_ +0 0 PW%P %*@P li 0x!C_/0t1p1l10[/E? p x10l1S 0S tAT# 0S iJP  #[1  K d0峘d00S 00S P p_'tQ[Qύ00D!, H!8 P!0R iPP0000JN8880101,0i/[`P VO[08 ,ؙPP0S8 ,ϙ5E[U@`PTv  p 0q_0pP7/PP70S HPPDq/)@(',W:  S:00S q?/Ch70 S00?o2%PP0 P60S P 1So& P 1Sg&@6@v >pP`P@(``k ̵0 R< |1000@ %뤐@b>0`P(@@`0p(! D0Pn C@` p P(@@0S_ `@p(``/X+8+;;+s, <@P&6\+i,H<S<s<<<H+<Q==g9=8++A=+!,++ c h+a=T+=d+<;Y;A>V>j>>>K&&>1??}@??@8@1+X@k@@@@#A;@0 b x+%AGAZAAAs,$+@BX+A8+ +ؘ+A(s,+ s,+ࠝZ 0`0P qP0QV00Sr QcP> PE 0*S0 TQ:0-S6 HQ`.0P0*0 /R& *R0 40Q@(0000S`!0 0/<4gP 0, y\0K\yqP 020SyP $P {P vP 2 m lPn000]P 0XP P @ #qJP<0S S W\ <0K/CR032 U 0ST#0 0 WBUCZ Z8 , ē ??P  #2S\cd$<h4Q0SQ?0!@0<4 :SQP0x4 +;̺ɺ4 7u(0st4( @ 0QP LT!0S50tӲ t52S| % R 5 P 5P P P E# 55`0Əs 00@T@ 0V  &PlvK0 0 孳 2 R@ K0"0C?o2? K ""0A0sY0 S ;S0 VLFP  0 R RT <0SD0S00?T'"0 40< R /$ $ T á @"͡<ᬗ<P r"HRL á 0g%PP%Pp0S0S}880S %@P `D(X000 R0PT0% 0 p wx'xl hhl ptp Kp tP #P U (  R@90S 890S<94yP $<0S @DTʘ90S Y~ 0 0S$8 (PZ0S= S E#@9 9`00S0T0S= rpqLJ  y%Ph lZ LEPW` b:0Sb: Q ]* Q0: R:#f< ;R/sr  d/ 0A3/@p\;@l nt; R0 ;Q;+0 0 S |] YUQB$0S,4< 0R.QVBTER0S и000S ɸ000S ¸000S 廸00kލЍ0S 03/0S 婸00@-P @<P  <P0P 0 Ѝp`P G A<P 0 FUhLP  Ѝ@T 0S S0S ( <0PP#929BS<+90@-M0h 00P P10S 0S00 0 Ѝ0   @T0 S 00S 0s 0 :9P 0B0P R  0 o@T hDP 0|S 00 0S00 0000++ < X+X++@C-$M@`p I400000@ PB0P/S:S XB@ӷ_  P+4I A3p$  4/@H@P/:HpP ^@᰷P $Ѝ@P /000p0 >@PWp@00d0@@DcT@@3 00@0CcS1S@1Bm9r,PP00/@-H,0 @  000H@+h+@-Hx0 @ d00S X0X0 p  <0000S H@+++@Bh+@-H@`00S T0T0 p 8 10 10S hH@++@Bh+l0 @- gX00S L0L0 p 00 101000+++@Bh++`0- lM@ BDd C3800 p +BB+|+0-@lM@% 00 00 0rS sS phd 3\d 2P00 p o0T(d ++h+s,}BnBB+|+wB@-`PP@ 0@s8#80@U 0s8#8000@(B(2b!! P VU 0A0T0Ѝp00CS0 S0 S 0 /5O-TMxp|W0ʿ0? p00p 0G0`P0V0W B@q0 @040SD H 8PZ0S= S D0 S00 @P(fG0S bG0#S ^G|0Sp `1 R R 0Ha# +9HGtp uTЍ ? 000 $@0 PP+G0S 'G0#S@DT|0S ld@"\8$0V 0 `{#M"00 "@B++O-BM MhEPdP$P Q L?0a>0 PPP0p5(`p 5 P<$ P@+40S5V $ 0D  80XD S00H00S+(1 0S 0 S     R  T!${PP$tp 0 s8@P$bp ij0tp9# ap0tSS 00   00Bލ ЍL3@@ 30S VW@@cA ^382 0f cW T 20S 5V  R x" R " R W WSh2h <2002eW @2000 !00D 1#0U10S CdPRPU [ 1000P T)T 00P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V0     0QRh\@\0 RZ P :/ 10 YS P 9/0F3h+ȕ d r,h+++l++++B|+@Bs,i,C&D+-A-` @T ޏ0 ЍAЍ/p00$  P#xnK7l0 h @oa0S@ P 5/m+Cr,h+ȕ *C|+-CO-FMs M`@ ( @C C C0$0h30(0$ 0H,@#Q0P S%E0 $z3 Fލ ЍP0 @,Q(02@@в@aGT  \2  P 0 PD0P2d FP h"hd/\ /0S 00S 44 0d  PP  d⪫@0S00?o 2Po C06P6D01@ @p  pႫ<1  RD0(66S0d000 d0bAa0PS 0ݎP P 00S x0 0|0xlP@0H| @010`,@+0=x+H+2Cr,i,+CKC+MC_C+CC+C+O-JMGMsn0p0얟VXv600S00p 9 PX6   t60 9 PLJލЍ860 00$0 97S 60SZ6m50S# 䵟0S5 Q U 5R "P 0S 500CS\5|l00l=0S P97S( 5D 58%80SX0$000(00000 PL 4N0000Z40܀C XSX P4`0(  $   dT CP 4L!>\ 0h0d<` ((0#$0$c# $c4"($ <7 $ &R 3^0 R0S R3)0( 408'0#P30S@97S00000 0S  0 p008'PP2 0 0080I 0  A pd 087PD˩ 97R^ Ś 0S [R0sO0010S ;70:70?70>7='<@P0S0,< 00 00,x1 CP!1 R  D 0 0ZP 0S 0097S|0 0S [[}X  S[00000IQh++ +++D\+++aD4++<+`++,Dr,5D\DxD+1D4E+?EDDDE+MEwEEEEE 2@-`pBWLM LЍ@w pP=  p7 0001%1 0S<0 |q?!((00 Q 00SZ=9Q ='/@#b?!"/p B0S B0#S Pe00+0(60 8pp A0S A0#S  pp 90S0 000 0LЍ+ +h+Mb F,Fh+OFA-0H`D0 82V p R R B`R RB`b2 Q  ,,00EoE?AA?R1 $!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41  000d4@T X40S@ H40S@@840STPv40S4O_ik3 3K Pi Ѝp30SCP PkpPHd+ \3 4LS {P@0 $2000 3 )bQ gP@$R000 0R0 0|IP  AP P"@P  0 2$@:20P S R0S S @T% 1Ao0S3 1o10S x1 P5D10S  ,P01S0  0S PU P 0S 0S T01Sl%(0 @Bs,j,i,i,j,++r,h+JG s,PGXG|+| F+|++RGxGA-M  0 8 4 |(@P@p(@P@d(d $ \(\ RS D8Q  Ѝ 00-S0S 8 7 770SN0<00@0D07 08PPGEGWn@ 9PZx7,047P3DPPL7`@0 0wK9P [9P6Qx AQ ,0 p,0000f4Qq v 0S6 @0szD0s{xFP500<0Su40Sy5$ 0 0  n 00|S  0fpD,,0S9x5P5<0f t,,0S    5<0,0Pp,0cPX0: S 5 LC4 i00, 0*D4Q PU>0 00S,  P4 440S!@%`4@0@@Sh4@s `TP@40S 4040 4 (a 41S $ R 4P 3P P P CD0s D30SP 30S 30S2P30S&Br,0p` VvU㨂c48 pcU|,00@ =00 0s400@ =80030CS,0"p,040q402P001!P XQ<0S <0,3/0,0@44@f1 R0PZ=0 SB\1#//0 ? 0!$$P400@0 0 0 48 3p 400@0 0 0 o$P0 ^w0#Y@(D $,0S <0,3/4 ++(s,+G+s,++Gj,j,|+C|+0 @B& s,Gr, +6ؘGRGj,H`+t+s,H,+ H@-GM ,$ @_̟_. 0 0+(0,00040E@PL0;@@P@;K00;00 7oDD0S>;0SV 080< @ t+ RD00S0\ H0PLKNH@41S<$$7P $00|S $P$/;@{<0SR w<0 SN $ M): 01RS 41S $00-S0S |: xfd:$ d`D0S $ GߍJ0S : <0s^@0s_JP0080SY00S]9 9 p9T00$0S  T$ T/00Ph90S <0 S$P$<0 S$P$ 90SD8Q0SPDPP?D0S!0S' S+80S ((P  8d(880sS<8  01Pw00S  &PlGfQ000SP 7 H7 R0WCT41SWn$6P_x7(074! 6 (0p(0p 0: S &00&071S ' R 6P 6P P P F60SP $60S 60S5PL60S 0CSWD0S8 46 4 (p(0Q*$ $00|S Bg@$((0S$ @54! 85 580$ 2((0S5$_00\%p00(0q(0P5P001!KPL:0 SE480S 80(3/0(000L0S04 SDQ  40S 8 4R qp~ `%$'`0x0ۿpr3X@$PA  0f 儡P$~D0S s0 0 @( 0@吒P`\ (T000 0ヒPP sZ,XpJ P @`@#T,0 ? 0!%%P0 0 040 4 P@H0S@ (, TpU@000@ I:400F:0 SE1(00@N ::,00(00@T!000t 04p@ TL0Da0L0 TUA @(, p%P1 G1#BXנ@PbL fc00S 0 =<@ (0S 80(3/0 +@Bs,+(s,++++|+|+0 GpF++GGr, +nFlFs,mߍ0.1dPP0͵#4P(0P/S SUpF Pd4P PP P4$0CS0p- P P ~ P0 PsdLF.P P >.P d0p %P 0? lZ}hX}dp P 0S I d0p P0? :}p P 0S- 0S dg0 P P d00CS0p`2`[ P Q82<0 0 dAQ 00 p1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\00 p P`, ^0!S^0C0 h|P\\ I+xR`s,zR+wRi,ZRRRRR+ S?SnS&++SS++0p@-P00 000:@?"`P /:"V0#03P0S`@F@@0/S /Q ("P@@@@+p?"#`"V0 V # 3P R P@F0@ @0+pP @C @y+pu+ pG-P `p0 00 @0 0000 0 0 0 @ 0 0 0 0 0 0  G-`@P y0@pU"W/Q5U0.S=0/S@PE .S6U+ /Q1`0@PEP00'0.S%@P.QU0 0/S@PE U. C/o" R 0/S@PE  / 60@P00P E//#P`@`  0@PEU.SßO-TMP @`$0P (,pL0H0D0@0<0 s`8*08 @D(@ᙟX ``8*08 @DW00@S0 0 @U vTЍ0/S  :`8j*08 (@D0S! V/0 `0/ P*p8J*DG0@8 (@ 0/ /P @P `|/ 0@- @0SᄠP  S#P 0  00@|0  plPX0 PcP40  0ZP0  &TTi,#T/T4T00CS0 S0 S0 /1A-0aS0P0P3U b"P 00.S Pl`1h`L "T1@P H, "P0T0!0!00(1   U 0!A0p000 00000JP0 0p0S0000PTl0l0  @U x4 *P$0`X`++9T>T+++CT`T+eTi,i,j,kTj,rTi,D+T TTp@-@P | 00t 00l lP0h @Q0T0 L0P@D0@ -80@0S, 0p++i,i,a,X+ +<+@+++P0 @- o<00S 0000 p ̳+++T+A-@L/QpS0S `0S p P00`P0000[0S t`0S p 10000<0DuT $  /p++ +s,TO-`"BM |2MR0pB  h" R S4 P 04 SP 4SPP004BލЍ$Rg1+ B>4P/S + +  mP ⚕ꔡlpV0刑p00g00000000 0S P1o@19 70@ R 100CcSppW00 0S 0o0000 00坷 v$RVxDxPPT{ P00++s,+L+UU"U+s,++Ur,+LUMUA-@Q0qS0`00S Q`Ѝ0YWP bP jx0 R 0000@ Pl00}S0s00T 0S$@,,W `++i,+nUU+&r,O-4Ma0AS000qSP Q 1 W4ЍPPH  .P00tP00`}'P$TL (P@1( @ S'*000GS0P#0!+mWi,a,lWa,a,/A-p`P @tP0  T  `00T  4$0@ R   `FVp`00CS0 X PpTD000`000 T00oW}W&WG-PȀ`$0帠@TmSp N 00)a@x0@P 0=D0D 0 P 0 Ѝ!,?+WW&++O-M M@ P"<` 00\ @3  P`++P # \ 30S)  PQ PUP ắp)0F.@00002+P |"|F)F@l尐ލ Ѝ tpp<0\ ⠐ gp \═020(PS @ ᘯ(0, 0/(0, PpQ)0$S,F␡0I00S {0h$Q000SZ=9Q =*/@#b?!"/E p5w)0S s)0#S [l)0AS  \0 0 PE0 0P,p 0S S)0P) 0 psP0\ {A|P?)<00W+WW*Xh+Mb_XxXp@-@P<p@꽭p@-@`00CS0~pP0 @ )0S0`00 )0#S V )00p0 PA-p@`pP0 @ (0S0`00(0#S V (00A-@XP`p$P #P0S ⠏yX@-@P ~X@-oPvX@-@op lXP@-^P_Y?YA-0hMPQ@00 00 T  40S P -00 P $0 0 0 PtCcXY 3c0S  "@"@@ p_ ' #P pP@ 0S j@P@ ! &  P@! &T0S M@P@p! &0SIHdr0S 9 , 00 0P YP12 qCA1 PP 00 @T ! & P 0 0@T ! &P |hЍTѰ[82P@k! n&T 11@T0 0P`V"PP)w000T 00 0P@T{Q DPX+iYsY+++YYYY|Y&Yr,YYa,++++YY!,++a,a,7@-P1 Ѝ0Q0S 1 1YPʔ! 0 CRxA R Sh10R P1P 0S8S,1 0P 0S 10S 0 0"@@P  0 @0@0 @0 $@ 0 )@0 00S 0 Sr,+i,Y+Z++P+Z++/ZIZj,j,j,hj,dj,Dj,@j,j,j, j,j,+00S%@-0M@, {%0 P0S8q@0Ѝ0@+tZ-A-0S&@ 00<ЍA Ѝ/xaP0 01Ps0 0@@q/0 0S z& P,r& 0'(X(00 Q 00SZ=9Q ='/@#b?!"/1p W&0S S&0#S @PI&<00D&0S @&0#S 0@P0C 0000h+Mb/(/@-$0S 00 0 Ѝ@-㳪@P0㐓Pª0@$0@-`P0 `@P  P$`太00 0+ūЍp@-@P 圪嚔嘔ᖔO-Pᐒ4M0pS`@ 0 0/0  @T T@! $ 0`F0C 0000V*  Ip%0S1 %0#S- %0(0%0S0T $0 @0p`F@P0,0%0#S 4ЍVP @0p00000S  Y 0( Q00SZ=9Q =*/@#b?##/ \% .p T%0S P%0#S L%0 P40@$%0( K?%<00(0h+Mb+Z0@-S`p@  ㎑P;0(% 000(0(0S,0SP U. 0 00 0,P (0S,0S PU` ЍT0 0PUPPĒP !0 S 0PEUPG #00 00 0@-p`P @P,0S T000(0 ЍT00o0@ R   `FV 0P 0 ST(000(0T00ZZZ/@-+$x,<0!R/P(0<18C8S/10/x, O&[3@-CM000030S3@TCߍ|#p#hʼP ##D6<8#1S0!$R< 03/3CPQ@RTA 00@Sb@+BbUPP⒬:[P @00S 00,S 00S0 @10 3/P00000S0S 11 03/0S+000`0 0P 0 SWy000 PB0h 0P0 S@^0000S 00,S 00 S00S 0 ` 103/P 4000U0 [ ,000@p` mPh,, , & x,[%[ O&,4L&/[,[l,@[[[[ā, 0 #Ą,@-# 0 * ,@- 0, y,P `00CS`0p S00 P0S X0X /X٬&C-@Pp  l18C8S t`F ȧ@0S w 0厫`V $ Ѝā, O&,[ z,@-:"" =p( P@ ĻP :""Ѝ""X0/LA! P00L,L[[ O&&[[[0s@- @I1`8C8S P0S y 9L 5@0 N0nS Ѝp蠃, O&[,[,[@-PM\P b P H00S@0\A PЍ @Pl: \`, O&\%\@0@-@%T W:3 ㇨븃,(\-\D0@-|AT 0S  0 ݦo O&ā,@07@-PLA/d!00 0P! Ѝ0 O&6\ @-@0S S S 0 \R0 R \ @ RC-@P M?   ? p ?p@` sQT@D0 @ЍC9 s0,c@T*Q!s00TL&9\[<\G-AMMP`PB|R p2 h2h S\2\ l 0 0 0 0 ` 0R  0 S"#O!@D`㝈Ppᨡ0S1  >10S0 0SR'@@T  T Hl9D1< ȠLȠ\ q P0 [!1  !)AލЍP0 SS  S0 0< ȠLȠ\ p 0圠0CZ ȥZ <)90 @ā,\,,,E\,,t, y,* K\ O&Z\d,,G\0@-EM,P ⶦPW@P9Eߍ0 ,PU ͥ ˥ ᶥƥ x0 <  TP~尥 8q\\\\* O&\3O-PM 〣@ptZ`l`s `#P3P iUPE!㸇,cP00CS0'%p 00R0S kP18C8S9 P%cP22l18C8S  640 PP 1 P8C8S  P < P^S,18C8S / P 0 S 18C8S <18C8S ̨l18C8S 00ll1  \1/ R L+8\ U 118C8S WpG('P`S<18C8S0 㣤 RЍS R   R(MP0 UA 0QDDꠃ,Ą,E\* t,,, O&ā,G\,\,\,d,\Z\p@-BMd,@P4P1 H`{x,!  1  oPP7`10 00S0S 00P0P@0 S090k0 bI L~,p,ȁ,ā,%d t A-U`V7P@4@Pxp-l%0P /Q4 {P |pP@uDN8e0S+ ,5 $5 @5 5 5 R- 5+ 400000@T ,' P004@Ѝ0400/S@`P w w w T,eH)e@ 0Sg}Qt0S ~p=0#~sp#;00S: z`P`|` R  V \3Q 30Sx Pl: z$c\3P0S 2Q P o2: @zP2  : zP2 l!: zP2  : zP2  : zPx2 !: }ztPX2 ,!: uzXP82 <r> 0o4Ѝ0X, O&@-`0S@ P80S 0000q20\@X,ee0s@-l000Ph@` R R l  R  R@4h03/ЍpQ P O&X,lL&eA-` q QAT 0SP ν@P00000P P0 P0 xP hh Ǡ\ 0L@L  "  \  O&X,eeeeee&M&Ɂ,00@-18C8S 0P 㟝 O&Є,(0( @-0@ 갃,,,p@-BM`  P@0 S`0018C8ST01y0 ᆠ0Pn00x0 ϛBߍpB/ BR 000P `y0001ꨃ, O&fЄ,, 0?o2 0/ O&H-AM M0r0$0P0000000@00 ᬛPڶ0 ȑ ៛P0SS WS BS 0 +ᏛP  hTcp0S JW 1 0S0Y` L18C8S ؠ0S Q  )   |P Y 0@^S00CS00 S00 P0S,ꠃ,Y ā,,\, O&Є,p@-PH@P@pP P P @ O& 0/@-铛o/A-@PP p 00CS0 `V PP<P0 P00XA&. 0S P0000 !0S0R 00 ffgA-`AP0E!Sq p0!00CPPSJ0`00CS`0p S X0 X 0P"SP, 㕟0SP`0P0CS`0p SX0 X ! VX!zN0 0P0 P000P pP:0"S00PA-</0 0P0 Ԅ,&fP&ggg#g@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 %gA-@tP0 =`P`PP2 00pPF 0P 3V @P  @0S@0Sؼ'-00@uPP?qP PPP P 0!SP儝0gԄ,#g O&4g;gp@-M@PP\1   ,@P`u00u0ۍp0 P 0@ 0000S X S  P00 f0 K_P O&Rg\g`,^gp@-`@;PP 0 53Up(P\@p4g7@-@P * Қ R ˚ ǚ@T| Ѝ0(R( d+0PP @OP ,KP ā,hf@xt yt h؄,0@-M@@ 0(@,0 0 Ԭ@P Ѝ00,rx0 kPPP P0S 00@SPhg ؄, O&ā,@-餜(,ⷬi؄,@- @W; Q囃mP /哃 唘0P3P x{tyh 3\ じw &岘Ѝā,xt yt +i1i4iKif@ip@-0M`5PPT 1<18C8S |KxAx2 0 9 0H@ I4R,P( A0F, Rv  6 2;P 71P` !0(0S q=R  00FS0xhP0Ѝp\XTP D O&iā,P&iiii؄,ihiiiiii0@- @6ā,i-@-6|t-@-.|0 R   ЍЍ/,-@-$^0 R   ЍЍ/,A-ARp`P@1T ᭗pP C`@DO-dM @P$0P 00P0 0 880 0(P40P0p`,@@0,@ T R3 U&T ( 0 (d(0冗p ` Z0 000,@ @0_oR,@ 0T ZPPU <v 04 JR (0 R 0S0bi g0S  dЍT3 ` 0@D(0,@OK00(0 RR `:0@D(0,@(0 R40@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q p >W : "80([/PP (/ R 8 %Q  R P`(M6c8@Ht  J  $P T0`000S((6 0(408 TU (0 $(,Q@D0T,@(0UT(0 $(,Qt0(00@DS,@Tj-jBji]jzj,jjjj jjj kk7kXkpkkkkO-lM($~`~PVPP*8@ 0L|  0<0hh2 @0`2 @0P 00G@P 8%@P &JPp@0S$("P @ [ lЍH<`@40S((  Px  , I, 0P¯4 p0BP00BP<  B,$( ( ,0pRQ @(S<`@ 0gGP%<0%800%4000 0'<0'800'40` 00$ P$@jkHQ&jkklll'lC-pᔑM00PS@ x(`0` 00qp@  `?sp$_@`0 P#00: pppppW0@ @ Q@Op`6t0` }>9 ?@l@ 00 S @.  C8 ⒙ЍC0HQ&8lklllP&A-MpᔖP`ЍA0@: SPPT@|`P00S 00 0iQTP1 ݔp P PU0DsLS<(    ll,lllO-]M0 M-SPPP50S ]ލ ЍOv/g]ލ Ѝ@p P$ 00S0W0S 0S  ` T|pP  @px{0* R` D RP mPP0gu |`P tX0v: S+ p e 3 P@` P|3: K4P ph ` 0 0P:00 0R 0S0S` - P`x`*v `0S 0 4P |V  P `z{ R J<MRK ݓpP Z ]P w!1Z[  0ޓ (.%Yὓp`l: 0S'HQv00x!0  P: b  0S- ᜓpP  W ]ލ ЍO}P-Cន 0Sᙓp|P P : R S00 R0S kPPhSX},HQ&lll mmGmBj)m Umjmmmmmnn&;nDn0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T000@- @P@@ bP 5FP00S D00S 80 -F!UOXx,h,,Lg&@-Ho@-{Pp@-P @~p 000/p,p@-P@0-S@@p GP0Tpp0p@-@0@MS`P0 @ ' P P@ЍpPU P$ 000PxQ&p,oo@-@P @`,00S@p,p@-@PPp00Spp@Kp,A-p `P@P000 P P0 0oo@-@P P0P00S@]p,p@-``MPU> 0S; RP2 @@?T/  `00 @ C @ F00 *S 0 000?0`?-XP10EE>P  `Ѝpo 0@-$M8P0S 0@Y@$Ѝ0xQ&0 0/p,0 Rp,A-@0QS`0@S` p098p QP@@qp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@ꠓ,,@-P X00S S9 (,0 @ T ꠓ,p0@-@TI0 qp0@ @}01p蠓,,p0@-^ 9 @ 0@&)60 P@ ^@Tꠓ,0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/᠓,P0001S0 0/Q&7@-P R I0 00# Ѝ00R 0@!"0@@qp Ѝ0@R?ꠓ,@r0@- 00qp Ѝ80098<@ q|/ 00\ /᠓,A-`px PP"@ 9 @0@  P09   S 09 r`Ad,,@@A-p`VY@  @ @ 0 usP0 0y0 hT  00`s0@A ꠓ,d,0P /᠓,\ -P0S0@  / P2:1S0BS /C-@4QM`@|@0S1UA:ЍbS9 .S8 00C S 0  ? OP ~>cS@U:s>0@0CS000 000C/  0?NP @@@ꬓ,,Urerp@-@P 0SP`pPQ IP@dPQVP4>|8P0S  p PQ&R&}rA-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o21@0@ 0C^S0SP@u0C?o2ꬓ,@-TMsL@DM@M<M8MTr,3,!4!!!8!!xz,,,zd, z ,T,d&zzyz{4,;{H{W{h{Lzy{{,{{d,yTz{{{$,{d&y{\,,؆,,,+U@  U !UQ0-UQ00  \@0#0P2 PR 0 a0CS00 0-P  00P= 0Sa0@S @P000S. ,YP& 0e`0,0[0@0S 0! \,P 0Sl-P *a0ES000 *P *0 /E: 0*U @U !U<30S 97R0 <430S07S ;07S 00l##O~.10@S @0007S9 P 0S S30S PP d0S7 40S{i 0#0CSPwd ;P $0FcS000 e`!0 S $0!R0)?040S  /0 S 4%0!R0)?0 ]!R00 !ı50S!R0 !R0 0!ı{ x5 r5 !R00 !ıf(60S!R0!R0 0!ıT !R0)?0H60S 60S >`@0 S 0/70S y0 S 0  6!(gR00 !00Q 0R eSd0C0<0S d 0!0<0<pP0tiP0b(`Q 0!(8 SXPt3IcG\80S0S]=B X8@ 8D 8H  pP- I,9000!R0 0!ıX900d90 00!R0 0!ı 0< `0000!R0 0!ır ` `<0P 0P0 0!ıP *P n P !p R0p;p;0!>P }0P0 0!ıPs ! R0;;0i0P0 0!ı=`P \ PPXZ=qpT 4< bP0P0 0!ı=`Ph A0P0 0!ıP 5 391<`P.)P #!0`0,`LPN(P 00,004 =0=0S:8-T V _@10 |q)PP U U ?Vi!P0 >^PP U U {!@0 NPP U U G!8>0S H%:PP U U.P0!0P. %(P0 0S .00S>0գ?00 ϠR0  B ? 0 S /00S0?0գ?0/0 H 00\? p?x?0S080k>00S/ᬔ,@-@0 S!0O-S`MPp``@ pP Z:T8 00"1 0T S@D0X0@D@Ѝ0  0A80 0 @S/o" R 0CS0 Q  S P R 0T@180 0P R* 00P x  80 aP wb [0J0Cꬔ,O-pZ鰐X& RP ` P`Px` )[ ``F 0R@ 0R U *0@S0S  Pp{p@-`R P@ _0P @@@ 0ppM-@Mp @00PC  RT0Ѝ `? `<P ?0? `P<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P#0 ,,\,p@-P\dpHPV@^8^LP gP @P%C @@A@@T AT T ep00SCBp00SBCp0!@00CQ#n0 DPp@{T ^gP 0S0^  PA0dP fP pip,,\,@- @ @ܝ, @-p@+ܝ,{ @-p@v+,{2G-pWuPP{ P0`upЍ^@P 0pqp_ uu?SZ _0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*p$,,$|p@-`l@PP ;O,;0XV@` `;D Op*pܝ,$| 0 ܝ, 0 ܝ,7@-`P@ PP 0S  P Ѝ0ܝ,Po/@- * Ѝa|A-`QpP P P@P%U0P 0 P l @^T @P 6/P^d|t|y|@-~x 0pl l0P X H0 H <0 P0 @0,d&$f&|D |p |||T1C-M0SL @10SH 410SF pP` JPUi0@?o20S@ _P[ZYe@ЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P jPE%U@@꜆,,,G-@M`0PSS00/ @ R S"\R" :R R D Z /Pp P 0H3/0S@00Ѝ|P/@-p U' )^Ѝ00S @  h n)\0PT T Q' 8Hqp  }}X,}<}^}O-@Ġİ`lPPPPp0SWpV  S -P0F@p U0 PPUP@ RpP SpPd&d&p@-@QP 0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`; PPp@pWp@. 0@-M * x@sr  + PP  000Ѝ0d,0,400S/@-$@P P@X,d,@-@P  d,P/ @-p@&&0@-M@%rPs00S@(aP DP OP AP dP oPiឩ|0t00SЍ0 rPP0 00qpr00@M(X,}}`Q& ~O-M40S 0S j0S@ T y P 4X ЍP @n Pp 00r pPPP`h`P$ P  pPPP(d0S P``40SWPTPQ ((@'#PP3`00FP0`0 P0`0 +P X ' K\ 0d)rP% 20SP `DP  @' YP #rY |2 d`2 p KH2p<20WF,b(2P 0S rP (=sP11P %0S (.1 \ RP MP l1 P[P10S [ 410 (0 qp 000Sp 0 2P 5 R0  [ R 0 0P: p X ,d,`,~~L~,{~0,}@,h,D,\,,,T,M~l,,5~d&,,f&~P0@-@d,00@-P &@0,~M~A-`pP`VUPU@JTVgP0, 0 d,@-xP@0 @ d, 0 d, 0  d,p@-P@@P Pp@2pp@-@`P%PpVU p@ Pp PpA-@Qp`P \ZZUG-@䠟@P`  @PUЍppPZ7AP Z8p0ShЍGd,@-T00S@ @yd,0 R/%R %R0 sR0/p@-(PPp@P@pD,~G-`dBd@p00CS0Pu U   0DIS  )\6Z4p@P0 P00@-@,P*~A-@0 0Rp@`0S00 R0R@@0`P0S U  dP@00d&d&O-MpG@ P!`Q[ Z@P[@P) 0 000p0sЍPP P K 7X P VPA-P [P00pWpd&d&*A-@MphPPPЍA]l@@@j0 HP`rsY HF@mYЍ17BA-PPЍ0S `pZ@W@@XPP D 0 B`rW ,oP@Y>oL@-@ @NA-p@`P@0S 耟P@0S0# CV* UR@ R %S0P  @# CV* WR   R %S8 P0Z@`,d,C-EMP PEߍ@ 0@qp `,nPڬ嬐P ` P:T0S EP @  h0Sp `P  LP@ꬔ,,C-MjX10S@GpDQ0SP? HcP ppp``k00000 0 0pqoX+00`@iPU ٿ`]XV PE0SQXЍ ¿HX@$,Sd&d&0A-0S@`9@#0P Pq@ p`P%X@"X X$,@-@<P 0P oS@-M@P Pۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` hSP TP D@#@ ЍP  PP 0q W ` WV @T P uX%XmP ገ@T@P@T 0l000@`<P-@s0SW,$,S0A-`V8@P&pP0 PЍA"vPs`[@XU@@@=0 `pGWEW@@WT ЍA)Ѝ$,-M nP  @oЍ0@-P@M0SP @XZY ^nPS @Ѝ0@T@0: S *@X,g& g&@-M@\nP͡00 0Ѝ0@-M0P@ 'nPh0  R\P0  R\ tu p0St00Ѝ0d,8,0,/B@-@P P0@/R@-@ (0@0Tb#@x,@-40 R\00S@+@H,4,h00S /pp@-qp :#qpP@ QPpp褓,@-P&#P3#0 R/  H,O-$Mq0S@P`0S\0SOs@HP`@100CS sDP`@ 0S"P`0vu0 @ 0尠00Rᤐ000  00 0h 0 00000000 0000P`HP$Ѝx,t,؆,,,,O-M<`8@p@PV t30Sh30S`o`V D3``F`V`utV-$0S 300CS QP ""]s"QP ""0S6 N` +20"`Pt0X 0SJY/Y @ Pi"V<"0 40 ut  20S1"0 000 a0 0 10S*P10S q+*qp@PZ "P~"P41Aw"P  "qp ,10S L"P ЍO0G00 ЍO,V utS 00St001 ?Q*)@P9ut`dꐆ,,(,,Lg&(,H,,@,Q&4x,,H, ,H00S <0P/000S $0@///H,,(,,'G-pP(,`@qP"V 410S(1`V``ut 10S100T T00 05*`%*00oᨂY J) qp00S@P W ЍGx!Vq V 'ꐆ,x,H, ,,O-M`iP P @0P! ЍO !qp@PV00SЍO0Az!P00 0@YЍ!pP@PX p 0Z qp0 @Pꤓ,,,A-p` qpP@VЍAw   0@2Ѝp@-8P@0SPpUqp @ꐆ,0P  P/Pg&0P  P/Pg&@-P@p@-@PptP0S T0 0S @ 00C0SSp@S  B 0d,Pg&`,0/`,G-`$qP@U P9 Y* SSU&8w@y|0 "0XPP00040000( @0@000S < 0P00QP   0Pg&`,P/P // / /00//000////0/0/p@-@4PPP .S4Pp4/O-M cD\ {rPX 0000 0 (HP 0000 0 (XQXQ> 00  0 'P*Ѝ=ЍO" <O-4M(0PX0@ ,0utA @P4Ѝ40SU400 ?QQ('@PP@dp00 0lp P7sc  ` V0,? cp` P P@㴣Pv V}, `?V@P,0S1 h3Z1 @P'L30pW05 0$ `P" R $0 S S`! P P  `VʏZ: P `@T_ @P[ |20S  P0 X (0 S  $PO 20S @0  1 R00 SA> P Pe p 4ЍO V  P0# 0PB R \A0 Pp``@1`@P!Z 0 0@P_ V V@P P P P P@Put 0~ 0@P_|l00S V V0 0 0S j@Pw`0 H, ,,,,,,, ,,7@-P@P ,0 R  000 Ѝ0蘟,O-`Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000Sd  RD = dZ* P+R( PE0P*!H(P3% R R R000#=R00S 0=S#0E0P0 S0PS  P Y PdP  PP 0S 0P Ig&d,!x&R&TVajou#~$0 RP  /သ,0 14/သ,$ 0Q/P/Hj&@-w04 ,    00(, ,0,,G-P匐剀J@JPT`ppP KT K  8 ! 3 K K @`匀耞,A-@4pP0`S 0P0aP 耞,@-@$ 0 @zꀞ,P 0 R   /,p00S/p@-m\@PPPpP 0S8@pPp  ,,@-4@NP00,GPh0 0Y  U;0@&<&8&4&0&00,,(,4,@,L,P/0/သ,p@-0@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00ꀞ,,(,4,@,L,C-P᠁M0@Sp`$p`xx!0 0 0S]0@ 0 / @,aP00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tP,,|,,,pQ&hQ&,,0P$0 00S000/,,,,p@-H@P0S0000p01S 0@&Pꀞ,,Pp@-`0 p@jX10S P@@p(1@0PSP5P/`0P@@S  1CP0 1C"@P 0S000|  0p  0d  0@@P 1CP ꬔ,,,,$,4,,O-MdXC00wvP1S0& 1S8 @ 0C# RfY) Q 0 0000P20S P 1wvP  S  ps000ap1U 0S f 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[)0 `0S % U % 0R 0Q0tP 0C001萄 S vI  0ꀞ,|,,,؆,,,A-p00PS` HP ` P 80@0@D@ 00@TЍ,,؆,p@-P@ 02p@A-`HPp@GE$1S 0P $@@ꜟ,7@-8PPU Ѝ0@@ @ Ѝ0,0 (! ,!/သ,0(! ,! /သ,P 0@-@P/သ,P @-@P$0/P/耞,P @-0000/0@-S@ Q+ 0S \Q@AOoB@0Sp IQ S Q0 0I0S0000Pp@-`@P  0Sp(P pG-phhE0PS`01SP00100P0W PP- U p P Ѝ010S00# pP0Hd0q#0 ` F $ F#Q 1R P@#1 R0,dP0 d0 0  0U*P0C0#0G001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0TP 0S0C 0J` 100P0C000jPPUF` 0Q 000 PQ_VP P0SPPA0SV_0Sh [Pd  0 ЍG(_V P` V10S t! RS 0  m_PP P P0 @PPP0  B01S0R4ABf~@D  pP@DT0CR0S*A8A@DP  0 )0S pA,,(,4,, ,,T, ,,P,Hj&,FA-`ApP V P = CP  V10S ! 00|QS 00 0S$8QQ 0XP< R0$1a 0S0S Q00S$1R0$aʈZx`P F F)00x$<0s0$10P0 0S $耞,L, ,,,,@-(@0S =Z00耞,G-PApP 0P0U0S = CW`dq, `0S( 0 0S0000Չ00 0C0S Y10S0 0S  L G5 EhY 0 0R  5x00S U d00SX00S D00SX    ꀞ,؆,,,|,,,,<-0 R!  ^ !0ꀞ,04/သ,0 R 00S P@0~0/0P 0/\!4 0 / B  0/သ,,0 /သ,qp/G-p`@PIpP 儐u U 0 , 0 W 00V@00CSaP P 0P&@Pꀞ,,PG-P0P`]PpЀ@ 0@D P V 000U00C0C0y Tʌ%P 0 BJ 0 Q@ @D 0@DSBꀞ,,G-p@0@`P@0W  S #R0C00C0Ѝ PP   D 0 ppGA-0T@Pq1`EP q 0P 10ꀞ,G-1p`P0@\\pqp 00R00STDP0pT@؆,,,p@-@ppP P0S0tFp APHj&@-p 0Hj&80P/ R/0 0S 0 /ȡ,00 0S/$0$ R ȡ,,\,A-X@ 0S0dS 0(0,`Pp` p U`0ȡ,X0QH0H 0.4 00/ 0 0,ȡ,,A-P@T  ^#0pP4 044 R0@pW T  4`0P ^@Q 0࠱`@ 0ȡ,O-qp1P0PSPU @PP0⼡p`@` V  RXWA 0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00 0` qp )@PPAp ` W0 0K0 0`qp @TP,ȡ,,P0G-`pPU0  SXW@ U W0S P)LP @P P`@V0 0 0 000qp0S@P`"P``@W 00 000qp0S@P`V@ȡ,,G-`딐P@Iptu00V00S 0SP@`P@tu TUP萆,G-@P匀ሐkp0`P80 @p 00 0`Pqp080ȡ,,800S/,00/PP//p,x,00CS0 S0 SU]0 /O-P0-SP ~ | z 5e hXpXXPX@ P0S,=@ 0S 0S%4@T vE:B8XX4X=`X ? =  p0  ЍO/`P @@ @T4 0 AV[B /2\,&G-@ $P`P,$qpP] `l    @yz  0Z Pp@ ;p Tt p@r 80 } pCac\,C-`Gqp pZqp@@PPR.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   ,,,v.Pp@-9 $P" 'P= P !srp p^P 0 &- P& 2A06 pPxd0`d0 T0f&@PAP,@ma006pd,,,,G-@tPp`4T#0 5T Ta0'000P0p0 @@6T` P'0,@-o0@-MPh@P  $ srxЍ08!P @00 0 &d,,@-HP!sr@Z 0!0 &,@-R sr @@@6P0&6 @0606Ѝ,d,G-6@PP`j>T6k.sq 00P6 t@06PU pf@P0ЁPP  G P ,d,,@-P ,0 0R  d,l0l 0@- ^ @^TSa04S '005S #d,,,00@- @P QA6R 00,G-X@pP P`P@`?p6W @,00S/A- M`GZ@pqpp6W @ Ѝ 0 PUP8SP P 0 %Z,,@-  0mS Ѝ 00 Q @@P 0 S# > PP0P`0 S  Q0 R pV`PPp ?p00ꐆ,17@-PU0P( P@ Pd0 Ѝ000S@PP [?P7T?7 Ѝ0@tH00S@ Ѝ0@ 0,0 0 $,<T,^`Q&r0 X,<07@- R ,0,@P?@0 Ѝ0w&,@B,@-P M# @0.S 00S Ѝ 0S0 0 00S000` @h 4XP0@ 0R 000@(@w&,<07@- R ,0,@P?@,0 Ѝ0w&؆,@B,@-P M# @0.S y00S Ѝ 0S0 0 00S000 @h WzP0@ 0R 000@(@"w&$<,Rn@-@P]P  @ Ѝ@-@PP  @ Ѝ0Sp@- Sp00S p@t 'l0p`tP p@$qpP@ 0 p@$,,,P07@- S Sl0 Ѝ0XPX0@PP =Z@ Ѝ0@=00 0e x&x&P/L0@-@0S 00(0 $ @D,l,@,P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P= Ѝ04@P,0, 0 10 x&x&x, x&$,0/0{,P/WP @P/Ap@-@PN=  !rP0UxSJ}{0@0xv6tkrp@!x&@--0@dS!@S1 CR&0C  R 0Q0 . Ѝ@A C#R k C Q 0Ѝ        @dP @,O-`-@MLP00P@*0 S  ?  000C/  0?ppT*000C SY E0!R1PT*0@ S 0,S UH0@ P0EPE1!0C, 0UЍ ,xk&|k&@-PM MP 0@ݍ Ѝ@` @t>0Sp0 | @ݍ ЍU \>w HP0Sm(N>xk&,|k&/!$P@-  0S 0 0ЍP  R lЍX 0L H 0<040800 0000000d&d&?cP@-M 0   0x0s @ph P 0S>000H ;0Ѝ004@P wom,,lP @P/i 0 /8,P/00S,0/@-@0SE,0/@-,@0S0 0C00Ѝ,0/@-,@0S0 0100Ѝ,0/400S/(00S/@-qp@,d,P@- 00@ ^S00S00 Ѝ0 w&@-P4M & @"`P@@0,S p  h0S  0 ,R 0x 0X0S` 4Ѝ80D@00$0P0 TPx,t, 1<P0@-MO  AQA0S1Ѝ0RS'DSSS 0e C R E C R   C R S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0   .d,n800S ,00S 0P//,t,x,$0P/0 0 0C/,,x,A-PU  @Ѝ`p@㈀}P`V 00S0\V0S 0S@`W P @`$V00,@-0S08 04*S( Ѝ * S,@-Q00P 0R C Ѝ@- 嵡 ,P/0S/P 0  //oP@-/ 0LP/, 0@-L   Ѝ,A-`@Pᢼ0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍfL0 @@@Pp 0 R @@-PJ &$PP 0@093@!+P0P0h0 P @0+S9P 9⍼99P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PlX   00 p @ =RP    B  Xp00aK[0(!00CpS0 0U ?o200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0 fP.00S ,D,l,P&@-@PM @PU`p0@ uUЍU  j  B U R{  0L"00CS0U0S U3/U@`y 0 LV00SYS_U 0 1  U# U U 0?o20 0?o2P0U U U W0 0S00P0S000 P W 0  0S00S000ESU U U I 0S0mPS000 00SH000V S\,*Np@-P`@000C S0 ` 0 B ^ ST00p pS 00 000S/P/,D,@-XP@PL0  0S0S  0  03/$@ik&D, 80S/S/ 0CS/$k&O-@DQMp0S [; 0S 00 Ѝ`V$P  I 0P  AAQ-P $YQY0 0 p@@OoB0 0S `0 0S 0Wppk& @-%PP0w&/@-0M@20S4P 2      M2 0S@ 10@@0Ѝ! 0R0< $0"1 S 10S 10S|1 \11S(  M2 P!2 R@ z$10P!@0000 R  RL 0000S@ T0 0S T`0 !PL 1 10S 1㗹$0Ss 0#So @8,<,,,,,w&,w&`,@-j<,@- . Ѝ@-P8`@@@ᕹ 0`pO Ѝ@-@8P H,G-` @$pP 0b(S%0 W P@@@0^3#@- d 0 Ѝ,7@-2"P@?@ Ѝ0@B@-<0?B3c/ ( 0 0 3LЍMb@B404@-@@T KP0  w&\,\,@-@0@w&0$R/ $嬾\,p@-@8P 00R:0 @0 $pw&[,\,p0s@-@@d`D \0 Ѝp坾0U4@5PP<,\,\,@-@@PC- `?@P!M0`p0PƟ0 0 0 eT-00EPN7Ѝ%A-PX 0`p@ @ 0m0 P dU-  D@C7Ѝ%O-0M` p! 00@C QaCQW@CACQ7@C@tT?0! `?0 !@P0PX ZЍO-PMpP 00@C QaCQW@CACQ7@C@tT ?0? pM ?0 ?@``PZ UЍO-PM`P 00@C QaCQW@CACQ7@C@tT? 0 0 `?0 0 @ppPY UЍA-0MP@PЍ%P p@0pnP$ cP& dP %PsP xP   ӿ@`0P`D@0 0 M`0P 0A-P@`p5<[ 0 $\,@- R$00S20 P00S@Po p@-@ 4P0 4孻P}p@ V00S뼼h׼d0`l`P{밼H0@뤻80@0@S(0 p@ \,,,w&,؆,\,@- 00 Ѝ%7@-@PP Ѝ0@(0  B0~ Ѝ0w&Vp@-@PVP %@MP _800S00 QTӶp ؆,\,@-@1P0pSQ 4000 @=U'Qٶ0 0 R 0?o2 `F?P 3W Ѝ@IP y3`3,,(,n@-@P h300o/O-|MpP `@< ᩾1 Y0 \0ACX 00^YP P0@     0 W" !Q0S|Ѝ@0/0S00 0 0eN P00CQS XH 0 R 1 @0^AA ,/~p p p D00/40@$0@0@l,,800@- ,00^ʎ1C0@ @ꐆ,l,@0@ 0 C\1/0@-LAC\@c0萆,l,000@- $0@0P0CQ0 @ꐆ,l,`0 0 P0H0@-0^@P C0/l,,<001P/0 R2:/l, 0Aꐆ,0Q@-@ q1!0sr X0L1!0sr $0A Q l,,A-pP 0RX@` Px2c00yvt 02C!A`Ѝ萆,l, 0P0PP@/ᐆ,0 :Q Q .Q 0?Q  \QQR/ R//A-`9@p0P; R0C @1@C" 30000t, p@-@XPqp00T00S 00CSp@n@qppꐆ,@- 0 A Ѝ@- : Ѝp@-@0PS b0C0Spt 23p0PjS BS bSp0mS tSpp0000kD,p@-h彴d0dP0`@S;Eⱴ ⮴4@N⩴b⥴pD,]t,x&C-$MU0`S@p`d$Ѝ:S/ %S .S 0 pU@0S0S ?S \S0S 00@ 0X 00~xX@KXBX] DX. @4LH,X؀PP6qp@40S(4 ȽP40S N30S qps P p P{i P3 qp }P' uP02~mM P3Xq 003BH@6Xg Q0R 0 Yqp 0 O|2MP0t2t"0 \ P B B?៻8(qp20 PP01P 1011T1P1Kf0 P \1C0  0R0:P0P P[ڹxy 0RQ x0 Ĺ 0R0:0P 극lSA Pb ] PPP$0[Pt,x,,d,,h,x,,0,0x&H0@-@@00SOoBҼ(0(01x0 $,D,t,x&h,0lx& p@-PPp P$R@ @Tp `$@R@p\ @R @T @R \ p @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P /00@p@-P@T `0S` 0 p`ㆲ0@Ⴒ0000`S @@0@A-@QP` @$ @~p0W0 S 0 R 0 0 ]PЍ /P 0`0T X0 @P Q/0T0 K6)1`,,A-p`@V  ` R P ( ^QPR(;P" ^ U!R ( ^ P0 0 Q P$^U $C 0SP` 0 00`Q!PQP "Q P \U!0SP `0 0S0Q  R \  P  RQP0  0 U A U0QPA00  @-oP/,A-M8@0C0p`pGP4 ϦA XЍ0 H/o"^ R  ? 0Q 0( XϦ@,O-$MP`T0pP@0L00SG RD L  R Q R*H)  H00@00000 0 YH  )-  0S0S @ 000 000L000`0C <P$Ѝ@,0    /,0A-@0S xPT(`V0(0l00Sdp@ i(`qp &Qt@00CSjP,,\,,$1O-`wvB 1!0РS ЍO>00S 9PА@00CSD& ЍOѴU 0qp  L 0ZqpV Q "aP@ ЍpQ&\,hQ&P,,p@-P@T <0@@@ @p `S-Q-@,,p@-PH@U p@\Qp@(0?o2(0,,p@-P@ӹ p0$ 0P !U@p,O-M,0`70( @40ptD70<0<78 @$ 70S 70/S 0Ï0@{t (0, Prs007S(00(00 0,00$0 `000|60(0, rs  T0000S (0S0 00000S0S$Ѝ0H 0C000L0 " 00 000zy+  0Sqpqp0S`000 00S0 @ y40S PIUPe U 0A 2Pm40S 4L HE0|4Px4U 'VPR `400PP40S <400S0R0S P 4L0SPk`kL0PH p3PPU7  T  qp R#T0'L0`     h ` D0ND0P T 0P@TX\P+ + P ` @ PUaP 0 0`0hP0p`PL0 $P  000 00 L0`$00CS$0P20S r000 00 L0`p408 CPPI h0S8 Z5  `J!` 0C pQ0_00 p0S0' 0 aP0o 00 0S0<1YPPYPUp1s+ q+0S0$0`P0S 0S < @B X0C  BS pa oZ0Yp0Pp0؆,,,l,x,,,t,,T, ,L,,,H,,\,p@-P@з < 0 P !U0p P$@,p@-P@ḷ T 0P 0 Up PS @P@,p@-@`PV0000S0 r| 00^0tu00 U 0S! 0P tu !R0(PpVp00@00S 0Sp(0(0Sp p,pQ&hQ&,H,,p@-P`uU 0S0P@T0 P@|0 pP*@~0 00000@pp@*0P00,\,@- 0PP,O-P34Mأ@0 40`p 0P 0 X0S`p$$P4Ѝ0 $ $X0X8< rq ut00T00S04\0`ut 200@_$0ut  sy00 $0Y0$P @ut00V 0S 0$0(00X00$00 0 P#srJ RD R 0E0P 00@PP; 0  Aqp@PN ` p%ut \0@P$100@_V `p000/V0V`p ` p @ P0X0  8< Z000rq0S Z0 YP 0 *qp`p000 040*, ,0@-MP @tu 10 }Ѝ0@-0 ( 00S@,H,h0p@-@mP HP0 pp000S(0Spp d&,H,@-$@$0S000r @,,,O-0,M "0Qp 0SGyP pC 00#  `PH Q ,Ѝ,S0S 30S 0S(0S 0(0v0(00P2 X`@PE?qp@P[Y8@PutTXPJ1\R0 0#@p HBHb0 0 0(0m0S 0S >20SX` 1``FoZ@P 0 @PX SiX1)`R@Put0`V@P@P 0S 00SL YJhG qp QP 0S 00S3 ,$H,,,,,,C0@- $ 00000S@\ ,8,0@-$ 00000S@K ,8,ɪ@-鬯80 000O00S@4 ,8,@-@P иx0x0SɸdƸøP@㿸㼸㹸㶸㳸 $,  1A-@TPP0 㠸F뿮w㘸㕸*?=㏸۫0 @ P`p 0RW 0` ?00b<0 ,00SAE, \,؆,,\,,G-pl0P` u @ P 0S 0S S,A-` pPD@S>1)0Up0P D/")p@-HP@T<0   p 0 ,'*'('x&,O-AM,b MAp'W A0 0 PP jp0S0000Aލ Ѝ0!S  ePA>004S S S ჩ0PS  00 QP4 p0S  HH P? 0 ^R0 P\ S$R0C 0M00`000 \P0C R  C0x&X,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c *PU Y< 3T YW9PA rPppX@ UR @@; 0 $pᾍW C&l V@ =&T<"0S0000P ;04P S@ 3 Pp 0S 1T WP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S t P p? U00`0002,x&&,&X0@-@PP P p P `P l;P;x&@-@PDP P @|1O-M0S" @`0 ЍOh8Pp00 0 Ppxy@`Ѝ00S 000S  0P @`IN 0 00O0 $ $ 0S,,,,\0@-PP R^0S @T 0 B,x&\0@-PP R^0S @T L0 B,x&0/,0/,00S H/,@-OP :P:P@-0,//@-L@M +0p PFS0PЍ,\ QR0* /QS QQ*/0000/@-@P Y$000000/0S 0C0//0@-  0#3@PP @0@0@-@ 0PSR? P  Q`  g$` PЍpA-`pP@T@  G-P`"(F$,@p ƙQP 0$ GdFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`@pR   ?PP@PT*?P #SP0s@-P00 a0C@`S0 PЍp  000@@0 0 0 0 0 0A-^\^ ^Q[\9[^V ^\00]QQ$ ]Q0\[Q`.FQ5 `@p 0]QV0@Q@\\@0[T T nT  \TR  @0\00<jp0p@- P0@S S R 4!@D@X p@M0 @ &1C-Qp`pXh0@`P0Y 0 4.PA \Y R T R 0 0P@0   [R .0B0S830 00]RT[T@ 0QT 0QST[@[T0Q[S@$0 R Ѝ,,0@-0M M00P/S $S! +S00! 9S\S @P 0IS@P p00ۍ Ѝ00@00 S00@O-@T0tS bS rS aS @{S000pW G`p 0S0QU 0V匮P 0 0 PUP,b`P!,,O-M n >4Mp0 PIW ܍4Ѝ000Q 00  R Q  R  R  R @    0S 00@0p00pS 0S @P#S ;S 4W00 P00@ 0P %WP  0S @,SP0S 00@ WP  0S  00@0r0W00 r 0@p0ST @;S }S p j 0R @\R 4 ZPU P @ Q V ,M P <,0 \\^ 0 ^0\ APP00V0I S VP0S 00@ :0S00*6p h 0S 00@0S 00@00P0S 00@X0S  @P0S( X :V 1@( RP0U0 P  P\XX $/V I0Px $^P I0~0 , 8 SR0 (  U듎700H00 PP R00C0 0C S000 VW,, X`0PpL\RC [D Qx␸0S <,00S ,, E 7P00A U 0( [0^ 0   0S 00@MgQ\ R9QI0QcQ Q \[08 9R/RR0C8 &R$ +P 808\R \ 00AR0  S S00( 0  \ Rl  ;QY IQ00pQ wQ$ iQY 00Yϰ EȰ0"S YK  0S 00@<,0 [  RR, S 8x V30S # 05p p  U@P IW[ 0SD @;S> BT0110P\SSpE ND  PP< , @P 0S 00@00 Hpg0 Hp Y20S!000 S90S 0S @;Sa }S0 @)  9099090H 0Ʈ ®Np000 XH 0S Ap Uf  6pYP9 )0     囱!dT1 ! 0Ү0$ (ʮ9 09909 00&,,(x&.Fx, #&3:,@La ,,5e%JD&tA-D`@@PU@Tp00S SX0T0SD0 0pS0(FP,,l,,|,p@-P @S000P @py&@-@S   0@0y&0p@-PPUphU8@P 00CS0gp ṋ=gp0 4g,A-lBp` R3 RQ R P$0SV0(  R R 8$0 P,eP0 P0!6QPy$00P0PT0, APP (00S(0 #R nR0V ,0 0200#0$0,0$0f( T0R #R nR   RpG QT000(0V0(00P R R0   $Q T0P $w (0V0(0 00  T0(0V0(0,,,@-|@X0  0S 0S00CS0fp X0  ,G-`DMX0pS00S 0S e#3X 00X 90C\ `00d0弃XP 00CS0 fp X幊X )pP0 W0 XPލP3 'fp0S $402P 02P p4S 340p0p4S \2PP fP 00\02P|p0`0d0S0000d00S 0@S0k 30P  d0   0@ @zd00S +Ø+㋘ P0 id0+ⵘ0+JⱘfP3J`g0t!PQH5 P*3\ PP e86P\a ( p$ o2\0p !i2 0`PS(006PX10@00*0\`0P l000S SP@  0 l C(00(01,&`,h,h,P& 8JV--AMM@A> 0$ 050 @0 c(, ,X--M MA>$005( (  0iۍ ЍЍ/(, ,X@-@P`PP  0)pJQ0 ) Ѝh,@-M Q qM`0S000@03 0@۬0S ֬ 0c 0 0S S ` 0"l5@P *0 <5 Pd0 00ڍЍl,T,X,@-P@  PxSc \0 P`p `P <60P S x :c Ѝl,G-pA嘁0 0`PU , R:(,P00( &U# \U   0 R`Z &R\R`P , R:(,P00(P    "pr P qu PE ,  R:(,P00(   "  0l,&A-@P p0R`*PW0 0  0P P O-0x/xOM00lPЍ080L?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0 P0 R p>0R*ST>0@oP0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0S@=0@oP 0 -=0C>S00L0 R: L O` 0pߤ00c0800400S<Cx<8 00 `\4 00w<0S   +H0SP80S4PU 0`  EP0800A E4 0T P !0  004 0| 0ll  0L; 8{40 08;0R0 <0p ʟ0P 0S !P 0( 0P2S 0 H_:`0C0 0S0`V: $ 00@ \:@匪0S _8 0@a H0 $P y0 H$0)$ [0`V: $Q N` 0 0C 0 cP 0`V:T p `0  ᩚ[ p r0P `V::0U0`(CE 330 aV :C ` 0 0"30 SH88 00 0h4 00k<0S  P00800 0 P%80S!g4 00E<0S  80S04p  Gޛ`P <000F pp40<  0%<0S  V 0400<068 00 V4 00 <0S  L0 R: L !N` 0p]00p[  R  Q 58 H4000  P 04`Z Z Z000 G 0X0 00 V~ Z0 0RP  d0 >0   PQC p0V `XOdH0p0<H<p(0000S \t4 00v<0S  p P[ 80SX0sFD$D-p@0 ,_Q0 0  0p V0`0  `=0P  0 RS0 0 p0V R`0 0 PP04 0,-4 0P $-P"0 000S 00P80S0s"0-p 4 0-40P, ,P P RH0t0`<pL0p<80S4X ! 0`Rl0004 0V*0000p(pW10 (W0 \90H ! R 0彄 0P pW*0$ ( 1 0X`xpH0`h0<H<h`x0h0E0| 01> ,l,,,dT,,,P&y&ht@3X,9, SVD&,W<0 0R,,0Q 0{Q  ,V,p@-@P`Tp0wS {S sS 0p t,P 0 H^0`@p e,P `SG-`pMPPU00a^01 R  @GPVAG5Wp8!p!Q <0A\S00 0  *^0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: vpP 000BS h,o\v0p@-P@`T P TP, 0S)00 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@,a-0@- MMP+@P X ] U+p8]+ j+ P+ۍЍ0H0  BR R RJ0 /&&@00CS0 S0 / 00&@-(A0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@~h,0-01S ^00So^ P0\ S0S Q0S R P0S0S0 00Q R  -,0@-  `Ğ\ @ T\    %R    ,-p@-TA0 5S <0S -0,!0<aP0U&!0! R8  (P 0  ,P 0  4PP 嘗p@㼉00\P ጬP D ϣ04 0ɣP$$Sp-D P,L,&p@-@0`  w+T  .tah pdPPT p ᧕P000ST @&&,@-@P cP>@P @0?SP@ p Ѝ/FP@PP 0S SH8'0S#00[@- .+=&0@-@<TQ T0B0 .0001S R0Sd0d@TPT T@0$D@ ,-T ,  $@-,&-@-鮤 -*&7@-@Pä  ֐0S 0@T 00 Ѝ0诤0"S sr@-@P  p U[ЍA-<0``@c# ^p "RG ^<0c#N 2 Ry&0 0p2#L @ "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L "L /0 0p2#L "L /0S00//00//H0H 0p@-@P@!R0 U0 ,㧞0P01pT-0H-01//00/00/00/00/00/ 0  /9- 0  /9-00/00/00/00/00/00/ @-@?-00/@-@ޞO- 0  /N- 0  /N- 0  /N-/00/00/00/00/00/00/'00/400/>00/H00/Z00/g00/q00/{00/00/00/00/00/00/00/}O/gb@-0  0Ѝ@- @+@-HV-0$%@-R  +@-HV-u @-0R-O- @-E-(0(%@-R O-  @- @-0B-?- M@->- @-A- (0(%@-R z?- < @-qN-< @-h<- < C@-_=-< @-W:-  @-N:-  q@-EN- e@-=8H- e@-5H- e@--G- @-%9-  @-N-  @-;- @- 0UK-XH- @-N- @-<-  C@-=- @-VJ- 0$S00 @-XH- @-@DP d 0 0@- 0|1wT-p@- -B- B-C-0@-@Q50%R   @  P x03S / xt p pl lh00S  0h iO- E-R- R-S-;-xM-0@-@ Q80 S00 @L  C   喘P `03S  xt p pl lh00S  qXH- VJ- =-<- N-UK- sK-rL-;-xM-0p@-PQ+0%R   p@  t/ @dGP 3S/ <8 (A. p{ HV- T0Q@ @8 84 C, ,( (/N- 9- =-<- N-\0QH H@0 4 4000S  /G-9-;-xM-H0Q4 4, C$ $ /H-=-<- N-`0QL LiD D@ @< C4 40 0/8H-N-:- =-<- N-H0Q4 4C, C$ $ /:- =-<- N-Q Q Q/ '  N- 9- HV-sQ Q Q/   8H-N-HV-///00/////////////00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/ 0@-@@,0@-@@y,0S00/ C@-{=- C@-s=- C@-k=- @-c<-  @-Z<-  @-Q<-  @-HN- @-?N- @-6N- @--;- @-$;-@-.0xM-@-}.0xM- @- N-  @-9-  e@-8H- q@-N-+@-HV-A-T`)qW A1@P |A嚂0 QT-A-@PP 0S ]`b/P .`1S0rKP O/P 0p R> .`@-@PI P { 0l0 0呀*l000A-@`\@*T<0p " RG\<0c#N 2 Ry&@-@[@-@@-@]@-l 먾&Sp@-@0S*FP) _BavP  RO}m|PFuGu5F@ P < 0@ S< 00pppX,,-y&O-,M@0P0 T; R0AT 011!0 S01  R 0 1AP5bP Ȁ,0S  R3/00S 3/[1P PP Q0P 0 0S^:` p` 00 1`@S0` $0p$0Pc$0P``Pp1U00$0PeUP0S$008C80ᨹ B@S SBڰDP@_@8C80$S@ Sʒa 1  p$P {" `0p B BR V` Z `1Z0Zma 00000 Z"Z0 "P P V`y 0CÐ   S CUPPEPE_P 0 zP ;a 0 0 0P@E>P Ml1  0 y  Q l7)z;XXW`\[PP000;!?@  S0010 SSQ 1S b !ġ1S 0C" !8C8R11$PUesps0 yP udyd `P 0PSY 2F p5 m0 m 0备<Z P ,500xP0 qP- >P( dP& <PV 400C`F V$P SuP4P 0CP  @@PP+t4P P0S 400C`C`~k1SR !0C B/?!1F]1NSAPN0 P ^A88#8xP  R11@(zP`PxP@a@1S020,(PJ @$3@P, #0@S002P0CP?P <P>P P2P 0PZvP tpP1aF P x}1S'ʰ1 F P x~}P C00P1 RE40S 3/i PPP i P,ЍPR0v _ 0SpW 0j 3/pd P 0`E P ~x h `9}h00x00AJ!0 b02P 00P000=c}h X,&60-&,-xS&R 001/X,P0 R0//X,O-PP$p`*@ [ !  0P@ Ѝ0墕00 1\$<0XP0 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @X,P/D0 R/0@-A1 P (h< @XX,O-0dBp W`H5j0 00p0庅 Ѝ0P@P 0S 00@ ['0 0 cqP  nZ0S  hZ000 00 `[0S IqP  TZ000 [0S :qP  EZ BZ0 00U P0IS0SPPq0 00*q0S %qt ?C S ZPU  m0Y!0C0S( 23PP PE Zl,&VUUU @O-$MH0[S0P 0L`ODpA F0Y0 0S 0g %jᄏ뤣`Ppp p 0@@0@0000. 0ESET0D0T00Ө?0S0 CR C0D S0  0ejpX 2 (j 0  BN„W P0{ P>  PN P P!VUA`E D{@DP`4i i i@`"PD P AP;  KR !   ` D0d{0@0!P1 `V0p00@  d&`J]|`F`FV0p00@  DPE9{@DU`E¨` Y @ &Ŏ@T`— R   BX00000S 000 0 0$ЍO0Y S l,&&A-`PlPp `o@o@0T .`P@ P xP0000l,@-@Pp 00T0* Gp@Ѝp0 00jt` 0 0 @zF@t 4῏P  T&l, Pp@-@*TP0Ps D` R :ٲP 0S@@Q@pT&l,@-@B0000l,0Lml,0`ml,-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@@-@@-pMP@`,0 0(e 00 0`Ѝ@- ЍO-M P`@pn@nUjT0 0bP?0 D0SPY 0SV L00SRD傍PPL00PT^y@DO@W =p PSWpV`KЦo`0 S`K0 s@PE0@ =PT0 0P00L00D H0T AZ  t eoyeeЍD 00R00S 0S "L0X3#Pp1z0tP 0 t똰iHHff A|0 EGsb`PPHH`ffl,0-@-,, ($ *Ѝ@-`$0P@ 0 t 00 0`Ѝp@- Ѝ@-pMP@`,0 0z(W 00 0`Ѝ@- Ѝ-@-00c @ @Ѝ Ѝ/p@-Pm@mpl,@-7@- @ЇEA*$ZPU %% 嘄J00h@PU %T 刄J00000S$$忻 Ѝ09-b b G-b ,&c O-CMP@`0P@0@ c&  @+a⧂PP P}JCߍPpW  @ npPY Z  ` 8 @ =R@</8@Ꮔ p J}e e e &e ,c e 1@-nC-0MM 0p@~`P0 PP* P nP 0S0 0    HPP0P 0 Q000Pl|ۍЍ00P 0 70 07e e ,00S/ 0P M@-G-|M-X@-ІP CP <?@("P@b e C-@M S@\00x$P.  P0S%|P  e0Sn Y0] 4)PgA@Pc$Da'DL*A^&'ЍP@R?ـP'P'20S @`P'.-Ap0 $!P?므 ( X$P 0)AT PYP HAP pPP 0P+Q !S0p 7'SpT+ApW36pp0W3:X# @PQ  R@4Q p0Q  R@@P`Vp003/P,00  h0S  R l 410!8hp4H-/j T-E-,j @-MM+@({+(}{B+({B+s{(?PލЍB?P `0 @@@@@ @@@@(&B(>>j Ej Jj -MM+ x{P+ @{+ p{+08{ ?P  >ۍЍ>j Ej 0@-M 1@@@#P @  P A0$*!PRW)Q`p&Ѝ0RN00S 3/P 0$003/0$7*I@P5P1[P-W@P)@P% 0P. 崉Y>&  0S 0_ Z'P \@PLx4m0k%(*004H-T-baj lj 0-,-wj @-M }0@@@>#P* 5@$  5P 00*!R00$Q )e@P  x0S 0` G'P{%h()Ѝ4H-T-O-`M  0 0X#*0S ` 0 SS 0p0 S00C `@0S :|PP @B pQ %S0S iSc %S, dS 30T PsS,200P 0 倠ಠ@ZR  @P %Q0 @0S0 aRT @R$R0PPR@  T 00S 0 ! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^0  3/PW Ѝ 0 y&7@- @PU ! = uF00 Ѝ0lP X+ H % ]yQ$ 0[G-j j j j j p@-@Q`T80800P0S0S   0p@8G-9-j 7@- @4PU  O$WF00 Ѝ0YPP x 9`00S &H EB0[( $""9-j j k F-$k -k &s@-`4Q@k<l Zu}| ubfu9bfq jbf*8f+b8Y}h 0A&n@Pxx7P BBlaoa ~|Ѝp,-Rk Uk &Xk O--}Mp@` 0 [p} ✵0%0j(P q`P lqpPT Pf42 $U(0B? 0O-P  kuEPP  blE00倈Pp{PS; @  LN; ;0S ;9P ; a#00|3$"0}ߍ3`33 4͋0"!03140`040&2ʋ 0ʋ 4T0 T  (0}P,00  ̲>"!!0@# r PO  XT $ tӋX2P ttCŌ0S%@0 4U0 8"QS b`'1P ~1 \W0W$2rv1@T m @>0XC0@0S@ @  0R0SQ ስD~0S  Nz 0 P`{s0  PS $29-G-ptG-k k k k k ;-k k k k |M-!l k l l &l 0@-0,M 000000 00P0 00h0 PPP@P DD+@0Q ,% ,Ѝ0@C~ T&&)l 9- -O-iMs?!0ZP 00iߍOЍ/Px`P<1P 0!0P*`P z[p P@& [PpT00Z%CU0P 00GSW 010#S G00PpaP@ P&+Hl 9-Jl l-O-0MT@pX   p$p$ `V  @P'U` {PPP/@P BH E0nPU m0'SP0U*S / GP00 xX/0 0P 0@ 0 0H0 }PX1Z u p`PUQU( 62S022SP0220C2  S |S``& Ṅ-z$00 0( 0 09`0VPMUSU PPV   0%S @S B B*∉ 0.S 0 0P1Zp@P^ 0A0 H 0y $R9iVz00 (@0 0 (Peqe0S  ^V0A X0E?o20S d^@c$^\ceyV @ x 60S. _e@^y00CS0000B U0S [$0S  `8OV,iyWU c|^ cX Pv^y9nG0ЍO Ѝ/|l l l l l ht@,-&l l 0@-CMlQ0PP 0S .QGz@P8 uCߍ0 Pu ,,G-p 堀PB`A@T:00Y W ,/Y 000 zP EQ 0@&l A-`Pp p@ w4 pt Pd@,A-P\o@Xt pt0S DQ0Q.SP @$ $kt gt,l ,p@-M8 8PLP p  t 8PLP b wt Xp@ (  ht wPU )t@tP ` Ut 00 *@PЍp t tP!i,%i,,8i(,l O-MNQ >M9||6nێ,Pz`0尪S ᴂ W:-8 4e0w=C $ C/E{ K00;{=0pQ>e0 sP400刂0 40P  Uw uUr0YR?; 0/tp @*<: R0 :P'P P 0X60,0:P<J.̟ 0  0/P `h< 0 B0u`````r4Pp0ۮ0tl= GD0Glq0,ݍ<Ѝ>0a Xfs v`P  pP; `{ 1sS1lS@+2 0P%QPL ]P<;c`Pp},9s*0x*0wnKP\8 0\8VW*0yU *0z*0}\8t*0|\:U :L*P0Q8 8* Q9ʟP \ʟW^9    +9 @H- A)0p HA0sp p=Sr9<)a0hh `P 0H0H0A sp , AsY`P( 0JVi tyPSUp`jv` <! J8H p0n`0<X(0~ad@垂P T,噂P @ⓂP ⎂P }JA∂P ⃂P ~Pg0:4LP '0/\6S '0DU`P 5|| ph,'[7S0 '#?x& P`6 AAy0\8P >P &6 jP `(:4S (6 YP 0: APڴ  VF\8&08\8n襟`Pڀ q j v%8P00Pڀ( q X vt%8P0040S\80\8Pڀ q @0S %8Pڀ| q 1 dvP000S\80\8,P0S\80\8`:Τ4S4Pp 0@?S` @PL 3aq 0{C:$P0R#R#t$ßRp#lW%R2L# M ? 0S2 DP 2@T =P HHv* G00S |"d0S p"w >3S6 U] "R?0⸂0N?C0C `.t`0  0F0`ixP:A?Faێ80I,0`I7>E00x 0,P"H p}Y0S eg#WW5S '!#orXv}wX60S`0 <I W4`P , 10000U00 0P100 0<0008 0pP ,0<<0@Dy@0S gP 0@  !D00 0S0 !Z Q 0S0H L0 43/4P X0 0 0 0 @-Y P 0P 0Pp PQ` QXPQH "P <0P/(/$/ /u Dv Jv Nv p@-Q4@P0@@DPp 04Pp蠚&p@-P@P  k j00ppv @- 贚&@-x &G-@MPP N/~ j0 0 0S1 0S X7P a-P ލ0S 0S1S P zP @l0 1h0$1d0(1`0,1>1S nP >H%0>`@$(Ԡp+ ep ]  Y + $0 Y 4p <[0S 3Sj dt ~  ~008?` `p䀍0kP 0S0)#0C?o27 #3RR  0"R6p7 'Sn`0F'Sn`0pF'S``Vn`0F(P~ 0C QY > 00B,0 c!4 㐀@<#M0 p^IP\P fP ,04!k`~ <#`(`xL2P  @000@A$"0p0N?P0S J`  d} `}KR [}00`K?(081l1$1~0 1\00 @a@ p C 01/@P00pЍpP@00003/003/$Amw O-UM M`Mx.0Pe'{.#{ QiX@,jHkD^aW[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7\4 04@0Pύ✗֯N#` 54, Q~W <S T7h4F>D0C247\41 [ V?h4F>D0C26A\4 040 000000000 00p@ }0 p0< 5 5s 1yt0 00 0000 0 0p@ 0< 5 5s qଔT1 @t00, n/E "f5@0\qW 42XL1`⺀0Nόpjppr຀q ph \ $t00? 000/0,0S00Ӥ?'N?,$"@p0 ,0mS` Ed40S N?,$"h4@PUX4LT0}10  A ]f "Xf Tf,1,1 101$10!4141(8H!L1 1$!0L1H!,7|$ 1(1)\,, 1010$1441>(8A $$ŸP   ^{Xy! H#A0$100$4;P 3x2P >{\ {$10N0$10HP0 0 0:n0H55S  Pf $003/$puPM pQE! >,!  '7$H0@;S 1 HPhP> <<S: $10>C418<100S. @ra 0bWQ!!10b/y0,1014181>C0(1}1S0}1$1S p E@4H-,-&L ZAv Ț&T-M-=-8H-gw 9-%x _PP$030/0@o//BO- MPM@AT0*!Rp0)A`T0 $0   P f Pp ,*(0x$0 `$](pP H4\,8 ܍Ѝ4p \h0Spp0 P0 4p0SW00l , Ri  000;x8,9/PV0  ,x8;;/0  ,x8;9/T0S8S "0CS0S "S S/ Pp  R < p9WP00P0*|2YP0 T Pu' (pP 0s &P }d0S "8_8 "O@d0S !8P\0 @S !H8<`0S !>82X0St! p!S0 80` DL0@ O@\0S ` R !8A8 ߐD@D~ِ@x@ҐD@Dq@ːD@DjX0S0A@`^pQWppc  ^T-x u fx w y  u y 4H-(y .y =y Dy Ky cx _x Ry ky py y x y y x x O-MuM0*QU$e U&V'p@& _ Z &060 T Q ȡލЍB )qW nP7 FP!' P - @ P' @H0 pX p40s40 P] P U Z@D`@ E p PU   c0SIS  : 0S #S 0P00P F0[dP14s10d#5:`#`S /*&5(&;&&0@`S D & & /0ispp`0 0 ,0S T0 S00 P0p0SS40 0  0.xP;85/>P0400S8RT0RP S@" SA00 80r80PP QL ,0@8aa<th\<0 !L! 080$ 0t40 ( ` C S/  S" 0 $04@(8 M>0@0P@0T@D0< MP t M\ 0A00@30! 8@4L( A003000S0ؒ; LP L oV} 0@o/b 0!!/,10/4op@-@4P0 ` _1111p,O-P䐟䠟䰟@p`0/ C !  !0  Pr00S  0 0S 0P1SR0B 0 0`p@P X 00,0 000`00 Ѝ,X  $ 0@-MP@/.`r1, 00 0d000 0X0@@@@@10 00@0 ,Pdߍ0 ,O-P4Mp@` 0SpP `Ppp 0S00V0#S 4Ѝ0L0 3/`P0 L03/P)  0Q R  S^0 0P  P  H  , R  T  X $ \ ( ` `, 4@8pTd pA- 0R0 DQHa@ 1QRpB   !LAPAP0` AS0Q     TTAU @@,~ ~ O-pLBMXQU<2]PX\1S29\U \QUЍ0C`1~`1S_`vl001PS \1 X6X1! 0`1Vle.X`00 T1a "X Xq\pP6 \ ! Nq000: S.X1 2 \1`0m0X1`bdP 0 S 0.S ]hop ` XX9P\ SX1, 2 $ e3],& \  h ~ p@-MM`SgPoۍЍp$P@P+C] P*p+ ] P*+] P*P BP~ ~ ~ p@-M@(NL`P8 k< 00~k P (P8(!P k aD o@P Fލpj~ k~ F-~ ~ O-M@P! c0 G 0G봢p`Y  CpP 0 0P0SLߍP W%0]PlP0 a0CS0S p `.Vp08Sڠ0S`p R SX0 0 a00G  p 0X1U0ů0 0s [4+ :pY0 hG @0cG0t00 00S 0 MP0[h!R@PO )O0㏐ 0S*?0 !CV4a0 3G~  d@edA`,   ,A-`Pl@p01ST0D@0S@ V 100 1P!P, @- @-G-t1`h1h1```A`h90 0 'S Ph9]!P h900 ! !PV0<1"LPDTPPH EjL` AjV !Dpp1 p!9jW !T``1 `!1jVpp1 !p!*j@0 CW P!Pr@ЍG  8 $ ,G n @-M@ aP @oЍ@-| 0S pP`0 X00T0 LCH0080 8<( Ѝ ЍH-o N-=- M-<-D-@-Ml@p9t)0 0 0T00.00 0 Ep $0t !Ѝ, p@-PP<@EEFttp@~ -?@-@P  嗇 R4 &(0@YЍ0@ Ѝ/  @-0  0 P L0L D@D @08( @0 ЍN- ;- M-D--3M MX aEP0  4jP jo3ݍ Ѝ~  -3M M CEP3ݍ Ѝ~ 0@-M0  0W 0S@Ѝ0h0h h@PX0 P00L0LP P@c<00(0 P([8H-N- N-=- :-M-<-D-@-0  0$ P <0< 0440@000 0$9Ѝ=-7 M-:-<-D-$ 00!S//,$ 00/ P /,, 00S0 10 1/,,11<0@ Q !@-0 " !/,0 10 1/,@-M /.m, 0lh6 0X 00000@0 ,@ߍ脜& ,H 0D /Q/QQ Q/,&@-@0 0 0@ZPЍ> @- @0S00N-R 0@-AMlhP N@ Y  P<04Px9啳/^0Aߍ0i ,e x DV-P@-@  0P   ЍG--@-  Ѝ Ѝ/-@-0X0@P @  P&Ѝ@Ѝ/၀ -7@-0\P01@P B  1&, Ѝ0@Ѝ/က {~ 0@-P P @   @-@gP@ xJo& @-@0iP 0 P * =-<-E-@-@0iP 0 P * M-D-F-QA-@@1@#PP1P#T|p|` bP (B(A{dp"m"NAKA99\A\,-F-@-@/P `m(@f 0DЍЀH &0@-EMd@DP X ]P00404 U,0(x:@rEߍ0DV-p ,@-MhPdA `Qn `]Xf<1-0 x @ 70l<B'0 000H0 0 00 0` P0 0P0 0``PPppR0p2_ 'lUx:\ J P (X((Jߍ| , DV- & i @-@P !0`RxzhP PP pxZ P` 1 >G/01K<0pPڶ@T 8[ Ѝ,ԁ &@-@<&@-0 0 Ѝ@-0 0~ Ѝ0@-@M00 000 00gЍp@-P<@0/SpQ gPp@ꄜ&@-0 P =-N-C-$M@`pP60  1P) 0 PP0P00Px0 @`PP0L`ySa00ͅ0݅000͕0ͅ$Ѝ n 9-G-N-;- ށ O-`-,Me$u@uE\[ jpPe $;\ePd@T10S@ ePPEUN TT0 (i$0P0  @$0VSS00Y00S e P E H $\0 0$0   0`$ VRR   P # 2R @D j0@Q@Ze `P$ [@,Ѝ, G G-p` @PPU  hPP 7/2G/11PpO-@ M$[`P Ѝp0P 0`0VSS TP$[-@-0 0Ѝ Ѝ/g -@-0 0Ѝ Ѝ/h C-`PM M@`P @@EHCpR< FMA03V,V]DADVc & 0Sn 0CS+PCS0 ) 0 0S8 0S r0S 0S QN@tP$ \0  AL0 @n<2P 0(0C?o2 7o00`H(0Sލ Ѝ!7aS eP5S/F B !F? $F@7o@1Pn0 < 0M _ 'j 0S 0S} q0Sy 0Sv QN@YP 0 @0 @P`F? Q. QFOz y{ Ԃ HV-8H-N-)  j ,&w~  &n vN-9-= W ` -MM P  P ۍЍ䄃 -MM P  P ۍЍ䑃 @-jP( `fP! % ` 0 S0\P @00KP M@T TgЍp~ |0|+R/@- h@|+\0 P0D0{80"w,0&s 0,ă V-LZ-$V-HZ-@V-PZ-P@-@ I0@XF-p@-@MP H(@Yh0H 000,0@@4P,P4hPp0: S HdP  T T܍p,0h 8,hQ @P@Pڤa <PT8|1| B,gp8<DQi*L1 0880%8PP  QP00S nz<  R t00 00000 000lp@ m(U(0tQ!=- M-<-D-x- 2` H-N--L O-CM00qSP `@p0!`i50S`PW!000J @vt@3/@P CߍW! 000Z 0S)X 0 "@!PT W  00 0 @ 0S l00S `  P0W0 ! !  000N-;- (V- F o xM- ,7@-PQ0@ SS <_4 000] Ѝ0 2S<0 ꜄ ~ O-PUM000 K$4Q c  f$ğ0/ScP3s䃟C00`/VeM3 P Q$LUc@ A@ tPKVP LDC;}@1 Us `PP$ 0RP 2<P 2`.S$o3^ 0 10S 0S6 0 1S20S KPpG $1F3V  00a G! p R R` 10 1000pZR `01S RB  0 P a0S  /SPR  Uߍ` 1 02UV U@P@T dT G- (V-&,ӄ 4 ~ ȅ 0-,- N-Ƅ p@-Ph`@TUdpUP`ZP  p& G-MM@p`ppT D~D2PCP P1P  /PڍЍ D~P D~P{6P~ `P p6PqPP00 f00 ]}Z` aP 0=Sp  B PW  ]P XP SP`lPvt &$"F PPꃀ 3% = T 20p@-4 P@e 0Pp@@-G-@Pp4 d0pS R p2"4p0QSP pP`p 0S!40Sp  e`/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @PdP  p@K@-@ {(y@vA-P@p`p0S 0pp RfAc05#Ph00200#X0S0Q #"0hPhp P#"4`V000S 3/0Q #"04P4C- 4p Ѝ`uAPrp x # o /i 0pW@뚶 d@T T ``PMP `P @] d }Dn ҆ @-@8S( pPp 0 0<08| t6`P(XRXH L)8S08 $ h08 Ѝ耜&bt&؆ f@@-H@8s0 0q Ѝ@Ѝ耜&p@-MMP`;  p  @p dPxdPۍЍppp@-@P nc`L P  0QpzPSp|d zd@@-M MPp; P`i p  @0PaRP5UdPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPIc00/00/4\80S0 S001/\80S 0@- ``@0"SR0(SS QU S!0$0S\  0 1Sp@- l@$\ P0"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/,H0 , 4 T 8 X  40S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4 BRp01 408 00803/P,000403/,H0 , 4 T 8 X  000/0O-p4M@ PPp`/04ЍO%0 L03/P! Ѐ 0P p* @D Z[H * R T R , [p :b8``pp 0S0P 004Ѝ0M-O-P4`ȁȑȡ@ Q 1SQ " 01 r " 0SQVLLSSDSQ R?!S,0S 0S00 0S  p!"00 0  SPH P00P00 0 K`03/P L Q Q  Q R S9 pe = ' & : & l 0O-Mc(0<00PSp@p`00 # 80s 3 0 \h0@l0S@3 `` 0@  "<0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0002Dp0 0 [HL0 48 [00(,(, 00 0[P23U 40p0P<0SPP0 M T00SI0Sj00q p0 0 0 000000  \0 t0 00000PX 00808/[0 PpQXQ Q(00,0 0p4 80 \`\np a X0S l^ 0$0p0 0(00,0  04 804p 90-0H- - G-`pFhM0pSP^X ?[0S 8[0S1[0S*[0Sk#[0SG[0SH[0SI[0SJ[0S`[0SaZ0S,Z0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 ehЍGc ( Z0SWCL4W@048P Q Qs0 =3003 0gZ0 0 hЍ3003 0WZ0300 0$p3 0GZ0 0TS(0p`@ 40  SH0pP0`@SH0pP0`@SH0\000 SH0`000S#H0rd0S tP`@0 # s8 OP0   R>0  H0L0  H0L0  H0L0  H0L0  H0L0 t H0L0  \ H0L0@ Dz H0L0E ,hЍGq !耟SH0000 #0PpG0  d :/0 00(0}0-9 = pe l  ' E-0H-0 & & ' R > ,Ѝ ) (< l) O-P(AM@0pP U !b p<#`~0!(<#@ sU`P $P (I00 P P H000PZ!@| 0 A@BrA  |!@Pt00Ce  L!0-\  (!0 DS`PpWP@!@3@{W`0 -@DPz\ @0  -U!ʨ@   P.㨰嬠+P00 @p ` D/Aߍ!00PRPV 꼈 E- -- $ `5O-p-0M<@$3P  P,0 `P%Q 4 0@0D  U 0$ p0pC 0@D @0 0[D 0S , S00 00@ Q`42PP00(4 0 4P00 0A000 00PPPj0S@8P t0P40 0H03/0S0P, p p0C @P0D P000ŋ`@0SPP 1(0p(1PP ! B B2"PQ% ,0B ,0R BB" y[, u[ 0 R80pPn e0 R01(1#0ഁ000Ѝ<0X ∑0L0 3/ 00X0 ,b0  * 0 P  1@0 B )R R 4PR Q0r Q0CFS0TR000US0a0Ѝ@0 pp 3PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V P @3P0 /S`Sp`` [XtT00U0,`0ȋ - 7- - T8 T- 8T-h9-Ë O-0MSأ@pЍ`  W0 @0 P0S% cS2 %MS) CS, GS R 0TPP PSS! W+0C?o20S 000 00SmS sS gSR 0R RO-OMM400 00 P00 <0 0PP0@@0 0P P(0 0H03/000400 0!6 0R 0 ( 03/ 0`` S08 `&PT&a0PaUTa`0$080(&00,00$0 Q(`ppDWP0`05R0h0d`  `Vp S` `U T` PU` VU 00L0 LPm4@ 0X000PS40\P0O>C<0000D040 40zO$pUL0 R  Hm0 00H0 F0HL0S pQP 0S80Q00`Q0S 0 L0aA3/P 0P0P 0%003/X`\0F0 [8#p@P0?$OUP 0 [0 0 Z0R0 P <0 S@00D00S8 P' a`0" $0$0,0, 0,0$0%$0匒 X+ 0N0 p+0  0N` 0+ F0N 0 u+p0`00d01` 0Dl0h#+X@+@ Y*pV 0 LlU 00x0 Ll0H LlH0*,0$ Q00Q03S (0A( 2PIjsp 0 P %B00P3/` 0X`APQ2VfP04PL( OލЍ 0 [0A 0 Z0= 0 [050H-  E-  B    + 5 @-@! 0$   0 P 0"ġ0S 0$ O-Mp( ,P|@`1/0@T0P5@PZ@TP0 0M 0pMpW U T 0MY00 @$P $ W<000$08<8pV 0` S04 $i$a0LHL0d00h04O0l0廿d  pW P㲿d pQ㬿d WJ 0 Pk 3$ 0X0 0p0p0 0\p@0800<00#p WP0, R)  Tk0 0p@0T0 F0pTP0P pOPP $Ѝ Lt0 PkT0 0S! 0S4 `Q00Q0S 0 L0aA3/Pb  0开0S S 0%PTrp; 0U%PJ003/%B0K0 p01( 0R, Q ( , W (p,  R\ 0Wp(0S,0 0>9003/p 0Xpd0%WQXcվpE0 Z00 Dy+p LpW000 0Cpÿ D0LpWP0W000 000W 000$0=0H-  E-+ B  0@-@M@0L0 3/P" ! !WQ 0 0 SS@Ѝp@-MMM`P; `@P Q = MލЍp{dЀ@-@P HMP <MP ,MoI K W p@-08M@ ! 0`P 0 @@P8ЍpMPUJ0 00  0 P@o`1C-M MPN @a0P *1SE$A T )1S ݍ Ѝ Q 0 1/PPPp@G 0S0 L03/P ,0X0uP 0  H x;8/P H{@T-0-@-0 P ` h9-@-0 /PR ЍP/R0 R/R   0f a 0-@-@@@-@@ rl @-PoP@Q@`P  Cp0S  CT K T @LP 4 oQ@ Ѝ9-} G- &@-@ @0&꒍ @-@P@@-M@  <  <<  ܍蠍 0@-MP@~  <x  < 0TsP< ߍ0詍 @-@_@A-pP K`⸽@P P  TP$@0 !PP Ѝ0$ D굍 0-p@-@P4Sp@Tp$ @PpܿDp0-̍ G-px`DTP HLPP@8 0 PP$0R040-܍ A-TP4SA p`4q 4 @0< ; D0-p@-@4S04pTU TU Tp`04<0 Oဿ0 4x0-܍ p@-@P 0p@ p@-@PJ @Top    @- @- @-  0P/0-0@-PM 0 xPP 0PP @HDᘕP0ᒕP0Ѝ0@( 0 = 5-@-H@iA-aJ?pW;$AT"0 =PPЍ @> C 01/@P  0Q$AHL Q>0 R 0S P P 0$003/$qT- %0pQ@-4 #"T R0//s@-(@T@ЍpHp0Pl0 0003/@P幻㹵/@-tM`P 1Q@ p@@&P  70@Tp@tЍT0 @T|0 Ch0h d p q`P H 8mmQ N-\ k 5- h9- /@-o@1@.( ///@-0@Q TD@o?0 \ 0P00P0P//5-@-0M@0  MH00SI0 000 0 0 0Ѝ5-//A-pP@`VT0S0S PKJP $1800SI000X0`p@ꍎ 5-0SR00/p@-@P}H<0<`P" 6D0# A@$!jp0H-E-A-`8P@JpP( 9 A5-@- @-p@-M  }M0p 㿺0S YP`L@@P㏴U 0 0+  '܍pcN- X 1G-`1MP@1!Pt1t10pppl`PBL@N^D 0[+ߍ ܘ@P \eH I@P 0=SH ?A@0 Y@lT@  P t0 R'@P P I@@ UAG9:l h e y { 9- 1A-@1P-`p1!PP0P0P`P`P0 D ?4 g9-9:Ώ ď 0p@-M002 0`0P 0p@P @T 1T 1T1O/1 ,)P1O/1 Ѝp$ ;R$0 @- P ,C-CMp `PuLP 70C@P @0 0p傳0S1O/1 Cߍ l Px0p  E0S  b<T wx1 1I >-?-o[-Z M;FJp@-P@1 1  pDV-1A-`@pָT,@` 0D@Pθ0 A 0@-@ ] 0@ S[-@- @ KJ "Ѝp@-@!pM0P2".<`   0`<01@ S0lkv@ @qppЍpWk@RkNk Jk 0 p@-P8M@Q p 02`\PAG0# 8Ѝp4 0, 0$ 0 0  # & ) p@-P@ჸP $"11P N/ p8 V1p@-@Pm1(1 P1 1 pG V@-X@8 C-eM@.p+KT P2P'Pt eߍ20$0`V@n"'B`(ppP0Sn Sh  @J 0 0`P@%,r( "0O8prP ߺP !20L0!0)P !(!pW ( E 0( Ep ᶺW`1N?`0pH!0(P P110@`P!0FS07P0@ ; E8;   & 0F 0 0 p000  Ḵ(@ᖱU4H-5DV->-?-o[-&S[- 05-Y ߑ 5 = 9:9- 0-,- K10@-@aM Q: QE:.`DJ0l0|0000000;g0P0(4x0`p  l  & F 0 0   000W@5ᢴaߍ00-,-̃ u P @- A-`$?cQq@P-@T 4 @. P( 0  3!"P 0 )< P ;F@ŹoЍX0b/tL 0 P0{ 9- ` n  F h//O-c@T Ѝ@T@T) ^' P@ U[Z [Сԑ YZ PUPE P P$P@ P$@0"/p\-O- [`RP`XP` P40$ S80( 004 8R0$0( P 0XX0S$ $ `;PS S2P11: 0S D岰 00PA`^U:PU2QP0 Đ(Q $?,0S ! 0S E ,v0<0P1 0$ 0 0 0 S 0  0S 0$ TЍUQUB"01x\-{p@-@TP0S|!R+)r00 S @ 0N Dpx\-O--BM MXt\08@P 0P(` ; Pp[Bލ ЍD0 PO MQ 0   d00 u0 0u0$0!`4X00 pvP0F`F0;S $ |PPV +RQ 0P \Q SC0Rpʨ0S R2 S - S/ S0S00000000`0 P 0S  ?/ 0 R$ ?!a 0$ S0S 0$ P0jedAږ O-DMhPl`kPDЍz@P >$p6# S0 m= P`;#S0b=p0 d00`0\ h0X P$`P`t0(0 KH̳000 00 00p; @-`X0S0g'. C|A\0@S0h - C`0S0i/ Cd0St0j!. 2Bh0ST0k}/ pP S 0&Ó Ѝe ƕ O-MpD001PUЍ䠟䰟`PE 0S Y0@  0 0 p1/Q S@@@  Q  Q @ 0@0R0 0p1/P @\- A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-T@p`P1S 3/`V@Td0@@?T0P0S@000S4000S(0000A{ |\-\- p@-@4`4P0Sp@k10S 3/@\-|\-0 0#0/0@0/p@-@8Pq, 00080sp` ^/ 4R R0 0`40$ Rp `083/<0 0"0`P0000X0S 3/ 0P001S01 0S0P000 00//00/00/00/10/Q@-@@@ 0A0003/@P 嬭  @z C-`BEM0SP;0嘭p ;0S㏭;0St刭 ;0S ね;0S@z;0S(s;0Skl;0S00$ R!000 PZ0H03/0S@`H@`A0 0Ӭ`P x" 0 Q"h2 2d"I0C 0 0 000 0A 0 0 0 5倨0S("0P L0 3/P X0P@T`@\0`0 S8㑬P[ 80S ,0 0, S001z40P ∡0L0 3/0 0P0 % % F   0 0  qd 00Tp`@Φ0t8@,Ʀ0æ `$0`p4 @4d!0 p 40000 f0,0 d0$10嚦0$10\唦\0d00h0@ 0l0`p900S<p0  PÁh ,`3 000000 000 0  0,0pۣp` ˣ3d,0᳠ l0S> S@; SN`p%P H3/P 0p0072|0 00p L03/P x0| 0 00S 00CS`p 0SV $vP2Q cЍCP00SZ 3/@@OoBS O00&0 1@0@!Rl!@!x@|@pPpt@@t0S|0X*@-P PQ 0!@x 0T:x0S@ ᄣt@OoB@|0xT:ݨ@T-! 4H-6- R) 088 H |\-X uL , 9-K >O-S`4UM@48 ` [D }0P(0 wpP(婨 Uߍl0P,0jᝨ30 40S 0RD 80S:(1SK 1<00J ,HLAP4#0A4  H@L#; $;8 0@0PP@T ( (0B2" ,0!P0S 3/P20 SU0%0c@D0`| p2Rn1@<2U?0P00X N H@`(HD! @<#P`T@ݤP ?` 3@ 303000 0040孥 @ߩ 2   0 ԩ 20 ˩240P1:> 6륤@0 000000 00000(0 p` DD0S, 5#7QZTX ᳧ᱧ(寧,孧v B䦧|\-\-) h noG-JMM/0`@0zPP+#P& 0S" h"`0!p/7P T` H 0@T* /R  5P8@bm+# P:8?0 `H᭾P+0: S pW8>00ꨠ|!  PJ>0@0/SZH!0+ # SP`+# P*P 0/S`0oo`bS 2p 20&000 SV|+*# P*+$# P*PA8@=8@`JލЍ诚  @-s7*@-M @$PЍ(0  㲼@P ᧼ P 꿼0S:$c(#"c  8#8S G-`$PPp X`p)@Ph"Ѝ0S @x 3Pd0 OpL峞 P Xp $0 @G x꾚 š К A-Mp `PXP HP4+"ⲽ@P@ 0@ ?⚽␽@Pi+J"bJ.0Z+J"xSJ.P0LKP PP|<B, ޫPPsW+Jh"3J.0ΫPPcG+JX"# JB` ᷫPPL0+、J@"h p0`!0J>&P 0.㚫P UT [ލP@[+J"J PPpJ.@0t+" jP h J>cPT ߚ   I Q ] l  & +  ' 1 /00/00/00/00/0@-4M@0#|0$P 0+0P` ᥾P0T0670 P {P @!C4Ѝ00H- E-7-O-MA Ad2,000PB,0 00000 80s0`0Q, p $  ?(0$0L 0s$00 0$l5l% T`@ @`3@0S 80< 03/P0p80<P Ѝpv'80s D@0 0 0Q:8`0S0` L0$3/$P & [P T0T2y@X"&(@ȼ@@,0S:0=,"(0P⼼P@0@00 +0@080s=0 0@( Y SW|Ѝ#!@&(┼00\1 0 .`!00 XT'@!0(P| R P@ !0 0 h0 @ 0400t0S00XT00P0 ̟P@| 0(I@hŸ $@8q 3/P0H- g М  ɜ 0@-)@M0 p\*4 +㗟@,㔟P 0ܟ*㊟P ՟-ミ F 0.y 0 BЍ0!0P80 S+P ,]P ߜ E- 88- A- @"(0M2( x0PQ2d2 5  L! H! D!, 1 0 8!8 @`0$ P$p 0PUp 0S0p\(Pp,P(FA}(00FC0Ѝ0`0 PCp0 L03/P 000P 0p0  UPp0H 0  O-p4@`00Y)Z]p !!%PV 0p  0 P 01Q 0S  M00,0 84p $0T0 0X05p0 P,[.[ P Q  0J.0 P8q84p T$00Q[ 0  Q QPPZ 00 00 Ѝl2O-M04p@$埽P `_PP $0 Sz22@|x 1 0100 0A00000崛@l咘ldx0SS(~PPL p0(P嚡!1Ps0PA x 0R`( b ",0x  B =1 91 0 8ܞPh l,0( 040x0?o21000Ѝ0ҽϽT-< u O-pᨑ娱,M@0S0 /00   0S,Ѝ/S  F/00P`p0U1(`P p㙑!PP PP%0(` 1`0 00400,00`T00 X08` 0100& $-p0P _k P'ᘠ`4H-WO-\M@P4 p`儰00 SU 0 Q$0S   $ p0Pd9\ЍO*.P0~  P%0#p#K*,9r`00000YF(0S` ` 0 RH03/0p``0[ 80s ȟ0 Q0 0 \0  BR0S0pS 0[p08 r  *   * PU0'0U " [P R 0S  0* PP p00 . P 0$ PU$0[00  [tp0 PU[n0[( !P$: p00 00$0 0 $0 0pS 0pW ^*pWZ 0 p 0P Z$0 0 S*0 0S  0>* 00#0 P4S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S0 0Q0000 00000000 \Ѝ,PT P 0Sp  0 ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 0 , R 0R  `xR  :+P` 3+P 0 Q ``T R T  R X `( 0SY0( L03/P <00S D0SS000(( pAL0( 3/P 80<00S (0, S004 Q 0( `M0Q =0G0[^80s[ 0*0 PQ 0N[pq! 0 QQ 80s 0  00UPppy0  R 0S  0( @p0  0  .M-@ T-(H- O-@-M`,p0 40PVZ p๜pPU Pp0Z:`PU`J6ERUB 03 D,00#h R 0  80s0`F`pHU p .h0S 00  80spHY pPp .h0l0 0L03/, 00Y:pPp嘝p0^0P80d5ЍOp0H03/,08$ $( 0RPP$P(0<00WR:< R4*,0, 0$` 0S `0S< p$`Sp $ PR( P`$ (0 (PU` P0 Sb@D S [0S 0 8P`p0VT:00S40000040,0(pWr틟8`0[:8`pp'p < p00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0'`V`P p0l  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0P~0H03/v8P0@00D00Z|*p 0<0 `80s_00\ <0 0RV04@ RD0  0H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/008 000@0 `0[ `0  ' V00 400Pm۶ ]M-! 0 0Q4 0ppP80s00  h0S l Y|* 0L03/Po !0 儐X09/Pe Λ000400$00(0 0$0 0S(0   0H3/P, X$ 0 03/p8  0L03/ pPpP$0( 0S pP(0$ & W00 40000400$00(0 0$0( 0c<,$ 0 0 0  0H3/P0`r 0R04$( $ R( 0  0H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0S ,0S| P0 P  R0P0t000400$00(0 0$0( 0c<,$ 0 0 0  0H3/PP80s0 00- Q ( 0 S% 0 Rj80X T,3/00T00X0 0\0$0`0(0d0,0 0Sz 3/p^p0`0W:0p Sn:Pp`,0 0Um:8P  0$ $0S p 0p0 Sp៙`P 80  p0R:pYP Y:PpW 00U0#S p`ЍL0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,0,0 L03/P 00p开8S  8y\ X W08P@DH0Pd00   8 rp0h p`o!8p 40U 00 0S 0P*` p }*_80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPF 00 80sh p R*P=p@-@P(Mw(0S⸘(`,`c000P0 F0 0PP` p P(P,(љ(P(Ѝp000,`(ř0,`(P,- R 7-O-`XM)1$qS W W(!0 "@PЍ00> p C 0 1/pP0$q Q 0 >  1/@P@p 0X: @1XS<1@1\1HL1X\1Pp(, !P#0@ 0$'8 '0 0 W %&, 080000,  0 :0080000  0'4c[00HH0P00T0(0P X0L)W0 000850p0  %  %  P%,  (P 0 %<  5 000000 000 00T0(pp 85P,0mXpW* 0GS0.>( CP$ 00S H @3/4pGWp@ 0 L03/P 00S 0Sp003/0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0UQ  01/ 0S 2 ;Cc'$Є  0<P 0 Hp0  @D@儀 0X60X< Pl<,0S$pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000T-4H- p408P |\-l | \ uL x k  @-} 0@Pp`4M#@0S $d0 L03/P 80< 0 ` 80< 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80s#    ` 0029'  ؠ`0SQ,  R) 0 0#Q! Q0 2'<{# 8 0 r  1# 000 S   4R$ 1 SR8C801/89-0! /89-p@-@$P x1SP 003/p@֖x1ӖP$ 0SO-KMM~p@㻞G<0`DPI;0S K2 @,0&,0 0 o=(0< 5#Pⴋ 娫 K@T80 00U 0 00000@0萍0 I@@@@0֐pK܍ЍI⮍+R*o=(0<2#8 ;c&@@L u7O-M0M,0t1`l@0pP 0S (0 S> 9 Ha&00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000p0 0|p`ލЍGT,0S*< !,00+C#X0S000C0C0000S0 0,0B$P89-L u-@-@ &0  !<$10(10,1P001.@-@%0 0! 0O-4M\`XThp(0P  啒"\ @,@;/,P R7P ᐔPpK %p WpF2 % "0  00 0(0 0 0`ƌ3ᘕ(04ЍO/P%4Ѝ[;0p@-@Q*PJ 0  PC40 Pt=<0l p@ P480 P@.,0 P,(00 p蔠 1 23 56p@-PBM `@ 2 V`P0 P Bߍp`00PS0`40Pp`80S80P8 < X0S4!V@ϑ0 PǑ\0 `0S @@`嶑d0Ph0Sڴ 0@l0Sڌ &@|p0SL @XT`咑t0P^ C & EFG2 I6 @ JKD MNOp@-`M<P@v   1U%PDPK0 @00S    8PU@V 0 PN0 ܍p(0S|  ĭ@l,0ST  ậ@00S4  ᰭ@$^ G 9 :D ;@ =p@-0M01P@Q# 0`N  f 0S (0St \  X,`VL ܍p8 0`N {  C 0S (0S  9  5,`VP!ϐ$0 PƐ 0 P0 Px庐0 P㴐0 PL宐0 P8娐 0 ꬠ I G L O C-`RGM8 C"\0S0 `F`| 0p⇞ 0S ;L 7`,p WV o$ x`ɏ +00"  `#ߍ@嶏 0  0S  R `PV| 1 `SN0  "㙏 0  0S @0S#@减  ߍCT<0040!00@0Fo$ 0DL03/00 N0S !0{D` 0S , 8`Y(0p x Q0X 8 < RFO    ᳫ 0 /@6@% 0  m R0_p 0⚫  궠 z  G  L wá ͡ @-x @2"+0 @0p0Pdp@ ҡ @-@ @"000(0,0000;d[@ ꐯۡ @-`dQKM0@sP!   091!S=0Kߍ0@ 00 @@0P(@UTpp (`0 0  0`0`p܏rAPnA,@ ]4P0@00@P&uƠ >?D A@-0QTM,0$0`s@|!  ( 0Ӌ$10B/00 ّ`VxX0 0  @8 PQ+< 0 \x S|0L@T܍ ЍHZ-xl-w  â ʢ Ѣ آ    $ + 2 9 @ D C-0pP@,M0TN 0^ ^ 0S T 0@`P aV@,Ѝ@M- d C-4M@T2P!`pPP 0TL0 3/P  Q000T0SX0`pS@, XT $0Sb S H H0S004Ѝ0CS@D&7#"l-i 30S/O-@SMP 0#00Ⅴt3⡥`PX3X@ ႥH3P  {s 3 B 000 Xf00,pP0S* XZ'0 FPP Tq 0 x0F/0I1P/S L(0(0 00+`0SvU ( 0S `P 01 m00!15:%  aP p Q 0, ($! `$ NP^0 0 8a4Q101TLZ-l-M-( x { m ̤ 0S@0@-S@00 0S/l- 2 O-EM 2@PT P0 |2Pt |1S$ $P| 003/P 02P ( ℣ Eߍ$0 R P 01/0P 003/P A10SX aPPE  <0 040000,00800 ƎpP@3@0S. $P+ 0 x0D 0$V- m-٥ LZ-t l- V-i l-C A-0M$^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T @ T6 @pW3dpW0V82# @  R @ RD RV @  @H0p W P^ TXV ,0"0P0 0R,0Ό R8<0$V-m- V-l-HZ-xl-\0p@-T00P DPPp0AS@  1SAv=-T-M-0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2"\-p0\ Q0/\P  ^U Q0000@-\-O-GMMz0l7d2@`(T H2 00V 0 000000P0@@@@ @E0#p@a(< (G܍Ѝ$1SpA08 L03/P `7Z Z ZT7S p$ 0ST7S8 P PP<<08P0<01P0<0+P0<04P#P<0 S ,0<0P<0S @ 0"{080#{0,0${00000    + @-@PD u|0 ,0C(080U< 4<0 0 0 x`06/Ѝp@KЍp( @-@$P04ML0` p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-|M@8 P (0 $ <   <Uᕹ ᓯ0$P0 |! 㞫|Ѝ0T-a80@-S`4M@Pc00 0DP 003/00$1U Ut  4ЍS0  000 0xp 7/( (0㜉 q d Z | p@-00MPQ0@$ 00x` 6/< }`Px1竃x1a1S0C€10Ѝp蠦 p@-@@P P ( bPp0S@}p P OPp0S 4! B! P  :Pp0St` P R 0 %  Ppp t ¦ i Ҧ ئ O-uM M<p Z-DH0 cS_ C太0SSzC0S PB0SzвB0Sy2 P    P 2     P\2 TH   @  P0000 2  @@K @xP@ PHPP< ,h@ ,D@1 0101010R0 0K000PP0 h}p@  PQuyE} 0S$10S $1S10 0Suݍ Ѝ_P^HXPhQPg1S |!R P  &89- V-l-LZ-l-$V-m-HZ-xl-l-l-l-|l-l-$d T-M-@-@Ʃ00S @PPZ- @-@PЍp$QU0 `P > PP C 01/P ,00 H$L Q>T-80S  0 @-:/ m G-`ᔐ唠@PX0r2&S80S00 00 S80S0|1 P S$1S00 0_Zp@-8M`8 @ T P $Qx$00S U  0|1 08ЍpP P P Q ᧬ E P  / ᫬P 89-A-M`}8 PU`ЍGP $A003/0 R   01/pP 003/@P$q0H03/0 pxVEL2 `0803/PD@ 0!! p8#  0 3/P"0#"#0 03/p 0` L03/( ƹ⵬p` 0SWp`@`C88 0U B0<0S P L3/00 L03/P @0D t0Rxp`00 L03/P @0D t0R 4 d00`RP  v00`p 0Sv   0|1 0>h   89-G-`RMXr@ ,PPl P\` `VP P9 4 (p 0S  xߍ<0H(00,0 00004008004004 04$0D0(0P  R0 >t!000㛓#000X     ,( [: v|T  P ؀!\R 0 0 B@s 0St 0 0@ H0 0S4 4 0p Ы yd|d&ݫ {dЀ   # 0$\ (00t S S  S00/Q 0P/0S 0S P//!R808 :C@- R )r0@/'  80R*@-0M@"P0 0! 0!  P0Ѝ/00S/8H9-zp@-@(P0S0S0< 4 pH9-@-@0SH9-A-@lP0ST 0S` @ <0P@`PV@H9-Ss@-@P ' dP Ѝp<P `P (PP )P` P P(  `P` D PdTPP 0SL` P `P @00@0S Z ` f n p p@-M  {P ڔ}} @P"` {ЍpT0S  (0q Pa}Pzꊬ O-QMM@@P;.,@pP}0` FUpw ߐ0p0p$@ @Q&D0S8 CR0 C0 㔀P[0D04@T.4@0@T50@`T$00 0ҼG p P P    00wP  p$ pp00#X؀z@0V  00#t #F000G  v `#APQލЍ04 040RP8< 8<0RP8|00 S 00#PDt P #P@p Y Y#PP@k P #xP0'% D00S00 D  0Sأ  0 0 0 `@00t#Q@#000@10 < d@ ` ݬ  2 O w k @-M0 0w 0@S( (yP\vX x@08 8 P$0$  B@Ѝ sí ˭ @-x0SЍ@-M@ txT0  CR$00S ЍwA-@lP0ST 0S` @`PT\0(Ѝp!0SQP ؁1/T 008( O-DM  0000 00 0 zp 00 4`Ro04`800,00$ (0  fp ,08<\@?! ( _5#Z<P0$P00p/2#*_.08 RP0 \X  PTuU G" ?P1 0HL R0@ p ?  0 `/G$'@ T R@`000 00 0  p 0S #"01# 0?04 SQY H0V`00P0pYkXUDЍT-/C-`@4M0`} p\ X \^ PRPR VS  RQ \R   0   pЍO-X @-1` QPp@-@pP0S0ST 0DSTPS$D  p# @0p\9-(m-08S^;/(}- -p@- @ 0(  P0R0PS 00Sxi ppM-NM`<Р@Pp p`0  p `ۅ000 ;㫦PP@ pzNލv ꐸ ydG-xM` ✐堠@pXP" !0 @P 0S PU 0 R=H!H0 bBj00S 00" !P@&P0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍY Y ZD   gYZ  O ø ˸ Ը O-pBM M@P`/0;( P @0P0P0iP) Y $;$   k P!14"S5 0S῁to@ U01U01Bލ Ѝ ]i0P0  j?XY$0 0I0,k?X Y 0oS 1 SR 1S  RS1S1S p2?R_0Q q @0 0@QD 0H 0LD0!1F41Q 04 8 <" 0Pݤw@Ȥ@Q Q' Q0PUTi 0"0S0S0@0iP P `@@=02s 2 02@F @DURX A- 0MHL`Pp l1lR/ fCPi@P( T00' 0R`0 !?020 2002p#04 pj0Ѝ 0S" $0Q00 L03/P Q H 0Q 0 SD S003/ꍷ >(m-P/@-\ @  0 2BS20D0C@AuOvO0w.#8\0 A- P0\\@@ \ 8\ @T (7g@ `Č `Ȍ `̌b` ` p SČpȌ`! 2/ ``~``a0q1P ?jp`T8|BuP08} ^\ 0Sp`82S04@1111111110 8l2~`S@0 PE} P0/b0@SP0 0HL R   ?  ?/Z[`0P @10`d ἐ 09/0P@\Ѝ虺 T-G-p0@PH8L041\`  S ^ ?Y R  0\ jX0?Pࠡ࠱000^ 0 G/T->00@-M 410@810!p`0 P00 0LPt`0 J0PU ! 5/Ѝ0T- @- /Hz@ 5y@-s@C ]  0 }z뻻 &@-@@0sjy,00p c0Co@&D--?$M0 0 y$Ѝ-4M0 00 000=P4ЍO-p-MM⼤E 1z " `(z4 0 Pp0 PU00( 0R0PU00"R0*Pğ p$PD0S 0s 0SMߍ0S @P 0d3堓0S  1{#HS 06᙮{0 A(D# A0k{ {jodVd`0{33Q-AP AQڑ""A0  2k B{Ÿ 0 R#3SPhS0 10`0 P"k {0 $ P(0 0SZP=9 =:qk{1 AP09+ A k Q 5 P;!%#3TQ0\ A  d 0! iJ/ a{$10 @P0&0` dRP* 2"%+0!@U0 4{@0Sd| ,{@t0 0 p wY@.AX-8-h-@-H8 0-(-= H-QN 7 u D-P-@~ 0P P0  AH0 A k{I{7{ZU0P |  z`fp@<ط<Pט 0z@W/ z@-@u@SRG-@  700pP ą`P:X:00X 0zP @-Pp@`P0S -S :S S 000`  0 P00 ЍU0S T  pZP&p@-@Pvp  `v@wUZ700@pp@-P 4`vp@  vPv@p@-M@ =xp$ ЍG-`p@T2 P  7P0IPE .PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝž p@-P R`@0 @ w0 00S wUPE P3ЍpA-@Pp sp` j o0W0 xW0X U` 0X P 0 hD 0yЍU  0 P Ǿ ʾ ξ ; @-`0tM0FP?o2p @/pxw Dwp$vnw@qvp X2S+wp L0V"4 - }htЍwX"Rvpp@-PI@@BwpBPpp0 p@-@ u0 S ! 0PUPUp@_0S   0 0S __0S   0 0S __A-pM@PU `0S@PE7  0P00ۍX700#S @ Q@BPE@C000  pL0S 0#S @UX5 @-MP @  Eup8oۍP  > h1p@-0SM` LЍp@p@>  <P  0 !   tpz0 S v09S C1Ѝp0 S   000 00P0 PS d0@ f p@#  Ѝp@ pR p@-@$`P\Pp0 @ `P0 001 0pSp@-PxM@`  OAj0 0tp@) tp$  tp tp  tp  P H0   p(AxЍpt t굿 0 0 s@->@P`Dp @t0 p`$AT0 1p 80@  p$AЍpſ p@-@PqP  Nt0}1LpP`qpR ;t0"18pp@-pM0 p @'  tpt@pЍO-QMMd700ۍЍ   Z W` @V s@pP` @-`R@00 Ѝ0Pp@ST\@PT  Q*R@00 S   0 0S0 S *\P `]]  00000 0` @@0P  @-@@ L1p@-S@T1S"d1S,tRU6\RUp`bV7\]\bp1C}]L10CL1SPv]0P11Cp]T10CT1SXi]0X11Cc]d10Cd1Sh\]0h17x2,P0Cx2xbVtN]tb*`2,P0C`27@-@0 PP$ H1 0D1-0@80@ CB Ѝ0@j Ѝ0Q@-@  9 brP p R00\!Ѝ@ Q @00 Q p-Ѝ@ Ѝ Q@-@  0A  rP p $00 Ѝ@ 1S70|\qZP| 01 @00 pAЍ@ ЍD Lt0@-M0@Q0$+p Ѝ  U g 081/@-@d'P0S P 0800L0S SB@' p@-\M@ Q t0 c op\Ѝ 0@-800@@~AfP@-@Ԁp ?X @3 Q7@-@  ,Aa _ Brp L P>r Ѝ0@ P 11P,|1@ R  |'?AQP x`00CS`0X v@T0 Y p ,A Ѝ0@ X0 X Ѝ0 P&&p@-PDqp4p@ @rp p@q p@- 4P@  0F8 ,p@ ? p@-P8Q & :P X  h4080P040 Ѝ 0b"!4b4# 0S %/0p@-8P`J040 :0H@ PpP  Pp%pp@-8a? $0080S  p, AU p p@) @-@@O-`-M@0YR@pPT.Ѝ P X  R$ R#W 080 C B#0  C0800 @@ (H@X 0 0 '|XUP0|$ 0|x0bB N A-`H@a0 CPPj p0 ,Up 0 @pЍP. P P0 P6 pP@ PTQ IE@O p(P  08*0 1 P #P @` )@GD!\10B0H1x-h 9@x Pʞ 0P X p @-@  A@ , > R **X  0S @0 S   000x1  @  0SP L 00 S   0< A-M0 P0 0E0"@0Emp00`+Jl`pQuw07S 0 S X `f0E 0\!`1  `Px1 ,dލ % R Pp3 P0 S   x 0& pP 0 PPUVx}x 6 x |x1p  P  0S 0[$0 P  C Q@-@  p A@;+p507S@Z.0 S *0VS&0S@X A-`R@M@p P?P U 70 0"@ЍAP"R 0S 0 r>XU%  *zP 0S <0 *#h p  <0 &V>P  *@ЍA@Ѝ\ O-@P$M `pP  P 00Ae $ЍOiPx P000 PMPPXRP < PE  0PE 00X  JT) $U 00#3\pPs 8118100x1`V+  jPx1`G 81181kP NP 6P4PUPpP xP 0: 0 0nP00P 0S 0 0`  RP XX p 000 0S 0 0`V81181$Ѝ  .P XX  ap0 00V0 0 0 :0F VYx1<1 :<1 0Px R @ [P V @(00 0Ȁ0  YB Y H0Ȁ0YB 7 X V xx@0P 0S PPVPPx0 v  ) &=  @->@T( 4"4p P`0f"@4"4 0]W =LL L0 b"!4b4# 0N@> *I>0@D Ѝ耼p1p@-SMP"!` +%@P T 0p1! V S %0S X.}QP <@tAtЍpp>0S 0x1@T l1S   @>0S@ `l1S   {0 @ "P 0 @  B00.$pl1S  \ 5 @-PM@0) \.P@ P`pHa 0 # ^  @@@@@P@ A0\0  L00B#`8ipЍ\ @P^ @@@@@@P@ A0p@-@Pp0@0D0X0\0PP `S0 0P `S000r0p0P PS00840P PR08<0pp@-`h@dT@@@0St#PP3T00pRP dh@pO-@RpD@T@P ЍP@`Vt#``T00@lPP 0 @Q<84`B(` ``0`h@R/qA- 81`0SP@p000S= @T@T2 0 S   000S@0 @@00000pp10  0PppW 0 S   00000@@0aq0O@Ppq0@-P@M 00Ѝ00S @T00 0  ! 0 0! H0 @  @000`hpR0000C0qp@-`@TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M@`ip P 0t`p`F\ Ѝ0S *p0 0 0CR00B *S0C00ʚ;G-P $0@`pT 0 S0 R  S 4  0pT@QT 8@T 0 S <  00` pQ 400@4@!O@P0S 0S0 @@@-@^00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@,p0 000"#} ЍMb@B00@-\0Q@ PUPUR PU PTP4PP@PPS00@"!030@-@Pi`p fdP@P@-xRO@P gpP@0 0  0  004  800< l0gp`pp0@- O0S 0      ЍM-04r@Mp0p0S r 0PRr00q0U0Sl7J 0R Q00 S 4  003/00<00P ЍЍ/-@-  ЍЍ/-@-  ( ЍЍ/0/H& 0p/PH&@-M MP@`@  0 0 0 $00` P 0,0@ 0$00wd0S@PPUV0P0\ЍU700@` pR0 PU B0>00 0<04  ,>  PP> * @-@T>@Q/@-@T>@0P/- R 0 R00^ PG-`P M0(0S @ P P P:`P 0!00 0  r0S80 00 Ѝ080 00S # P`p  P`K0P 0iS.S  P`;0S4 040:S&0@-@PDM QP@T D00p@DЍ0U  cP @0S@-`@MPpTЍ 0S P 0S0Qp   I=@P @-000Q/Px1P/$0/@-M@    0 cpЍ~iO-YM `F/@H9X0)JpPpYߍ0pgL 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 ┑PAT1S@\1S`1 ↑P5\1 S S R@L1SP1 uP&L1SPC_oRPU@P04S 0s0vP?AB@@$P00SLQU JPPdh1 5P Pd1UP H@ `   0[$0D  H `0 S 9X001H \0cp X0 PB000S0 15S4 S  CR.T XX @@6S! y R02 > 0*81 000S p S 0 S D@@0?H0p 0P0H0}>H0 @0000LPPP  iB @h A-p M X`P00 @R  RT T 1 # h0@ @ QPUx!@TT00 Ѝ R @>btaȀ- 5S @00 5A 0% 1@ A  + A+": A !9 R50,@-`p@P@ Ѝ u0PXJJ pQ,'$P PP @-`R$MpP 0S0U00$Ѝ/@P 0 00 0  0S hU 7P P0 T/00DU 7 O-@`Z0"Sp0W"SpG` Y PP u700 ЍTUYP T0000W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R T0 `T 00T 0T 0000 0    00 PP 0S& T  !C0 `P0A\0SP0S   CT PT0Pt &P /0 S S /S/P0/S S S/0/O-M €PPЍO= `P ЍOzI@Y@S t  pWlI᠀PP   P Q0A00Ѝ=0@S. P( 0S ~@PfAI@=`@9VH0P 0 @ {0 0 @ @ p@-@ I`P 0SI$`P PP(0S $ I0(0$0p,` P,` PO-@/4M10CXP`pS00pHU- : `Pp$=P@  ␝P7 7  '$ !0P`0@T\0@T U0 @4 0H050U* H0tp>0P H0 F@PA t014ЍJFP 0 2Ap 0S  PH01@U  CUH070 0  p P! .R@ \ 0R77@0U   0pP  H RU H0@1Sw@H000|U HP00r ,0 00 0 N,0S< a J|U ,0!00 0 >,0S L Ux <1F8xb0w4t0000 0 P'PP00 0 P p@ 0  @P 8 UJ <18xb0w4t00p00 0 PP00 0 P0@  H0:0H P 0<0UH# 0S /!`P /`P00 V /0P0 Q00<0000H060U ,0 00 0 VM,0HST  Ah 0A  ap$  P 4@AK0  U \U ,`P 0SU0 pH0 50hx0 50,0 % 00 0 @,00,Y`$ UPePUN700 50 $G 5'@ 0 ,  0 p P H0@40U 0S 4S 04S0:006S 06S090PU- ,0 00 0 L,0HS U H0P SPH0;00H090U `  k`, pP .D`P 0%_ CrFH0Q7;0UlQ P0l1 xP0l1 `P0l1 P pmE0Ptp1tH000UH10 2yPH0 2q PH 0 2i P PH [ H000UH020PU @ 0pP$` H0 S;70=H0208H0603H0;0.H080)UV <1$8xb0w4t00 0 P000 0 P0P@0PU2 <18x04gtr000 0 P00 0 PP00 0 Pp@0  @U =PD 8 pPWH0p000S P0<00 P WH p P  PWHp  ` P L P 8 P $ PxWH`  BmzP  ($wp= 00w D& 6 S a d   Q m { ~    4 P j s    / ? e ,3p 00ypP0 $ ( H,8   P B( +P*WH B $p JpP ((_ (\ H$8X  P  B P  PW ,0 00 0D _J,0HS J  PB /o"B ($P/H P0(0P 7$ ! (0'0 ($P/H  P0(0ߘP 7$ ! (0 '0aU H0[X UAXUH020PH0 000J2dH000BH000=H0 008H0 003(07600 2R  *$450S00T01=5 =5H00UA <1(0@0P@47x0'tP 0SU( H$CzP$U 81 800  (0 00 0 I(0`S, P5`( "4`4# ,,0H0800 PP0 0 P 0 0QH010H010H000H050H050H000H,';,UH090AK3O\ 00` U0 YtAKοOAK OAKҿO"U \0@T$(@ p`P  ,00H,0S \dPPl  Q:`P00~pP {  ,0{0{{H,XLDsP>P/`Pp =YPpp"4DPp&P`Px $&DPzP `P DP vP`P  DPF|P`P CPpQ CPyJ CP9|   @28|?o2= VO 20Sb YP0, PP~ZBCPqP`PDCPr CP p0S TP00CPs (CP .CPp 3CPp :CPp ~CP p 0wCP@p 0 pCPx |0iCP(tw   6 < v | @= X s @@  R \ , > E ^ x @0:CPuI \03CPu |B |0#+CPu: 0)$CP|4 CPws 06CPwl 0 CP|  CP| CPvV v@PP00B`Pr x`P  R  R 0,PS0P , S%00 0$0(00X `0` 0 _P@p@  dWY`0P ʎIY\0PY YU6HP70P7zH0"800tH080oH07 00iH070dU 6P0X2\X2S$tH000QH070LUy W`P 00^`syHР؀JP qP lPVJ) saP \P1Ȁ0H040H030H, 4, H020U2 t0 XpH H000H000H0@00U ,0 00 0 F,0HS  qU ,0 00 0 qF,0HSp \U ,0 00 0 \F,0HS G >O-pPУr8@`P P `nV<1X ЍOnR('RZ8 07840 ЍO3 Ѝ O-SM@5 0P Q  8p`tj⬰<1@0  0 0Gp0@   p   P@ X 8 *  Ѝ褷& X-G-@`pPU T =PPP@P@  +T?0S DD0 !@D@DYT 0: @/@L A-PQH 1pS`01S`5x1hS`8  ??$?0g47S90?8g<7S:8?@gD7S;@}?HgL7S<Hw?(u?Ar?q? 1`Pj?h?1`Pa?X  P T0 ST/47,`0C47(<7,`0C<7!D7,`0CD7L7,`0CL7O-MLM`p$ 0=P\IdxP ED3&7 E000 0000 0P70P7 HE000 0:00 3000%0  p T +8 0 EH@ 0`0 E+ >01 P#Z [0X,=P0047(&P @5: ؍LЍD1P PA0 D  D 0 0G<DP078t247x204<',0Rᓸ 38>@D',0Rᓸ -@>H'0\"L'87<7@7D7`"H7L708 0p  +m@0S R R P\R @=:0@ R (#P0 00 ?o2 00p0S0020pp@p(0 DDNP 0 0# z00tDP P0( &H  P;P5 Z$dh pP#22C((,,0 @0S 0 S S0P\S  @ p:0  IPphqduPd p(0 TP$0S P $J1 EP 0S P ;Ppp} 0 0# 0 -Pp Xn0D00D000 0 @b 0 S E:$ E000X -@  0Q//Q *///G-p0000@P `P` Y 0 0 R:@CS@D"@3X HGYU( IGA-TpW0 %\T`@V0? C.CL0LS @sP X X| |00 S HH0P 0RS  p@-P @Pp<@-p@-@Pp PsPpT Pp@1@-0@T @00T0S0 eB@@- , T0A-p `R0080810@: pPP?W0A U t0  t0 <p@0S d0p0S <%p? @U4 )J.P P @$T T0Rt0t 0SnPt0 t0 88cPT0$0x x0RX g@OPl0S :@S d s \ A-`PP c_@T T0Sp@Qp@- M z0 zB T0S0e PUx x0 BPc_`@P @ 0  T   Ѝp ,   G-} G*:SR0M" 4P (  JP  0@0A 0(P  0Ѝ lB 6@T|   /T0 R0 0800, P T8p(0SS90SSDPT0c <|  `P7 R|0   P @T T0R88oPY0Sx x0R ' fT y00 HXXNPR P T T0R88=Pk0  >pQ0VS pc_ @TG 0SS`-90SS)PT00S8 0 G0*: S R   p 0S 0S @T 00, T@P  Q00@-1@LS? @q@dRl@̠ BR001 BS@P@-40; 0S /000 P@-40QD ~0S /000 P@-L0}O k0S So/000 P@-H0a R0S Spw/000 P@-L0o :0S S$0@o^/000  hp@-@Q0 eCRP0_ C|C0`S0 SQ 0` 8Rp@p0 p@f`0 p@  { 0P@-|0| CQh0i CC P R !P BR #@@  p@-PP M0 0S@T 0d($"4d4#@c@Ood@T $S 0@0 Ѝp/0d`Q 0000P 0 CC0 - 'A-0S00@Pd` pW /0000Pp 0 C_눱- nP@-<0<.TQ(0v CB!>0000 K @-@QQX C-TM@` P `6gp) 0 [g ````gg 1 pW0`pV& QgF 0 0 VN@ gT  8@TЍ00C>S/00`"P!@03@000C>S00p"P!@03@0 -3@- P fp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp pp A-0Pp@`S:0SS 0? C/C  RS* R0 $`V1S* !P a 0@DpR: Q  O-MA 0TP` 0 vuB@PAHh@081 0S  wp 00ЀP P P P P P P pPp 0S l Cp X61T!R H9p 0;1#3K0$0&&*аp L0S% %S  p H p P p $  p ( pw P0S t00$Q0p T pe 0Sz 811K10x1ZsPp M @Pw p@ pP0hd p1 | p+ U%P u%P0 x1`@ (p X00SXppW0h 1SP~ᨌp@Hh圼s>P  |p MF upp%d lp~ 0S P oQ Z T  hPp  r"B_Pp8~P{ (yPv tPq |oPl jPg eP `P X00S 0Sa Ta FQp\%P `V%RY pTr0S]  pg 0x8!pM^pJ0SL  @ pQ 0$8!p<HPpB 1 R6 0S  P4 Ѝ 0Sp pl O J Y a i s X  + &    1 L U ~ 6 & B E G ` p p@-@Ppp p@KRRA-P`p@@L0s  S$0 U@ p@@@dW0S R H R U pi a Q p@-P0U@S S00pH oP@!@T:!p/ P&@-`PM1pSAT  p@xЍh BPЍ@!R 00  00 p@ a@V 0 !p@{`P ̤p 0S |00#40 P < SP 6, 0% A-PP 0S 1 p@ 0S @@00 S U   ^ @ .S0.S0_S-S```&00  @R~"0T0 0D0& @- @0P P`T00Q    DP `00CS`0p S00 P0S X0X /XN&p@-h1@SP^kPPE @p -0.SSPP \DP L?P < -P 0  .7PP p@-@P'Uh 0 RM0 MM0 xHM0  hCM0\/T,L)D& <#@4 , $      M0  M0  M0 L0 L0 L Ip@xo DP     " . 4 > F M T Y a i n w P& 0(HLǒ -\ \` Q^ ,\ ,@-QMM@pP] p 0B  BALQލЍA> 0!>0 0B 4Lp`0SPE@E* p 0S:0@D0 O--,MlhpP. i}`  2 @P2 0S  ! k,P$P@P@ X_P$0X2200,Ѝ P,P, R P,PE0S p R* 0w20 [8$ R, R P H8$ R R ,Pp!@P !!! P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-MpP@`UQ:T 0T00D0S00V`F@@6V00ЍPW,"0$?S 0[ PW RPPUT  P 70 0  .0@I0 0IU:D X0 0 `TT  DSPO-`0 2"Pp Y*Q@ U V700 Ѝ$@@`FPp  00U V 00  P     @3 \Do   ' T/T$\T0 U V@@U V\$0@00@@`FPpU V `F@p~& O-SM MPd`p`p< @({>pF (NK p V=) p (>4 0S *P PU@P PP`/0P@-404 EQ 0 9 C/C@ n  A-` (M`00>0@SP  '00x B0epp 0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT (Ѝ0 8 0>0S 0xPT A-@`lVPFPPPp2Xp`Eh,P hpl"h20 V0  l20l2@-Mp@`P! ~ (z (ΩX( 8pDPU@ T700@Ѝ ᪽i///0@-M @ ⛽*PPЍ0 3"QAp 00000)QDpO00000@ CDpl A 00  0"7Dp<6 p 3*  p@-QUp@p B,0h1p@,@-GM>`V =P00Gߍ@PF/ 9  0; ph0 1`%0 DF?>D> *P0 F?1D ii@-@MIP4@ $.P P@Ѝ` Q@0@ C@-鼻0SSP`/// $0 /Lp/Q @-@?t0@0Q00@-,M@P(  y  ͨT Cp 0 00S p,Ѝ08i(p@-MP@ U ` P ⤨  (PCPЍp:iO-PQMMD3D COT0S,3 CCpW3 CC@H`" 0J01801\0t0P0 0K`T0`V3P 0P0T00T0` P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0T0 (@)@@FF@T0˻  弱 T0R B   @ Y@ P1F0FᶰF @T0  YI @T0 0F0FᶰF @T0  XP ׻UPEPPP@ D$("( U 134  R2$ $@0 DЍUi@il@-QM@  ĺ00 p l20 h2"AЍ@-]MM`@F#P@p PP VR 000S0S S SS wR0S HcpȻVPS CQRS 0  Vxp@P V$0 Bp 0S$H` W ᫦l Ap 5 $ L 80Su S S00,0S  R000@0S  R00@ H @ 0& Hz!>50H \0Ap\_0S [01S h(Qc0 0 0 00 0 0pURZ1S SN F F]ލЍRIx(@P= >@2 3P0 0- H)@?ATY$0S! HM PPN0 0~Qii@ @- 00 000 0 +Ѝ 2S/2S00/@-@@ںV002@-S0@0 @@̺V0002S  H/, A-PM`p (PjP)(@P. 0LL`0??p00! B4?Pp0Sp  @p PU0S ap 0?.)@! (⇥( @p | P@p 7/PP @p &P Ѝ@2 ; qB@F lBpBfB@0O-0@p`M0PU  >0S2P   5 P崡 00S U 1!Z0  P000P0 PPP0PU:000000x Ѝ@-  "@ ЍgB0p@-M2S@P`x (VP@0  `(?չ00ލp@  h B@-P`2$MS@p0  0*00᰸4%40 0 0p`>$Ѝ@-@K> I(@F(@-@pp ?p`~B 0`( "4`#/R00@-0@ ^ 0 # R 00P0p@-@^P TT00p``0@D^D"000txœ\p@Tp0,O-QRM@@0)01`Q !V00ЍP0p Q :8Q@SI  넂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 &P 0 0B з 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S ᜷Ѝ@-@ 000YP  R ∷ Ѝ@-@\0S \0\0@-@`q0`=0`00@-8@$@r0p@-800P@ >Q &TK0x1 RpR 0S TT0Q  까T0800 >0S p@ H A-p`KP%P@00<000S@ (0? @0K0cScO-@IMА`p< Iߍ0RS*  R? 0 000KC\%PP d R 0FSV (0Q 0S 8Qh00 00> 0200BS* 弶 0360 RS00 T+ $0K0pC70`$pQ@0 DPV VdP h  Q 2  $⃶\7@ $Q DQV R <0S 0GS60 0 <i@V 0GS80 0 \@F 2!031 0 k %R  GR0+  %A CA %0 @V 00  0GS}20 0 ,@8 R  GRn3   0GS_ 7000  0t2@,0 x" R07 ,0 4'R SH < F P41(1"<1815%#8107 dSV (1S 0 G0S#=00(  ҵ(100@0S W0 2S 0 GS <0 0 " ⹵ 20@V081 0 Z00 GR P0@  k 2S P 0 GSQ0Y0 2 0 0000Y00 @  @V 00  ^00GSt00``@h 6S 0pGS^00 &A Z 60@{V(9(, "  P V: ART ,0,,S P R:(, "   PV: ART`  ,0  00D0C0W00GSP9000 0C4 < 1@ 4S Y 0 GS8M00 $A  40@B?S6; B?S6o 00PD0 KS:KUKe 0 S0P0"1L u0G R 0   Ẵ @<0 4 ^$S W` n cSc5 7@-P\ R&@P\0S x0xm08  Ѝ0P V<0@ pI$T& A-PR1 7@ `c0P pC R0 00 R0 6 30 00 P0 0:000 P00;000 P006000}P00ЍP 00000000 0ap00 0Up0 00 C-P@MT h"P@, 000`0001H0i0P0 0 x0`  (#0(10< P $!P( # @B  ) 0ta!P( ``(1  ( ⨳0(t!p⢳0+"70 (P  0  )>``` P( `(1" (> *>Qߍ 0*  D v L b @-0p M$M0i0PS` 1 !p 8p@O0S i p ۍ$Ѝi@ 0 !Pp  8QQ0500 0hpP P(  &$ @- 0080@P PU@ 0S@ ` `P@Ѝp 00O-IMPpHLPL `PR : 0@PIߍO"0,0{"600 0400 0 P` p00,0S2 V30$a2@0 0!,0 T=0 ` P ={Y@PIߍOa@=0 ' P V`` ``00Tn=H0 ` e=(0 P @ G-P@pQtbP,`,x2S#PU`,@ ,x;PI`;, Q 0S,9 $; 5P,`0 8 0 RG-%00! 1`pP@T:p T  X ⢑00U *"0 pЍ0R0   @<L0 ;p  < @ ;p@ p@-RMMֲ000PS`B S@ Dz00 0hpۍЍpt p p `F D૱<, ;p VJ @- 81S Q S0 000 PPЍ R |0# DPD30O-S4M@ h@@ `0 0_0P o0 00 0 "P 3 00 y0 P3 0 0S0@0k?00T0{ @P0t 00 0 `Pk 0 $ ( eXcpP  , $(,8`P@ X0⣡  Q*"00pP 0$00S $ h0n  ,(xt$S(P,8M P@0 Sh0` 0h0  `0304Ѝ 00 !0 pPz @ uZt $⭰ ,⩰,0pS 1P@,0$S  S St 0P !R "Rp( $(,8oP@ N M R O-PM0@0400``2 ##`pp#`W9 pW6l0S,0S0`tr,0v x2S0`80w,0v 847S0`\r,0v `"Rtr0,p80x2 S0p0g,47S ;| 0 pߍ0$000 `2$Tp$`  `$: 0 p $`  0 p 00 `2(4p : 0 p(:| 0 p#0z0P,04l0<40 pl#0k@0"04,040 p]q`]n`dk`k,0 !P !904ǜ R6, `"R`P, 00`1,0,0G0 0 ` uX, 00}R0S 0l00P 0H` ` 0 ,V,p1S  ,0 !P !`" P ,0 0L00` 0 3p,`v  @ p@-PUp@0L0pp@- MP#p 0` 0 0 `@5p4@ Ѝp 0 `5p ` 0)`5p  ८0U 0;1005p@-@pP`Z8!(0.080000'0S  0R  Odp`L Ѝ@@40 pA@ Ѝ@x Ѝ "O-`@p 0SP$H` E000 0 0000 ``0 Р0 `  $s99 0&0003H081y H. ЍO <0 $U9뜳  000H@0Sp3H000s$8040@9 HS8 0008 R#:kg{{'{z40S' zkg{{'{ z0زS+d0S( $0P$h0!900 R::kg{{'{*z8 S zLkg{{'{* z$800 H0S0SU h R 0R<0S 0S11H000s8040 P14 6P18 0Pt10 *804 \[00@0S0i0 N00.0 p ỳh`0 c P0 J.0S00HT{  P 0dh0 ЍO Ѝ?? # . ( N V q  3 9 |M { @ G p@-P@8T    (00@x1S0pS|q |20|2p 202022p R Rp0A-p@`0P S pH pph0`00 00p0 pd0h0  0 0 0$003 0 A\A p@-@`MV R 0 iЍp@F0H8P3 \00 R,  0i0P% 0S" <0S 0 $ PP7  |n` 0 4D0@ Ѝp0 %Ѝp@o O-RpP\M@`$[P X0 #3P 0 RT000 qp` hPP. dL0S0 0@S@0#/L0} d?I00&P X0 "2P 0 Rzgjzzz{T0d0S  $: P $[ <Y y' `20\200(4"<10,00000<00@0,0D00 <$P(P Q48`LPPPTPH01p_ dpX 0 0{PPN  h0&h 0x100(4"<8#8  10 mE00`0@008d#l `\0 P00\ 0 `zv ì04S 1S0810 5p  [X  @0\Ѝ7S zD0 6 S CDC  8@-`pP@`+0 h0X $7S R h0@0 < ` ^6 0 Ѝ@$0   0 p@- P@$ 0 00L0p@ ! lp@-PUp00CSp@0D $%6  (000L0p@|)! A-@`P p_ 800 a B00H 00<0L008 %A H l SA-@P` h 0R 00P5  081HAp` P!08!(0 AP     Pp p 0 ]B@v 0 d0 xP@0 $%A!!!! h00h0 C-@p0 PR  R $ RP508Ȁ `g5  Ji]@0S ]PP N P0  lH81 0S; 0 S<$3  cU0 <`,0  @ R 0P ЍG 0PS 0 PD0A 50 00 0SЍGЍf! #r!cSc!!!!@ 0p@-800P@  H*h00h00L0p@$` 5F_iE!!\/0S/0> d0S  0R/E. / !O-M00 0PS000p,`8 0S@TQ 0 ЍO> R*⑅P7S Ǚ Ǚ Y  S2  H!  Q 0 S:500 0#p00 00 ЍOo Y 0 0Cs0&0S0 S0Lp0 p    0t 0P $0 E0SY0@60@ 600 0p0 0  i`P  =$0 S 081TtiZ<6@P P0S0 0<S<0P0Ѝ0    0 0PY6S700S0 l00 0P Rh532Y@0H%KSK?305 00 $Y0S0   P   [ i0 wt4 @R0S Y0 % 2)  Br  Br 0 3 $ 0 0P   0 Y 1 0 :|3 @S R@00 D$0娦Y<0<0818 ? < 0 P0aP5 0000  000 0P00S* -P *  pt @ 0ЍO2600 0<P04 a0S * P   pE`81 000 0 0000H ``0\0S   `!0YP 0 8 R 1@sЍOKY 0 aY 0 20Sg0 00 P0PY0 '0  tЍO!*!T!k!!!!! !!H!! !!(!!C!K!. 8,[!m!~!!p@-@l PT0 p@0HD N`\P d  p@p`$!O-,M@`P Q0 ,ЍOm`F ឌVWP0@SS 0SP0t#tx'xVI:PQUE0VB:  p"4"48#8S50V2:1 S/ 0 0P!' U0S 0000<`10a  & ! P +0  ,,Ѝ G 0 B c!A!p@-Q` M\@MP  0000x p 0S T A @ ۍЍp0 V`V \@TX!$^!G-`j 0Px1@pTT 0S R T0S> R*XP$ f 0 @!A- p`=@PAlPU/ A0D0S0 A\0S0 A!!G-M0MN0 ;p`p D Pd`8B0480EL80H8$0ED80@X@8<8 ` m@TW0|` 0E 0)p$<ݍ0Ѝ`!!  7@-PX0B @P 0S40>8 Q0'Q'+  A R "'     0  Ѝ0@h}"zz  P<gjzz+S$0@ | Ѝ0zD! p@-@P0 0Uph0Spp@ O-`P@T Q Pd0S r 0 0Gd0  ЍP0AQ 0S 0P .  `08p|0#  81- 8 0 $ 0R0hd`h08 R0, 00C0 0800<0  P`00 400 V0S $0 pWp:#<0 2 0 0 R0H0@S^ 00ppWX0H0DHt   pH00!,!# ,0`( "4`4#S /0 @Rp@-,00pPQ0`PE `@բ@d@ $,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ RoQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScx1G-`@PM T+ 0S pW$ P Қ ᝛PP@h0 d0S4 x⻚d0 0S PPPЍ|0d 0|00 00d0 00090 dP p8VPNP  j | APP$0 00 iPP 00EBd8>dX:) PPp :|0x 0|0h0d|00|0XᑚU H0S P 8 P  MU` jP < 0$Q S "  Q  ՚Pp h  5< 0   `-pP; t0<0t00 00 80dQYx X ᡚP  ? U: ␚pP ⰚАY $0% h  5< 0   0<0| !*!!p@-PP1 yCӟ p`01S 0S 0S 0S  (0 @T 0Q0 PSP 0|U d0S0h0d0p@C!]!P!p@-@T PP@0p!G-Pp`Ps@Ѝ0E @P00 4 @P 00000P00 000t+ 9 0 s)$0P pEpb+0 "p_0S <,0 EP  0@R 0 0000@@!!!@-@T PQ0 8 00*:SR h0S dP H` Ѝ$` dp P (0Q,0Q   `P 800000( ,0BP0S 0 h dW $0Q 0h0d`0SH年!!0S/0S/   O-MP<`RH0@8 0xP00ЍXpP P0 U@ UP R R R0 P 0S8Y0000000Cs z@UЍO4 @PЍO5    p @@0 0I*0$  J( S#!!0S/G-P@M T 0p `xY&00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000p譙Y P 00p0000 S0 @00:S 0S @\S000@:S @ꐱ-&0@-P:P@A0 P\:R \:\P@\\ @R0/X& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO0E`VK `0P0E@ PPf 00pCލ Ѝ@@;04pW 40p(0= P 0 `R0 :R `d4@0  0(8804 PF0P {0S # p PP ;000P p 0S#00 0Ӕ8`p@Z +8#0P R 0#0SF @ @ #0P 0O008`0 SWC @DpW:SY @\Sp S Spp00T:C @DP m 0SQ h#Np0@P0 0 Y@ S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0B @D0J`FP  0S # _ 002 @ ` P D,0c  _,0@PE P0S "$ D0A00T* PP 0P:SVrꐱ-X&^!@-0  0 Ѝ@-(@ P -V0 0萱-C-MBM000pS 0S`! \0S)  R&    RA^0C R[ {0Pv Ps @ U Q0&P ލЍ z0P P 0@PU0 PP U P&P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0SPZ\R    B{:R|R  ꐱ-&a!p@-@PDp@NG-`= @P@ d PiQ 00@^S0S:SQ @0 R0FAd P= \S@0S:S: 0C\ 00C Z @ 00CY0TS @ ASBC\ 00bC ^\ 00:0 0 0 Pd 0:SS0AR0@A P p Pd K!8!A-p= `P@ d8 P`FPd0Ҝ 00@0S @Ad Ps Pd0 :RRAS@A P @-@# P 00S 00XS@ 00A ^a0ASW0AA0AS70A\2" @-04@0P %P許-d!G-A0SRPp`ʏ PU00Ѝ ቌP00CS0T Pp0  fY( hP \, XP  P00SW  R00S 0σ47,P R   S@T PR   R ꨱ-д-q!-@0@-0S |P dP許-и-@-@[P08G許-p@-P@PPpSPp許-@-@FP Q 087S@T 許-и-p@-SP@ P@p p@-@P * 087S@T 許-и-O-pPW`@P @ ЍZ K P 塖PT  RT@ Z //////O-@4r00SRP` 4 PU00 Ѝ  nP00CS0S Pp0 0 ٙl GZ IPD =8 9P P00SX00 S %P P00S  P  P | P ` P H P 0 P$ :P-t!w!@-04@0P #P-y!X0@-0S H@ ;000D@JP0DЍP- -@-@`0P0`Sp 0/P PP Ѝ-@-@P08D-p@-P@PPp}RPp-A-P @`pPЍ0 (084SPUP @-@- 0 00B;P Ѝ -A-P @`pmPЍ0 (084SPUP @-@- 0 00B;P Ѝ -@    /A-0@@`P@0 ?p00D0& SQ! 0@/0PA/A/O-@PD{pDpG``b0Y:0z  Z # 0@@Da 0DA\0:Z: [=0 S: p `$ Ѝ `p$-A-@`PpK  E ? 9A 00@-A^ 0 n$ P/o b2 0.0AT d$ Pon N$  A000R0@-0TM00`p<` @PYp TT0 Cp=@ <0@40 4/(00S 0TЍ\&!$-A-@` 0s P00p0pGWp0PP @P @pT0 @@PP @$-p@-?@004@ptpG0SkX$0S` D(0ß0 R 40><L 0 @TC3^ B00@  C31X  02` 3 d ! \C2 h00C0'0hS8 0t 0 00\\H`| <.,`ZPPDpAލЍPpP >P 00PpWA C9RQ 0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0h0 :/1, !ᏕkP 0H0$-\& !!Tr !| !--* !9 !0H0S/$-0P /$-@-P@ADM|0`S)0S&C0S S f;0P 0P@ DЍ NpW*P 0 000m0ppz@ $`0pRX0 7/0S D0SP 0 P0DЍ@H$--\&!G-dqP@0L P12C1b05R0 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rᜎ000S0PS ⍎&0S,P P,@GJ$--!\  0L0#0$-t0@-M  L0@31 ^AP 0C! 0Ѝla$- @-L 0 0@11D ^Q       $-A-@@bM0u L0 @2# p PW%cP_  Bc p\  Z@$0 HD@,X#1010 2R01   000 S" V00 S  ЍA X 1(410~X1威42 SV Q`ЍQ0S "ЍA`\c  Z l⸌@l⢍%0S  Zѓ c00@$-!A-`QM0S 00S` @P9 0s$@Ѝ QpW   @Ij00|0pS0S @Pps00pFV@@jP 00T l@m`pW 0S:S* 0 200ppp$--O-`PqL10PSU$,@T,P@P6 h0d 0B1 `P 1kh L0C R P!050%Pd @T:  R0 p[L0CY1T*Q@@$-G-qT0So:\0`S&7 2 c@Oo @d(0d$0P0@U1 0S.   B 0PN %Q * RG  ؒ0B408@S 1:X 0@D8C 003 c0< ?o@@D@  ]PP  }PNPP  0 @ S :   b1"0!00000P00,0P$-\&A-p0@@ `P PP00`Pl P@墋%Q *0S  e$-$00S:@-@@R$-@-P`P U(0SP@P )@T \0@hT0 4/]냓 00'0S 0( ( @4Ѝp$-\&!r !O-$MPpPeE00U0SXc )Z@ D3@7<3 4/+W(0Sp0eWD@XU0XW5 0PPW00 # 30+*[@C@dQS: ?L5yP KL ` % J2 10X0D30 2%Q b*0S _Z_1)Z @] 1@ْ1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P00P K D K0@D   哊%Q   Z0@P0'0S 0L 0pP$Ѝ*0S  $-\&!-r !@-M@p4aPE(0SWTP )@T; 0@L0 4/@0#880 P0Ur@P   '0S 0| ( @Ѝr@P %Q|0S0S P3 00$-\&!r !O-@QT$Mp(0S@ P xP'0S  p@P$ЍW "0T`M\0T*P* 0`0?o 0c  `o `S PP T 1b*A4 T!P030#P0S X $200301S%T#2Q FZD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp7<!`0<0 0 MpP zPP% 0   D<  h%T#2Q JZ*0T00S  D$UKP )PU @0@?<0 ;4/4PPV 004$-r !\&-!@-@H0'0S 0 00 0T Ѝ@Ѝ$-r !J////l&/l&000/&000/&000 /&000/&000/&000/&000/&000 /&000 /&000@/&000/&000 /&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/D& p0 0CS0 S P0 /p@-P0`@ᘋPp@ Tp !0A S010// !0P/!R/P/P/Qa/P/0000 /&P/ 0S S//0R/0000/&000/&7@-@P@@P 04PSPE  0   Ѝ0 ! ! !&PQ 0S///ᤫ&03P 0 /!0 ACP 0AB0P CSoPS//O-M@X @ЍOSQ`pu rTp 04S`\k P0@`S@T~WlЍ_Uᚔ!` 㞎`PE`0r>T 04SJ:`\H  ?T  QX Q(    z & Z P    mT0`[T?o20S@ Z@ @0R @T`0-@0S S @0V @ X 1>@@V X*2 00`00P 0!!!00S00/"& "!00S00/$"L&"!///@-@H,D&P (  @׀꨾&4"!7"!-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A 00ЍQ@P @ p@-@P0 `P  \*. Q  Rp R  (  p 0 B &-qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00$y Ѝ0S/1>3 !/0S 000/Ἵ-0S*p@- @PUQ P p Pp/0S/p@-P0 @R`*0 PQp0Pp0S/0@-0C@ 0 0  (  ( 0 S/! ^R/0@- @0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!s0`A-PRp `@{P 0!o000A-@P`p0 SV1 V00W W0Sc0P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & pG`P  B0Z  Bv`FpGPo`FPA@"!A-@aP0S0<R&*1 21<0S0 0PPR0 ,S*!!!0 0R0 ,S(!!!,p (P0P A, (0 ,PD&&&A-P` P0PS\ ]\ xp@BX T 0| ᛇP$Ppī&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00輽-< 08 C800/`Q'Q!//&0A-sMp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0m0 "0 00 0W꼽-p@-P4`@ᕆ@P@p Tp`"!Q 010//`"!,1p@-@0PS0<Q:1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0P`D&&&O-@P 0RMp\  P&  @ P 000Ѝ 0@  CNPP ЍO 0 PS@ ᄉ 0 00<00S*^Q0R08 ]R00-R @@g Q* ]R -RS\V0]Sj-R0 Sc:0S006000S80S 00000〦 0 hSFh ,VKX ,0Sq40Sn$0Sk<0Sh(0pwd  0(` pc 0 @`F p@ Uh 00C0c-R [RS :R =R} 0S: N .S0,S00``0-S]S0S00``40\ 0 IY0 S:0`S00`0S00``E0 0I{P  0 (SB(0<R$  =MP    t P $0  0$ 峠S0tS00``0-S]S0`S00`=  0 S:0`S00`0S0 -RZ QW]QT -Z00  YI 0S. Y0`S 00`0S0<Y00 Z0S  Z40 LP  .  uI400!0ⱐᲠ40  7P0S 00100  *P  %P (B(N [ 0]SS0<V*0P80 P <0S P Hp00勰P00 0  EB#ЍORW =RT ]RQR :R ]R001"!"!D&-&&& 0p@- 0(M@! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@&&&0A-``Pp\U@ [U_0V:0dS00`00 4\U=*Ux .U; 0Sf0 `S xAPu 844U\ 0CUUt0SU 0`B }t  t 0 D OU &83U F 0  , 0000h308@0S* *Q2  0  B  BA   B0|  B5Ѝ 0  0S 0S 00t200}PT\QR {RO00j0SP;* ,R8 Q 6 2000/ UU0 R  !   h0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \a V 1L  0 S *R \R )R003 0S00000+꼽-)>{^ ]&0@-``P?Q@ $0A  R % S 0^Q [Q \Q 0S Ѝ{Q |Q720V:0S00500 @0` V1@`(P ?0 S*0)S  ) V 1L  ,0 Sf:0S00l4000 S**@?PQ{PR ($  "!,Q 0S 00300\0 0S 00300?P  *P 0 B-  B   B0!  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   0p000<20to kmi0V:0aS00`00<Q >Q x`$P |O &   B 0  B  BZ  B. "Q A% l0 S`0* ,R-  0000< V0 R   0 S*}Q00A R 0}Q 6000S 00T"!-&^ ]0S G-`M pQpG pL2@P 6W:} Ѝ>PPP P $PPxP @jP 0   uPP6   $ ( , 0P4 8 < @ D t| 0000L R:0S005000 S8:  0A 0HP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RQ00p< 0 g  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:_00PS, 0E10S*P8I0@0CU00C0 RB  \ U B!U  E 1U, X0C ^ဗ!1L0XRU!U!  R0>P P PS 00 000@0000 0H @ R00d000I 80S@ 0Q10CRZ/TUUT-Ee,1p@-@0PS0<Q:1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0vP`D&&&0p@-P0@SQʡ@P80 p<0S P pH0@0@P(00Ppp@D&&&O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  ^P%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(&&!O-P0Q,@p` V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. `F`FPV00@>N>0> \0C~>!0>#0 R@u @O-4M0\00(0, 0 00$002   0 @X = Q  0 R  R  PZ$P  (    R    ``S  R  Uj k V pw p (B( _U RQ v   _V R up  (B(   _U R w v  _V RQ ppX u0^ v  (B(    _V _UQO  X 0FPyu   p$ V    upv  w( ppu  v X pX qX0wo u`  _VX 3"  Q$,ZS (  X `M P0#v  _PU PRPU00000S 0R0 4Ѝw_Uw^RwOu2&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@YS  D>31># R 0800 0@~Y_  DS S- S* S( @` PS 0 b800 0@YY  DSU S S 0>#0FϠ2@P0  =P0  0P P 0, 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  /ZP%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(&&!O-,@pP W`> ^* +^` ^i ^O ^a pP ^o ^Y  GP A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>0 E00  R?o20SpG pGP t0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-u!&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@~YS  D>31># R 0k800 0@bY_  DS S- S* S( @` PS 0 F800 0@=Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-u!&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@~YS  D>31># R 0k800 0@bY_  DS S- S* S( @` PS 0 F800 0@=Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  ;SP%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(&&!O--lM%PQ0t @%Qo ppl        Q 0"RS. 0 YO,Q 4^ 8[ <``F0` 0Z01S` 0s vQBo \R 0C1!S` `0o0 0Q[ 0000,@4H80<@ = PP  TX0\ L0`t Vd 00 S`FY10`0 0 ,`NP XD0S 00D0 ,>`PD00D0 0R < 0JS : !R PZ Z `p3`XD0SZ 4P ,0@P4 pj,0@ 0S%00D ;0$00D0 ,LP5DQ/*0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SPHDhX 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y),Q~ 4^e 8[b <``F0` 0Z"01S` 0s vQBo \R 0C1!S` `0}n0eED& 0Q00000 V,@40H08 <@P0T0X0\0 00S`FY10`0 0 ,`P XD0S7 00D0 ,r`PD00D0 [ ` 0R< 0JS: Q PZ`XD0Se 4P,0@P4  p4P HP lЍ,0@ 0S%00D ;0$00D0 ,[P5DQ/*0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SpPHD_X 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^s 80 0So <``F0`$0Z"01S`$0s vQBo \R 0C1!S` `0cm0$0Q000 0,@4H80<@PP T X 0\ L0`DrV 00S`FY1*0`0 0 ,`4P XD0Sd 00D0 ,$`PD00D0 0 S` 0P< JP:$0 O $0PZ`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$00D0 ,4P5DV/0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SUPHuDjX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPppp pnpl-Ѝ///@- // //p@-08P00@S PpdP pȽ-7@-@0P0S TP Ѝ0P Ƚ-@-@P 0S : 0; $ $ 20fH21Q@-0M(,4`@0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&-M{ {zЍhQ@-0M(,@0  P#U` `0`/"`o R?#0.o^,AUU-00ĵЍpFW`& O-0M@p`0W PV P'Z P2Y PyX PV P:$  >[W Pr  7[  1[V1  )[ #[Z  [ [Y;X% h  [T 4[ ЍZY!X3  Z ,Z  Z <ZЍ Z $ZXVZ  PЍOd/0//....x.0..----O-@Q0M0R00P$値 0` p 0P R nRk a BR $  , j PQ D jPL Ѝ3 00jP~Y U000T0003 0$0jPNY U070T070H jPY} U000T000 PjPY U000T000YW U080T080 oR 0njPT000U000v ~0 X[jP 0 4UjP 0 `OjPjYL U080T080U0 t>jPz 0 8jP 0 |2jPTY8 U000T0008T080U080/T000U000&T070U070T000U000 ЍT080U080T000U000t iPYv Y0 hiP 0 iP ,,l,(,++H+(A- `M0 0 !!0@PH@>SHPPP PPP7"`!P`03 pP0  p+ 0 Znp@ Gnp@  p@@@dbn PDn\nPZn 0PSnP`ЍNn00@ŸO- 1M MP (@PD`0\ "( p (-pRp^ @D;h@ 0@k 0Sr pء1 00p 0``00p@, -0)@t0p )0 PP 0S Rm001ݍ Ѝm0S 0F\ R Pnp @`0}!@DD4 [@ 0 0T 0V   0/ 0p,R 81ݍ Ѝp'FtH'&&gt0@-M0P  Mp Qp@ P? Ѝ00 06Ѝ0@p@-P0M 0P@?cqp" ` p PAP0@@P0 @@b0S VS00 S0ЍpTm000/ᰫ0/Ȼ 0 0 /ጫp@-PPP@t 00@,PP00p.m 00ttp@-pQPpL p@ GP0 0$p 0S A@p; 00A@00p0pl@@Pp 00@@0U0 pp 00|@P@00lPpl 00l 00l 00l 00ĺdh(0@-0 M@P0' /\P( 0Pu 00gP)000S@ SQ Ѝ03pP@H0@Tnl@4 0 P@pL` p@-0PRMP @R 0c TT /\PQ b`Pu* 20gP 0#pg Q@P 0@bqp\ Pw pR ЍpPuhi/pP4 0LaS`( 410P(l@00"l0 @@k@ 0  ݃ @pp00 0 0@ lP#U8p@ k00 k@k0 @k0 Pꄸ$4ا &@@P0(@-ZP`O-$(X,p.S`P@+Wu00Sb [0 0GPP: $" 2Q > !"04x"3S20*rW00Sa [0 0P P : )" 2Q >@AQ!Ou0 {0Qq w{` O P : 4#0"Q . ![0 0OP:t' 00{S' w{Q e 0OP:  4#0"Q .@AQ!O[0 0O P :[y'@w{ 0OPy: 0ᚔ)Z@0S20n2" U%> "Ww{T O P \:4# IT0S20R2">" R01Q"Oi 0S20XC"""""""""""p@-@M@ nP, `S 0 S1h!R 0SLXB ,007H+Q !POT d! +0C 3S00< G {{xP 01C /AGPV P   00%Xp X P$0SP $Ѝ00[pG* 0C!< R Q!h! R@( Qt08$0p|0xpx0(0|0p $0ptG 9p00W1<PSQ_ }Q<) ^( S*P0 09P 01<p@(Q( !hQ0Wt08$0px |0@x ( | pt0@$ pP4  L A!h!R"0( SS:t08$0px |0px0(0|0pt $0p 00WP<\Qp5 LS 0,^0F <P0A  0=R< ;< @%0Dh0(00(0000,00,0  G ,0P S G"x  RQG#0 SG P\0sG `0d   0 Q0*0^*{ r0s{P T80< D000@ h0 0$% 0S 000000(00(0,00,0(00(0$Q0P S %R" :"  R#Ό01"?!x"0x$00$0t 00 0p000l0S <\ ~ X  NR HL\ @0DhT 0Rk{AP{{$hE `&&0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#P0L dSH0 G`0G0Gd G 000#( R 0S $0S 2S0 :646 0Ÿ! 0Ϡ!>! 2#1110N 0pP<0d2@#! (1#@ 1110N 0  ΌD !` R<l?, | 0/  "1? A D  D @0<0S H0Q 004 0 2 0< Q00:P0 0<R$0h00c 0<0@i^< "0RD01H0<0@ #:6 00" 0Ϡ">! 2#< 1110N 0  ΌD ! R@$?, 4 0/  "1? A D  D <0@ S0H Q0#Q0  0C0h  BQ_ $0 h00$%; 0dR  PM<@ \@@@Q<&<0P0T8<  \00 Q00000S$PT8< G ! G! 0 ! 0 0S(0S `5d0 Q00: c 0<@]%20SD000@0H<L#:@6 00!$Ϡ0!>! 0H!!!0C" . D @" 0D, P<8? D 0/  "1? A    @< P0LD \0#G0000$02p rp t t z  0 RR  0 & G%g G RQz#Z!G RQmG# &K(0<0S$0@00`0<\[=QVH NRL0X\q<0@0@0D0h,0 000 0%0 0" P9#R3 R0  \Q$% 8<& dP(  01) :60 0!$Ϡ0! !>@)0!!!0C 0Phh)! /.P P@<΁!@? < "AL00 h00H%00<0@ C00 00S ^0  $0h0 C0000S ^ 0@D h0 BQ0 D00@ h0  \ps; 0 *R" O-Mp@$b0l`00b0W0 T# 0 2c1  ?<0>PP O 0v> 0`0?d00 0P0?T0 080?0 <00 4@$@$$%"0000  000T ;0h0PJ 0TP dP; P< $`Pf0Sc R`ʰ  R\ʸ  RX 0 0\ 0S0`@dp?O$@T'pET0}Np0`@dp002b0@D HPv^D PEJ000000 0H0!00R0SX0 0h080000R4 t PQlpx|POXRSY Y  h@p| Ux Zt 0Sp0Xl0[h0 Rwt XXڸ8常0:=CP0p00@t0p`VPu x0S apt00 0800@4p0 h00 0OP |0( x PZv> 00! 0#/!! !./ B 0S!?.P  PɊ 00#1?Lv.C BAQS| \xt Ptla00 qp  A 0qp `pV@P 0R?o20SKa00ߍ 0Ba0h00 qp@pS Q#! !pY@2NRp/ h0 P0,P_000 `0  ZR 0`S 00@ a0 0h@`0S 0V0ZS0 dh`  ?PhT0 ?8h<0 ?@hD0 ?HhL0$`X\YZP R``T00`0S@Tp`0S? 0ß園"b^2):##c2S# \TP.j<#PP 0l#0dT0IP30@pD|`0h8P000 `0@4pP ? /( Rß&0Q 0Z/0 #10">/ 0 C!a0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 E2qp> @p(pQ`#00`0S @㼀p h @p_00@pߍ輀X) XXʕ 0_0 Q  s!P _T00_0S10(` #ΌQ0"c01 2c1@Tf_T004l)\P(\ ףvɻ %I$@-@T p  T8at X00 R 0 R 0Q/  /  t  DQ p@-0t` SPPH 0@#  T\  Q(p/,tH  Q j.0 0#  Q/s00Ɠ\ 0@-o>lP 0@" \ 0 /0sA-@P `p@P0% P @PPA-`X@@P pjNP0& P @PP0rA-`X@@DP pH@P0& P @PPqO-P M `P; p pn$0P0@P P p % P pP0S 8 Ѝz P0 0V +X D0`0S Ѝ0oSP 2 ;}\O-BMM@pq]d `0 0WPP:MPP  8JPPn00WP C @PP`J&  0PPsp 0P0  0PPep tB@P"  t0dQ PkPUPp`  <pu 0 BXP{ @PP0 PpL lP P \ 00BލЍP/U ` P wp8\0SI  GP G0H00 PPp:  G\ X0 0GP@! 0  0 0\ X0 0GS\  x 0 00Fⱡ[00/\ 0 0GP}\l0 P0@  G{q\ @0 0{GPrp4hzd@,- M 0  PЍ- M> 0  lPЍ- M? 0  XPЍ8-0M  09HPЍ--( 0P    0/ 00nnp@-P GU@p[,0,0? `0  6/p8n4p@-PFU@p[000? 0`40  6/pm@-@P 000l3/|m@-z@P 000l3/D8mp@-PU?o20S@p 0 0 P5/lp@-`P VU00P00S@p$$  0P 5/xllp@-PFU?o20S@p 0 0 P5/lp@-`P@PpW[,0,0 @p@/kp@-Pf@P p$$000 B3/ppdk-@- M  rp@,,000G3/ Ѝ@ Ѝ/k@-rp@  000G3/jG-@- M 00`P O0Sp ЍZ880M0 P@:/(jG-@- M 00`P n0Sp ЍZ880a0 P@:/xli@20!P(///|////////////x/l/`/Tt/Hh/<d/0\/$T/L/ D/</8/0/,/(/ ///// xhXH8(xhXH8(@-@$ MP05505#0%A0!0%P$00$0Ѝ R/,0p@-S@p(P$ARp$0S* >$0( 0C\ 0 CR$ *0#$00S 53$07$05 0$0(0, 0 !PpO-DM@X@fP, p@QX Z P a@: Z Z|7$0P$  0@X Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S 5,3407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P [ S 5>37,05  50Q,0R 0 CQ * 0CQ,*0#  ,0 0,0S 537,05 50S 5,07,05 50S,0DR0#0C R700C 1L5$0qS 5<37,058`0,0 ?R0@SKX0 0,0S 5#37,05 50,0 QS 57,05 50S,0 R0#0C R00CP,@DЍQ T` 0pFQ)Q* AR bQY fQ ?R0@SP 8 b@S B;; # C, 0c0#80 S ,0 S 5,3407,05 50,0FQ0 0 ,0R S5 7,05 0,0 5RS 5=37,05 0 ,0 0bw@0`fpF2$0?Qa R^  2! a, A0!p @ `+ 8 Q,Q 5<37,5 5,8Q,  P,  , Q0@5p`0``` VRQQ W  P [P=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R`0W  R `S` 0P`0S 5<37,05 50,0080:Q 5,347,5 5,@p`0%#jo%#jx`%ju-M{00{Ѝp@-MP@` 00 4/ЍpO-PRM^  `WpP+a@/GP L0  D pp Ѝ@0S 0  D  pp\W0S Ѝ贠 QW0S(D 0@pD 0@ pp6W0S1W00-W00TH(@- @MЍ脸O-EM MaX@Pp+`EB 6V0P@(T 0 *V@0PT 0 0EAP A AUEލ ЍV00Eލ ЍV00@- @M`p PQP+ /U R rR  P   0@  P@ЍP  rR 0rSX 0 , @0 Ѝ@xV 0 HA-` @p 0P/S /~UP @0 Sp 0 S {< fUp@-IMM@`PP Pp 0: S \0 040qp IލЍpF͌(Y P>C͌ X PL>JB͌8W P>̌1S P=^B͌`=@ 0S708x H0PP `P, P  P P P P P` P@@ (P PpP (qP PD PxP'( Q780H0x100CS00000C(0h00Lp P 0QP ,0 `0p@ , W @  gpV/!01AQ 0 0 @T @վT, W   @@daXhP 0Y iPiߍ P 1 S ,0 0 0 !1S 0D 0| 0#@p00ᠿ,(00PpL!!\V( @  B  $48p< [$ 00A00@S9 00a1 P Ua PZU, [000 P,0匐0Yp$0p1P,@`@PP ` V ,@0@S 48p<PP 00 0R 0'LpP1L0-0P@X1@ @P0%0P0$001T00PP1P PX00P0000(,p A8 P40P0@AT 0<O< U, p@PW 0g1pY@10P00 `00V00 `νV,0W0 P `ܰ少[@`@PhP  ` V @pY @ P @T 0 P8 U`T,p40@T`0 (!  A A$@ 4 p,`0[T0, q q000 p`8@<\V 0f1`W10 @ 00 P00U00 P[U,0 V0 @ PqZ0P@ P  P U `W 8@<\@7P,0@0 0 ,0pG0H W0A10D|a>pU( `\M( WM( RM( MM (  HM,( JCM8( >MD( ^9MQ,0 1@-( `BU0,p4@A,   ,0@0H T0封"1D|QF>p T Pu[3p,`4 TP2 00RV 0Sf ,00 [D k! 0 SW !L011@ @ T @冼T,00 0 @(0 pPCT,`4 0 ,01 , 0@ H 0T1D|=p! 0R1B@P0P @T  0 P (0 SQ(0 00CP, P0T0 X" 0 0 B00 S3 0 a0T !1 @Tap @ T,000 @,0,0Q@ 0@1P`P㤹0P: `V  0PP$0SA ,00 $p1@T d!@W3 !P011D ` V `ƻV,0 0 0 `Tq[V` ` [  0 [0P,p40 0 (0 SW(0 00C,p @0 [# 0 0 B0!0@SB 0a0X !1H P U a PwU,000 P,0|!0RP0P1 `@ 0P `V  0 @ p3 00R80000S p,`4 O-`YM|0cS PAX3? 0K͌00 00S 3?HPK͌0H00S2?p`F͌(0p00S|x2?@F͌(000Sp,2?pC͌ 000 Sd1?耍B͌8 000 SX1?̌  0110SL1?<1NB͌ 0810 @iYߍ 00@0Sk HP90Sv p`20S @+0S p$0 S 耍 0 S  10S N T0 D@-<@M $( ,ЍpD0 D@-<@M $( ,Ѝ D`0` 0 R/DDQ 4Q(00?H/ḉD|$T0P0/ D @  R 0  R$ 00?H/<|$0P08 A-D   R'P?UH0@aaS@T,p10 0D   C(   S@T,  R 00/Ј|$0 0 ćDl P  `0H?30\ -@@  D\,00D//᠇|$O-P␲4M  0pS4Ѝ{PD H0 L ! 0 0|!0:|@hPq 0`D0ZP`@P0Z0 T0P V@H 0`@;1 0?3Q |QN D pH0L  00|"(0:w:`P0S R,@P@RP 0 : @RP0`S4ЍP U|00 0Px ``0T `@004  0㈶`Pd @|`|$0 0 LhD`0` 0p@- PU 0@S ƹP7ppDDp@-@P 0PS 对P lpp0P0& H -? \| 0DR0S  0R0000 0\$( /ဃ|$0 0 꼂D 0 0 /H-O-MpRp2P0@`0Vu T":L"@"4"("2 2 $ 2 T 00 1 X 00 1 \ 1 ` 0 0 1 l  1pmp00pnpp@z20吲唢園 $0TX0\` 0lm0n j1Q0( 0 0  pЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000t h<0,$DC-pP␂M@ |b`P {h2@0@Z  @03""BBB {6`@"C{@@ÅCC$PU Cb pP 2pK 0p RZ @B0 @@@(P9 0 @@@(P. p* 1$p& p0 @(P  o'f*000S :3S 6ЍP 0[B2S@ T  `h0S,Z=pPc40*dA-Z`pPp [B2S@ Tbqݶ۶000 R AӶ A ζ|@-+ hQhP@EM`_0  S*<10#  !!!- !!!!>  !< !^ v : !' !.{_ !| !o !* !Q>{ R pp1 R 0S8ЍQ L0 0 0El00TЍ!f'4|&$&<0l 0 S/%O-`Dt@M[p+(($ X㚷0CS0S<3㜷(⠷P* 40H @08p{8 x%t{ġ`X(ÂPPßHHßP@@ß88ßx00ß $$߂ß@ ßÂ`h"Ÿ! ⼁!: R 0S1810S XけЍQ h2 0 0DPr'>ppGl`( E(@ T (0Ѝ>@ <  ^v#x:'#0# 0H#p--`_|oprݵyڵz׵{Ե@|ѵh}ε`aT'z`L&%$+!,!-!.%0%f&i%j%k %l%m<%n#qs%t~$%#up4%#vr,%d"wy{#%e"`"|oxz$<"#00p@-0'N[( ?E(@(0Sp!O-M4g47`,0 Jҭp7划00 7 `0P `00 S00U0S}\ p @00  4` S  00 4 `0 s 00bR$ 4S4 0((&0 0Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Qt l   P5U0pS  p! @00 4 ` $R{ 4 0 0 ; 0 $Q B q/ 0 ;0 岴p4 S S040ST 4 0r0  cR0$0GU  p p P p0np P 440 s 00bR43 $0$ 0fS t30l3#`w pS 83003#`h p3 0 B ` 40q0cR 4S02$0$ r0 0C aR?o$2#n p Si p  0 s 00bR40 ;0 p P `R pa 40 s 00bR4 4$R40 s 00bR40 ;0   pE `Q q 4 00 0q0cR  0`  Ѝ 100 ?c p; 000 ?c pv/` 0 `00! 04 4 00 40 s 00bR 44 `th5Ь@5X43A 31Q$10(,80p@-P@ 0 PC TT Tp-O-@Pd4`DM0 8 p$Qq  :Q#R3Z 300S 8&3P@P@P@p@-@pQP>P  >P <P10S. ,! P:p0@Sp0S0[S0mS S@ 0S 1CQ'0@S ;S 00C S0000@Sp0@S mS 0C;S P 000@S;Co0O-P0lvSpM`Xf` `JP >U0 `r(ʍ"(0]I"R` (0$00 03Sd7PK UT$Y7P K XRڈ5$50T p5"00`4S03P00S5 p0S2 4S, 4S 0t %W、匑Tp"2 0Pm 4p2Z& LQU# P P 'P ᳰᰰoH5S4S 4S0?o2 ᝰ44Ytx2 PuX  =P3Zx2  =Px2?;~0x2W  <Px278x23X|2 PW x3|2fЍ0 D $l h $ <% p 0$0(0JXj <P Y <P! Z$ <Pp2?;~0p2|20P?0 r("(0rH"R`p2Z Ѝ\W8 80 0P T0 0//Vp@-P|``p@0@ >0SP0P0:3S 8 80 00 :L#pV0O- Mpp3 0hS0dd*B`pP 'WW p p PS p   r  `R  00/"1 R" @0S S8 SW0B S p20h2#`pw  @U ` Ѝ R j  P  Ѝhp P ` Ѝ0 r  `RR 1   S7K @y ` 0  S q$ lR Q1   ЍOp  q B`R/o"n000 ?c Ѝ 0`0`0 0R.<  0 V\Qhd(lxG-@P4S43P`Y 80$ RF U ʌ3S23pSnW " Rp{ :8hp@-PPP/ 0@` :QQ" “Tƒlp lp  #P`p :Qpp=h0 0 =D0 0 <D@-@ MZ*qQp* c0 B0 `000050 00508003 Ѝ 0< 503 ЍL L0 0`0` Vj#cTP`<<0 0 000:P/; 0 0@-00ֳ`;X0X 00:3S 0 p @-,P`/0;\0\ 00 :3S 0- p @-P`/:$0$ 000:#Rs/\:$0$ 000:#Ru/(:000 0  :#Rs30/9(0( 0 :#Ru30/9 0 0 0:/|9p@-@P0P`M00 p kp 0S|000 SC q R0 :#Ѝp R 40,00 3/ЍpD9ht@0A-MRBP0@Ss Q `P 0S^ 1P 00p (10p Q61 1`p0V0S  h100V0S  034p )+ 03, p 0#%ЍP  QÁP 0:x   000 0060 0@1600X8dht@0DT@-,@@0S600H@-$@@0S 600@-MT@@ 0S Ѝ< 000 00D60 0Ѝ4@-Md@@ 0SЍ 16 0R  (00 Ѝ #6 d$@-$MHBH2@PQ :cVW0r3p pp*0Scqp 0SQ1p0SB 00  B0*1`00|PN 1@ %400 R 8 D 400 X40'0  :3,p 4 P`$Ѝ0`00|P @ 5 0R` 00 `I500T @8 300 54lpC- M`  S P@<0@00:3S W  Ѝp 1 0 000:3S/D1X0X 00:3S 03p @-)P`/t1D0D 0@-0 03, p aP` 1@0@ 0@-0034p u)P`00@-PP MP* 0Q0@00xP 000 13000*C& Ѝ0|P H000 34000*& Ѝ0\0l/ 0 0@-P@ M0:R# P P&tP 000 20& Ѝ0`P D000,PP Ѝ0/l0 000:.!0\ S0 0 Q/p@-@Pp80pPU,LQ (0 P0C0S0 U@Tp#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@pVЍA-PPM Q@`Q00?`FV`V` ,p(L 0@pqVЍP/\ , 0 B0/\//A-M`V,P@p(L 0@pETЍA-M`V,P@p(L 0@p+TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ , B(0 @T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-4 PlMVCT_ ,P@Q@8 =$^8R@ 0000@0pP 0-吢Pp4S-`w0@PP#@  p) ,t4,  [ 0 X, 0 e lЍB 0i9lЍO0*O-0$MP2Ut 0$ ,,`V} 0` 0P ) W):0S`H9 0 Ꮱ@P$Ѝ 0SM S7 S0W  10 04S $ЍO@ 0 @S S" S0V   -1pG0 0@SG0Wᨀ *H0W0 `@G0X0  0pG0Wᧀ*`@0X0 `@ 0S S0W0 @Wᧀ:0X0 \O-PQM0 43pS`.0S+R= @00! 0@ @00@ q+TP/  @ ` P @ PER 0  ܠ`PЍ` D ` P 4F " 2 Ѝ@ 0l#`P0  0 / 404 0  R *P /!L0L 0 \ ʌ-P  /!404 0  R *P /4!L0L 0 \ ʌ-P  / 404 0  R *P / HH0 @-0^ @P 0 @P 0 0@-0@T J#0R4 B0pQ 7@.P @ 808 0  R *P \/hD D0 00SP:P4@// 000 000S :P /L0L 000S :P @-p @e/0 0A-0`V* Z3 S$P! #Rp@4Swpp3@Tw AB0tQ 67A\.0((0 -0 iT000 000S :P J/00O- M X% p `P 0 Ꮯp @ႜP  0 P僟p@ 0 .@  Ѝ@P  P /p@-JP }3S P`4`碞30PV圞  03s S 0XP 2 $R 0X0S H03 20X #$04p03ppHp@-jP 93S @P4P^30@Sp@WA-`Pf JSU?sW< 3$@PS3 SW*0N, SsH0S0 WP3PSSpP4Sjpp3PUp,0\4000?a000401C0010L10|1spp@-@P X0P:"C0T0XppG- ؀\/P@p  `P LTL VW PT VW  T000S;0 ˞0 0 x|O-($Z Ap`PሞP@8P ( -T2匞P* T 傞P 0 u- @00 m-0\ WXP  RX8 @(  !-@0|d @-?C0 @   @ (( -  DTA-@PQP% pW# 0 0S0,000 R   R   R  P l4`T `TX *P Q Sp QW02p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S TP00SpX@ '(@ 8Q0@0ppp@-@PTa`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0pZpxH0H 0 R P@0?30Q@ 080// D(0( 0 Q /D(0( 0 Q t/xDT0T0p@-PR ` <@78H@?`pp@Dl0l 0 Q RQX@078@08Q 0@0//D0 0 XD0 0 &4Dp@-P`0`0@T X0:20T1S@0?;@0h<000080S@078@0vpDP Q@0?30R@080//R^/R/p@-`S 4@HP@?Ipp R P RX @0*"7 8@08 R (0@0//P@/&p@-@Px`P` X0:20T1S@0?;@0P8000080S@078@0p8 0 0000TP PR  R ! R! R! R (!R !R 8!R !R  R/L1S/ 0 0000TP$ PR  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/ p@-Pk%@0@0p@ ) Dp@-P@[% p@p0p 0p@-@ QP00S ^ p@=% p@ DL0L0p@-@ P 6%pp&% p@ Dp@-P@'%pp% p@p@-P | @ 00`%ppT0\ ^ @ p@$@` Dp@-`@P$ppT\  R @ p@$@Rp@-P@00S ^ p@$ p@zO-`h8  ( C P 0 0C00T0 R0, 00.80 0000 S 0CpC00080  GEO-PM> P@ ,0H100 0`0  0'U,00pW$ 0 0 00$ 0 (p PEU` 0 ݗP@p  @pV' Ѝ880 -0 M0 00 ЍPD- M0 ЍC-@P M(p, P00S 2`0 GR 0 O@0L"Lb ``8  (0 0Q 0 GP0D0 Po \0pq1QH``00CQ000 Ѝ0`00SZ00%0   T 0S00% , W10X0PXp T0RpG WڠP`PW 0 ` p Ѝ80  080 000 S0CpC;Tp@-@`P!pp 0p@- M Ѝ\p@-PT0 0M`@  g!p 0 ЍpDl l0 00S X  8Q Q @ ,@ /&R//`DH H0 00S 4  !R@ ,@ //D`0P0 T 0008!R !R @0<@0/6S//<0P0 0 0001S@0<@0//l0l 000S X *" (Q Q @ ,@ /&R//D$0$ 000S @ /LDP X0:20(!R !R @0<@0/6S//0P @ /A-@Ppp" 80  P P`   D000T $000S0LL0 - 0?o20QQP TD,0, 0 RP00T00/DA-@P``$ 80 ! QP~p PA eT : 800PU  000S0P0 0 D?o2?PRPT //PP00T00/,0, 0000P/P/,0, 0000P/P/O-@Pd30Y Q T# PU D#00SH04SPPQP0pGP0HS``HpHW, 0 ^  1  !!$pGPI@Ye0pS a[0 SqU,0 !0D|000 P0 pP`a`0IS`IX`a,1 \  0  !!$pW`YH0pSa>0 S:,0 !0D|000P0qpI PX 00C 0HSP 1TX[00CS``[TY0IS`YPY0 0CPY|0 0 Dp@-@Pp`P0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@00C N 0 00D\000S  Q R P 0!00//ᰯ|-(^Q,0 , R1S ^^1S ^@O-MA!1@ 0Q4p, @p P `0S" S#A 00 0C ```P 00(00(00S00C0T0 03/p 0PS@(  Ѝ謮`|0(0A-S$'p`4@P(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ 0 @ Q@R0耬O-@ M`P 6VTppD0S  00C(00@00 T0@ 0 S `&, 0 S@p  Rᰁ@`pD͒ ` | p Ѝ@(0 S RR Ѝ,<P d,050P `00V  ppG , B,(pqqA0 ` T` 0Dp4 P ,00 G@p`4 0Tp `0Dt@U   PB   0SQ 0 0PC $ 00\R <@U 0 BQ 0C R G-@Ph 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`0X0P`UPW`V``0 @p 0 $p0PEPUP D0@ PQ0 /$ $\/ P/A-PQða@`؜1Pp0$ TY 10 0 QTD$ 0R U ESpL @10 0 QTD$ 0R U EAp: u0 0D  Q SC$ 0R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0QD0A-PQÈP0P`@0*$ P uT00pW  0TP- 0S* 0@- \&@T!\8x ƌ8 t ,0A@0@PU 0P0U00 S0/0?o2?=XA-P$@0S00â?4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P 0 BS0@( p`0,,0 0CA1!0 0`@0S( 8XE?*0@-0B  80 P R00 8  $P R  R0 00S00!R0$R0 R d1S0800800080$O-RQ M40z`p@Ps 0ሰ(P,o  PP0^ X4% 0080!0Sa0 ` `8 < X$p@0H0|0L P0T`7 4!8 \0`0d0h0l0p0 ЍݍP4, 㼌P& :"R- 0 R80SJ 0  V 0P 0PʬR Ѝ  ގ܎@ ЍԎ A-@P0QM(PD QpAR`    B P2 \/X* P%ʤ,APP  D0HRD0000H p0$`!bP@0SЍPЍ`@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED   0  PI ЎL1D00S*Y p$`(D0@0S0p`0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @|$000@-@PM0 pp  00C  ?o2 0 mPP <Ѝ0PЍ0DH@- @  0M 0LЍ-QPDM00  ( 0@4ЍP8 /0@-0CM 00 @0C0 0 0D NЍQP<O-DM@hlp0tx`PP RK TNP@[ B^@D࠳UEpAPpWAA^APU0E pCPpW\[4AAA!p @lp0,00@0@0*l@0 @ V 0 000@ X@* p0Y  DЍ   Q Pp X@* 0Q0 00C0CO-P $0 0x'x08C8S3,, P( @^ @@P8P``,PhXEXFh^ N``,P.PXhEXFhD N^ ( n@ @D^, 10 0UB0h0@0p4!01q!  S 10C8#8 20C8#8S弱 80yD 0S 1P`0HX 0EXhUFhDH00p4h00000 `00 ` (0000 000CQ00( @0 0AP8 `(A^(   `   BQ  8000(0 R 00(0 R 00S( QS 0000!0 R!!0Ḁ1v0C8#820C8#8S弱 D 0Si1L010|0 p7 8000Y 0D1 L0|1 p" 00F<Ѝ,X`EXhFh,@ 80@0808@8u @@@ <Ѝ YD YA 80&`V,p0A08C8 , N ,  B   S @ T%\0-A-U5P` 0M@00%?C5p 00TP 500 25 0@0@0@0  00P P500 @5 0@0@0@0  00P 400 4 0@0@0@0 00LP 400 @08@0400S@0@@0 0 (P !R 0400 0@ 0,@   8P !R 300 0@ 0,@ T!R   P 300  @0;@0  00P L300  @0:@0  00P 300  @0:@0  00 P 200 z @09@0  00P 200 i @09@0  00P <200 X @0;@0 004P 100 G @00@0 00P 100 6 @00@0  00P p100 % @0 0@0@ 00P ,100  @0@0@0 00P 000  @00@0 00P L1S 000  @08@0Ѝ00@P L000  @00@000K|~l\|0@- Md@d0@P006S 0  Ѝ0,0 000  Ѝ0@`lp@-PQ|A`@: Ql1000S 1Sڸ0  @T @TU p0 0 pp11S)0C8( #80B0C8#8SB 1Sڸ0l0 00:h2P000S  @T 0 0|-M  0 ЍC-P@ p$P ?`LH/\O NI ^pGPE ࠡPJ@ 0$ @C@-PB2@` M0@0 !p Q,  !1pP0 01 0@00 @0"! . l!OP6X10 R00S Ѝ@,QP: * Ѝ 0pP0 00 0@00@0 0 0T0 @00P@0 l0Pp PX0 0L 0 @08@0  0pPdl~|~\A-@`QRPp,010a, qa0 A/? O-dM 0L0 :3SF?@0800T $0$ 8 @8 @& @ x?0SG|?@$? 0000D'L0 0  0S* $Pv80@@080000h0S $0Q$p8PPXEXU 0, a    D>0<00 R' R0X *1h"0  70H 080 0  , 0P fp `@%u8000SR000 P0p 111qW@ 6Y0  0 00Sp P 1 @11RT`U0SJ<0I@n| 0@|@ 0@20@00OH(%!  -(0h00,  (0!$pA (PP@P @`@pH0 !?3 `FVQE`P  H0 (P P@L H T XX0ٚP0@0 `@D`  R00CQ,08 S0IC,00@D Q5 @ \p 0@H  UL pD D& D | LpL0$0`0SxV$080  800  R6 p0 4# X0:h280L @T2 00mL0 $00ScL000S808 0080@080yP0+ V0P0PF R 0 R PP[UpdЍ !`v 8000W00C000C0J 08 0<00 ,R0B,0000Տ 8< ` ! a , ^@XP ppX@P lP<0 `0P ,0R,cJ8 P  Q  p, @Wp[@ |0 xwwvmlkkfl[@p +P<0 P0,, 0B P0,@XE q0EHP PX  \00000R000, BCQ<08D``,000C S 0-pP@` 100C `(04p X0,p,(0! B00S @@@Z PM 0X 0\4pP@``FQ00CV00@ 0CK^@0, P^<00, I y / P,f$@ 0 0%80 0  `[p @@[p dP<0@ ` Z `@D` <0`V,p,@ ` !RQ (R $R 0 0D (0 (0pp   0D 000$R_  4 '|000!R`@ SQ<0UpP:Wt W$P@ ~@DT GpGG`E@p<000:  00,R800[,@ 0A040 0 qPCD`<`0 (@040 I᪹ Y Y R !0  qb, R  [ RZUgU)0S 0 RAA0H` LD` ,JP~ZP LD 0B0 B0H` B!!l 0 0C(0Y800(,0 10 0, 0R 0*80p0,@x7 P o 00 0`d0,0 00000000> `P0 @0YڔD`U 0 pC08 0 0W0jP$U pQR R$R $R [< ,  QH5S ,P 8 @ 0  P0 0p 0 P00P  <0`0 0 B0P0 0, P00 p 0 PQ R dP P d1S  ,: 0 00SF 0`@`PH@U9 HPP0` R d1SU,00 @',ʕ 0 0 0D00= 00p  0D /2000PG (P0`xUPH%RFPUJ 0 0 0 ; @P0 0PVWH%R*$R 00 0  000 P<@ :,0 PC00P0 000P'  % 0 ?H50S0[0S  0, 0 0  = @0 0HPWP 00 `WP0 0H`W R [ R 00, 0  000PT p RQ $R $R [  Q R< L5S@ , s`> @` 0  `Z0 0p0 `M00P R <0`0 0 B0P0D 0  < ,  Q,@ 000 0 000P <  T P$  ?@ ]000 000P"  X10 0 G 0 a R! W 1 `@0 000`1S3 W 0 P@0 0pL5S! <0, 00RW d0 `@0 00L`WPg 0 0Lp^@lA-@P`M`4 0p0 R    8VxtP0000 00 0~P 0  Ѝp80 D000 0 B/ 0C?0Ѝ0 00DC-@P⨐M 048! \` d0hlp`PpcP880  D000 0 B0C 0/? 0ЍЍ@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT :#| cp @V0 S0( ?3 S 0S1S0 S  0 00ܛD 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP @0 @T $`U0 VP `a~Vp` |0P 0@PUpT` @I~T @pp ! !@-@P@3~T R/0A-p,SP` @T @~T0`SP RQ A0@ R ", "Q//@-pQ-`P@0D R "! "T R "! "S ^ 0N R ", "Q^`WP@@-@@@0S $0P0C$0H(dO-M:z*0p$P( ,pP `*00\c S@@s  nRXan HR@ @j`40IS0c0@T ^ጰOoB@TP AA  RT0)\ 0  |  bR\ `)` R&P) R! CP'(I@, 4R S[80S ?$ 0P00B$0X @C, 4R CPg S ^\ p( 00Q P80, H04(0RK0((H 0@0( y $P)0S700S00l0S$ 0 S! , 40R$0l P, 0S  0P$0@P$X70 R(,Ѝ<7 0( S$(00 SB G @ `0 & (00 S5$&P0C (00xP0S $0P0C$0%x& l&@ 0,@(@ R 50060, 40RofF`@0,0 $P,40 P@0(@Sg 00 CRcڴ%%  pp% x%@ 0p(`Y ʎ| `nR`F`V,00P0S  ($ 0P00B$0X@@aV  @ Q[Q $ 0(@0C,000 0CS[ pH40,@4!0,01010zd4`000 P ^$ $@$#@ P(@h0 Rv ,,Zq  P+ x# : l# (@$@ ?#R W~( , #\ $6 (@  P ,0(@$ R $@ P  @ lP " 20,  , k40 S [ (L2 0$ ,B@0S c$ 0P00B$0 $ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S +$ 0P00B$0,@%A@0S $ 0P00B$0 ,@c8cbhDbaH`aPa,a$a`P`,`___D__^0t^p^0^\\\x\\[[ZZ 'tƒ A\ B\ ^tƒ    //ᰀ,( 1P0= 00` P7ʀ:l2 S3030 /@ P0000CS000000000000000000/4 @-P@M@&\\ Y #3t P P 00 F000 0 Ѝ ~l`P -P\P Y # /H}0 0 |  0S h h0 8=0!H00 R/@- |`,H|H((1 @-00*l"R !@@ R  ,Ǡ 0:'.tB00 R @R  AR  |,GGԹ0 000:h/zp@-PA1@`M0*l"R R &Ѝp   P 000 0@ 00 @ &Ѝpx   P `000 L0@0D 0@ @ @ &Ѝpzlx02C-00$RS MP@ "2` @  "0S 1#{0 Q  l"R R, !`@ '( v@ Ѝ1=00QM0SJ\1`20lL100 C0剑Q:20h1=00Q!0S0`20 000 #0剑Q:20t 000 0`0`60!Q 00`*0!Q pETyl0 0 0/w|0| 0p@- @00CS0 S 0 S P00p/P0v0p@-0CS@0 S 0 S P00lpP0000 0p@-00Pu@Xpup@-Pu@Np 0 00S  @-@J Q P\,Q    @/uD0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp03O-0PP`$MC@ V upP 0h#0C S-000$ЍpT0 S80  2 0@Ὣ  B@DT p`$ЍIɟ,0 AA!R1A0 CQc(^01H1H1PWZ0!! ! :  J T0@ ?Zq $`P@ qP, @ T  @ PW0(@p TDI0WD@0 (0C\00Cb$Ѝ\ X@ @  D0|0\p H0001@D T `V `sV ``  @~0sԱ0 0 pDp@-@Pppp@@0@0p@- P@ ppp@oDX6O-0lM@P,0 g Q 0pt`P^ P*q0P0X W  0P <0R0 080ąP 0@SF00800`P0S P0 0 0PEPUS 080 00PS0P<0< ,5 000`Pp0 @R <0T R8 / 0<00800C?80-t0P`F'tPY`00 t, h480 pP pTK 080 `0`p8ppP P8 0E<,Q4pQpP Qձpp( X< R!! B qH" RW`!: pGUH0< S8 8 `< (P4@p$0,0 1400H0p@0 @0 0DPU<$0 (Q0 0C0 Ss 0( 0C04 Q00SP{ 80 0B s,0"8 P 0PI00 08p0l8 0n800C?80is0pGP0C00S`FT\s0pP0000C0P00 0PS8 0E!q Xi 0 0H000ᰡH XD0|0prlЍ80< p` 0m<0T pR0`<0 yPo 0;rlЍ`~\qdo@0 0 ZhDp@-@`Ppp p@L J0 0 BhDp@-@Ppp p@5Hp@-P@0 0@`  pp p@!4hDD0D0p@- P@ pp p@ gD0p@-0P `@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``gO-SؑM D@HP 0T p @` 0Z  A 4/ 0[ 8 $[0<SD100.0S0!10>0P 0@0 0}00 0GP8  #8 S R0 0?NP4/ZXЍ0G\8  #8 S R@0p00pP4/pWfԣ\Q# @-@M  R ! R "R pP^ 0 0 @`Ѝ/@-0QM   S S PpP$<R@ @ 6Ѝc<@- M@0 @!Ѝ\/L0L0 @-@ 0 ,M@  Ѝ/b p@-B\\@0N ^\1  @ %  ^ ,\'\{ X"LB!!N0 ("!! L0 }p % !  ; { \PU@ 0 ER7d!@`PP   P0 B! {c\ "0  '  p @ p %X  + {p\\:\ c bQO-$M ImPE@PP 0@%pp 0 6S pp; @`\,S 0  @000 S  P~%S+0LGS00 %0i\@0 `f` 00#1.Q0*Q 0 S @0 SPQ0% p  0  @0d\% 00 @ d @ 0 S4p300 0h0   0  00 < @ S0 0@D0 D@00{0 S[n5 00P$Ѝ0 SQ0%  p  0   0 @%@  c  t 0 SQ 0% p    0  V0% +c@ @  00@Q0 S0 0 @0  0" T 0@40  0 @0  0 T0 S\R$ W. 0C00 S $0< o>0 / 0 w0`f S` 0S0\S 0 Sa0 000_̝Мܚp@-@P0P`M0S SP!  00 0!Pl 0 Q00Q H  < x0  Ѝp#0Z&%%%A-M0PSL!00@0@P0S? 0  ` !~r!!`"bNL LL 0 0210B qI0P pW$P@WP 0fS6PЍЍ 0ЍYNgA-M0PSL!00@0@p0SE  0 ` @!^RRN  L !0 120B Q0P pW$P@TP 0nSPЍ"0ЍЍWkL>G-M0S!0 0`0@0S[ 3 0p P T1T I $L0!b!bI4ቐ გ1c1cL0 0Ã#3cl 10B qP)0< X" pW $@r0sSpP @WXV @T nPPPЍЍ,V-?L*S0 O-TMlsjPPPR ,$   0: 0 @P> 5e000` 0: @P 0S  R 0Z I #Z =Z =P  00pP0 p WZ p z0 0X*Sk0P0 0S, 00    ZP  >nY P Ulq0,0@M 0s p3$ 112cAP3L112c B L00'pr!qpC 0qP  0 p@B `@Hp, @W 0S  m = @P0P m WP00TЍ  0   "$p΀‚ €‚ N G !1 qrpB LqPK  @:p 0pp q`1 $ ϊ0K $$N04!b1c$!b1c0N K 00  0ɉ)1i1c1B뉑P 0tS0cS0Spp~G@ < pPUY nk00u$D@gݵN=kL>\*S-?LpA-pP`0\ %\0@pS sS lS P0\UUW 000@1CP0PCV`1E !z00O-Z A0J =R* =S00C?QRp  Wp1PW -.R0 XZD cJQ   Rp| PA0JlRpY PA0Ja0J Ro11OSr00qߍI@[/gP 00040gP, 000#pRp  Pp1l X   QU PEQQQ W! 340`0 R,R*P  0ep 40P040 P PPp1  \1SB 0C111S? Z! J 02( R 'ZPOQ0S'Sl! 0S'S'SX AT 0DS11a x7@D!&J0qAVZ ຠ `OTb1p@ aAl!AT @DAAAa0J RA0JS3J Aؕ 0000 0 B10 OQ6 10}RRl1  R}R}RP!R[ 1h BY!u o400 P1`Q,*P  0ᯂpa 40040l10J Rg1lp1OS!!0Pl1XAT @D`1AP 9OT1a@0A1B0Sl00l0 0St00t060S&   ?R ;R P0S %S0 01S/ 0C11AT, 400 Q,,*P  4 @ , 40,0PPp1DA0JS30J1OS!0l1)00@1@`gPx 400`,Vp p2gPm 400p, 000S   ?R ;RN eRQf P0S %S0 0AT @D1! AOTA 01!0l1`V ן```&``VP``P``ø`@oobP``V ᳾``@Q AIQ AAT6 @D1!Z!oA媢Vp p2ngP 400p,PW0`0`0001 0&J GZ @ppy00u00xq!J0o ᪢0i00*d0 0vV@``pO`V@`pJ@`fpF@opB`@p>@oopb9M^'ڠ  V8T- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/A-PQMp@ 0S XD xfP P`! 0v0+ V T 00 PP0T0n 00ЍT 㑯/ 0 0 R T ႯT\{P0S T`P j< ~p 0S R 8(C8B((0 000ST00P `  8C8(0P v`  8C80`*T}H,#8 ܕ@ht@|<  0R@- M<@P Ѝ0A-pPjP U) @T`0DV 0PS |[@PV  P oO-PRM pQ 00Ѝ@ `Pc % Pc Pd `%0 ES  eP  P p  0PPP0PS  PP  0S  P  0Sq 0S 0PS 뼐Y$ P Ff$% eP !ePdP }뼰 0$[PP "' [ $@P f 8C(CnR sR fRR0S  V R00000@H$H TP 0:  >0S 0C8#80 P p0  +  V0Y P`Y 00pa 뼠PZi 쑟   ༰ 8C8PR 0VJ *ZPK  PU; o`嫲  PEX%X U !  X ` *  `0 00 R0V00j0S00   0/V  R000WOe  dP$( 0(C-@Q!PMp` 0~ P |00y0S< @Ѝ PP  p0 ip  R 0S 0LP@ P@" @Ѝ F 0 P  LPP+C P*PP004@O-M M0p0:S$0S:S@ 0PS:S``E[ P!*  `0  kP 0P:S ۍ Ѝ@ۍ ЍC-M$$ŸM pP@`tP4 0/SC P zdY PE _\qp4P0  ۍЍCD0P L  }P<0 \0P 0S/S ~pP xBdX0 ۍЍC0  PۍЍ  p 0g d XW L0L 0 (04ۍЍ,0, 0 04 x$G-p`@P  ^PcU  UP `P@PbP @T P  0@010Gp,-@- M@00 Ѝ@ Ѝ/? Ѝ@ Ѝ/@-@ccc@cc c0c@c 0p@-S@M 0  Ѝp0`P0 0  00` 0 Ѝp 0p@-PS@:pS bP!paC- M P@U pᬐ`0fV@@PU   W0 nV sV  PU  @000 Ѝ R@@@O- M PU( `pfSPU  n @8C80@P 0nS sS  Y@PU@@O00 Ѝ 0S00PA-P% Ppp R,R    0S,S@B``P  ' #`00ppp@갥 C-@r Mp`P5(P:pW`*nUB sUc fUH0D Y2R4 @ aP( H0D@ pH0@0 H0H0nUp@0 H PY sU> fU& L00L0 Ѝ @CP Ѝ@P ` 0S0080Y 80 H0@ HL00L0 80(x400H0@ 400H0@04 H00H04 0H0L00L0 @H0R ,0 0oH00H000, R0 0cH00H0,0O-M@0[ ` Z p p(080H0_P; P  `.00 ( ἀ0"[0   0 pZ0 0   0 0  0 @ 0@Ѝ 1 !00@- 0 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00'A-`P0PUM@p"S& p`P !P  ᴀ00V0  p  00 0ЍPЍ^ pu  O-P@ 04M 0"P a`Y`5   p `0P  0I ``| u@P  @`0P `4Ѝ  0* ` `,0Y (0 0$0,0% \@ ,`, AR   0S00XPw Y  Tr  " `Lp W@H @ D L G ,` $fX7  0 @P- pW;  BHDDnXDH sX  "0 S   ,@ 00 O`4Ѝ  B $ ?`,TdXH_X@PܚA-P`0`VM@p(S, @_P$ A`  㶀f0 00P]00 0U 0 0 0ЍPЍ]0@-P pW M@`R _P 0 `+0  00P 00 0 ЍP Ѝt]O-LM<0 <p*0 0,, 0@P | |P0`00PP  p00 ZP_V PD9P_P]^PP @ @P W 0V 0,P * 0p100#$0L90400 0IyX 0s 0PQ ,P  0S $ .S  ROS9 = P# @PV xhFhv 0n P DXD00S P P& 0 " 0S v 0# 000 000 0 n0=0TS 0  0 00 0S(00W8 ( ^8 0S)^9PLЍ @0@S* Hx00 000 000 f0Pr[N (p`@V 0 Vp 0P: '\VQ,W%U^VP< P@U P0&0HS y  0lP (p70 FQ4E F/R) ` pV@ V,%`  @ ` @ T%,  / P P``P` p( \8 ]@T@@B`  4X Y0 0MPDx0  80g80P p` P P P P P P P 0  80@80P P?U P#v 0 S00Pp`@ 0AP<, ,0  80W80V0@A T@@p`F 0 00000000 s0P (p]@ Hx] hFhv9 @0n DPH 0S00 @P>qPVVp P:p0  0F(p%ṔP00P hFhv0 0@s 0 P0Ph 0  S 0 x[ L]LЍ  0Mt  mG0 0 a;h<  `Z4 p( L4lPЎP/U$P00//ᔏ0@-MP0 @ 0^S!1l!1"b2cNL 00$@B!A@C0[PЍ0gݵN  P0`0K?//ᬎp@-MP0 @u 0nPcl b N00PEK 20$AB@C1d!PЍp>kL@$0P00?//p@-M`0 @@?MD@D6 P0ec`E $`L0b!b4!b ER1c1cL 0P0@$D$C!d!bA@C1PЍp|-?L*Sp@-0MP0`2@P 0Ѝp}], 0 0S Q20ЍpȢ1!0G-@q0PP03 0 4`S 0`02,0tPP00|Q``  bVPe`EȄQ  WV|0`0ȇ`H00@-@P [[[ [$[,[[,00!R  ! 001/x 001P/ P/`@--@P X@X0@00s@ H PJI HH @pp@- @-C(M3@ @`3P0R kU{F{{!00 (ЍpPm P 300 U  {Ukk!00 PS ~P 0300 U 2 0"P  0cP0z200{U 0kkP PA  0cP0wʜ200U 0d2ŀ2""P  0cP0P200U 0 0"P  0cP0200U 0 P  0cP0100^U 0 !1""JP{  k0cP0Gd100U 0I B \0cP0f,100U 0V1""dPS  I0cP0a000U 0Q0""QPP  60cP0ʜ000U 0uh0"">P  #??tpHXGd̟l0̝(0cP0Y,000U 0 0" P:  0cP0t00I? 0 0Ō0U"f P  0cP000E?{U 0kk] P  0cP0!t30A?{U 0kkt P&  0cP0,300U 03""P  0cP0o20t0U 0_2""P  0cP0ʠ20l0U 02""P  {0cP0iX2000U 0Yd2""Ps  h0cP0:200y{U 0{ qP+  V0cP010h{U 0{  `P  E0cP0Aʌ10W?U 01\1""MP  20cP02D100uU 0 ;P  0cP010S?U 00""(P  0cP0Mʸ00\0U 0=|0""PT  0cP0p00P0U 0`0""P  ܜD`Ԛ@Gp$0cP0Z,00@0U 0J@0""P  0cP0p00O? 0U0"g P  0cP0ʸ00M? 0U0"  P  0cP0%10I?{*Rk 0F{U{O P  0cP0D30l0U 0d3""P  p0cP020d0U 03""xP  ]0cP0ʴ20\0U 02""eP  J0cP0xl20S?U 0hX2""RPe  70cP0i(20Q? 0U0" ?P  $0cP010d0 0U0" ,P  0cP0ʘ10E?XkU 0{{ P  0cP0P10t0U 0(1""P}  0cP0 10 00U 0T P  0cP0ʼ00W?U 0s0""P  0cP0t00P0U 0b P  ̗4GPdДpܒ̒t<0cP0PP00\0 0U0"& P  0cP0Wʘ00d0U 0G0""P6  l0cP000l0 0U0" tP  YnP  S,100 1,1 U""00 Ch100t10K?Q10G?c|1 U""00 -10|01001 U"x"00 100i1 U""00 2080{Ukk!00 30Y?300|3 U""00 X30T0L30N??@3 U"i!00 30p0Z2 U""00 20U?20R?2 U"!00 20`020=x2 U"Jw!00 h20h0;\200P20C? 2 U"a!00 20p0200:1 U"rO!00 10U?c1 U"A"00 s10H010K?X1 U"/!00 ah10`0\10h0;1 U""00 O(10Y?z0 U"T!00 A00|0E00`000G?*00T0s00(0J`0 U"!00 #00h0000̑t<tdT ԏTD ԎĎ\L{Ukk!00 3003 U""00 300{Ukk=!00 P300.D300=L3 "ZI I 3 "UM"00 2009{Ukkz!00 200x{Ukkl!00 20p04c"00 ^"00 P200D200A  :PI S @ ~G"00 yB"00 t=!00 o8!00 jkk1!00 c,"00 ^'"00 Y"!00 T"00 O"00 J"00 E!00 @kk!00 9"00 40Sj !00 ,0SE !00 $0S !00 0S !00 )P  0S !00 -DT! @\$H0S !00 0S "00 0S !00 0Sm "00 0S5 !00 0S  "00 0S !00 0S9 !00 0S }!00 0S u!00 0S m!00 0SI e!00 0S ]!00 0S U!00 0S M!00 0S E!00 w0S =!00 o0S 5!00 g0S -"00 _0S %"00 W0S !00 O0S !00 G0S !00 ?0S "00 70S !00 /,3 H "~P !H H 3 "0S#!00 0S !00 `300T300%"00 "00 "00 "00 "00 "00 "00 "00 "00 "00 "00 I I \2""T2L0 02(0 0u|20 0z;T20 0k,20 0u20 01t0 0 1P0 01,0 0 d10 0@<100 %"!00 T10 0xU00 0n[0h0 0d*?h@ȃxPȂ́|T,l0l4(~0 @@ l 0/H00 0%p00 000 0[00 0 00 0kJ1 @@ T 0\H1 @@  010 02\10 0/1 @@  0TZ!00 280 0D2\0 0l20 0e)2 @@V  02 @@H  03 0 0!v,3,0 0 l @!A*?B0CS Ϡ-S)!R#  S Q0 {+C 7G 03S S 0A.B B03200P1046nT kȠȠ+S 0+C{6F{7 +S0+C؁P/ /P 0S $0S 0S P? @4@P//A-0Pp8`P' , R( 0"0, 4000R40G@BT@! ~V @D8 w,0400Gp,0 4 00(  @(4/P8,0S0Q 400 @-P0 , R 0 \  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?000t?0$ R&4000  0`d>@0U 0PEd@T$0S`0  0@>`0U 0PEd@T$0S  &$   0   0c 0$ @R`t=`0Ut 0PEd@Tf8x<0U0 0PEd@T0S` @<000<0LQcD0*; <0\0T  0T :K0PEd 0@SAU 00P,P0p 0U@@ <`D 0S\ 0TS5`0`I 000PA00 0 0 00U0!19@@ 0S03R0 TRR  4,00`VSZ*p: 0 40 30 <Ѝ QSQ 0 C hP 0S  0  B0S 0~0`0`I00U 0PEd@T 0 B00 00 00R0!10S8 0S 0Vs p90q?0:00 0Dm 80B4 R,5@0 0000 D 00R1P! BD A   B S000D0S808 UR000 0 pP <`@@ p0$(pS   0 *P<`@@;,TU 0PEd@00 S  Sa@D S700@T6c0PEd@TUL\70Q H0 @S0 0CR**+R~ T70i?070  Q 0SU 0PEd@T 0S 60w?0X70U 0PEd@T:0D 10*D0 6a@Ddh0lZX0 #P$U 0PEd@ 0S\6c@D0l0Z$l6 R` ?0S50E?0<60UDZL U01Z!Zl 0 PE C0 p 00D0 0CD00i`l Qv4T UN 0PEd@00Rl @Da0_ T 0 $ R40,0000 7,400U'  PEd@T   !R H40d0040U 0PEd@ T: ,H06l0*H0; @D 0;  0$ R# D  $ R# D $ R$# 0+R D U1!Z $Q ^ LQ0Q 0 B0 !!0  0D PE B pD R000 R=0X U 0PEd@T20F?o20Y$0S 0   h"L2$&$B0#22cR0S 2000l20D10PG6c@D;D10 Rq 0 B D  0h10)@`Ud 0PEd@T$0D`S`  0 H@+`kUK G $0S  $P (D0 S2D57ZU0  0 $ 7$ ZPEp(0? 00??|{{6?7?8?=?>?N?P?5?txJ?PM?uH?A?L?`srq4qDp:?;?$ <Ê 1(00^x(,$ 0PEd< 0@QrU( Y T200aS@D L D0B @2&8#Z 20002093 HL0:P6c@D;D t 30 ^ `300DSt30 @`30x00`3030)6c0D@C c PAl090r0\ln^PEd@^U,( 粠*@D6`'R d 0 Q0l0S>0p0T0P00X0?0X00 p0tP 400 @z 50>040f8 0p0P0X 0㽯X0tp0 (0$$(0P/ 80O?080ʁ80}?080 0cSR: 3@ 0@l0&09@0B(d p T  \ \  h P 90V?090b@ `0S909+p@-@PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S    0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /X#X3 C- M0P000@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 2#\p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R*0Q  R*0Q  R:0l00p0C0l0pSp)x 000 0P,04H0p0 p0 0 0 30 Ѝl0Sppl0 @@@ *,S???DP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pXpWa 0`(!P3/@P^ x!8pW8 (0 ( 03/pPK 8 20!.P S>0R *p  BS>00p00 88p@oRS B P T W B T p 0Bpp8 p P S>0R*pS. 0A pp oR$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-M@ @㬰P X 0C00$P $`0p sRpW0- p p0 Ѝ0` Q`V00pJ\S0b608#8P0X 00C∀ R"P @X\!\ 0!01 00"T Tb T 00,0(00040 0 B80 0 0$ 0PU?PU@PUAP0UAPR@oPP 0CX20;(8ӗ1Ӆ1&=tPxl0PfPEN N0NxtPAPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPPh`l \0S8 B0l0\000Sm tP `H0P` R P lp"p  G R lp` h0S:l R1#P0 6SF \0P8 Bl0\00PЍl08  :R&ƃP&ƃP&Ɠ) )hP\0P8 Bl0\0~00SЍO-tdt`,M Pt \l 80H00XT0#D04@@QH0  ,0BA?C0CP`PƙYp00B8#( ƙ#<0ƙ3@0 B0(1I>RX30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80XpT`tR` l H 07#0H0Xl \0P8 B l0\000S,Ѝ806&6!Ɖ909t6l L Qtl \e /t0 S` R S; SY`l r (l `m 00400D @$H0 A   @`@ Pl @!0 PPH0P  `  @P$ll R1#\ Q \P80 B0 l0\0l0P,Ѝ\P80 B0 }l0\0Y00S,Ѝ`O-@ ,0K[!`QM00o0AHP0 BR U   s 0w 0 0B 0 %B  0B 0 #40BV \0U8`1 \ 0 0 00PE0C0000\ UW0%&* Q!A2:\ l` p`F RP!P1UP! U:Rpp   W 0 B0 0 ` PV , 8RK0A6,0l0 &\0` PVpl0&R65W06( `&  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\000S8#  #800#"0 B0 0 0 0 0 S0 S 00R01 00 q00 R000 060&*W6B &R \ R80l0 C< 0 B 0=L0DCP0C Pt0*SVzl0\06Y0Syv\0l S8  B0k l0\0G00S20^\ R80l0 CG-`=pPVqP@D Q00V0SK0儐S< (0s T Y 1@0@!A00000 |0`[p* 0S,t l00\ R&6S S L D 0 B ᲐCȖ060@D0 0!1 0Rpppop@-@PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV0P0pPO- Mp`80S04< 08Q1S00PP 0 0S $0Sw wpVnV`F0HSw0FSRs WqZo[FoᩒYhV 0!( `3/@Pm ! 0*1@PXL@TA 0`, `4(P6/ `, 8(6/ `L @(6/0j 0 D(Ė3/68 R! ( @ R% D PR! 00C60p删$0 ЍOv `fp00$0` (0y Ѝ8  40 000" -M 0 0 =ЍA-PpUpWm8 `! 0(3/@P` !^!@ 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/08P8 @ R5 D SR1 Z&8{6@S@, sL DD n 00C e6&^&-> 0$+0;l0ƕ 0CS /O-@QM R0p  0S " !,"pDP` p@00 + p % *0 @p'0 @$000Q  B1;`,:)7(463041 R P%BQ` p@!0A " Q"$, !!   R!,  " " Q"$,     R ! P%%   R,!@S4T@ RPR aR,d&P%PN&, QR,T% R%, QR,T% R%, QR,T% ^%,  C @0S |0 " !S," ЍL ""pR1C2Pv#P$h @-PQ(0' p@p``P 011   0" C  P0` @-PQ(0' p@p``P 011   0" C  P0`$ 0@-R0@@0 #4060C0 0k6 &S0 k6ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @O-@ 00 0p0 1Z \Q ⵟ 0100W0 X.0[ A  װ& 0А#"^& 6 2#60 SZ+ ೞ0JYJ Q LG⋰@ 0p@Q0C Y> 0@N0A0 \0000C0/ LQ @00^ P0 00U00S@ T R 000 R0@ T<ЍW@  xyQ / !02@X1Z Gೠ6;#6pQ^p N00=C-@TppR!ಐN0+m^\hT( Y!. Q A^0 pR% \LANpR 9 ^0@ Tp9  \ʰ Q ^0 Rp^0@ Q ^0 pQ^0 p^0@ Tp@@  @O-MⲰ[00Rv!+z   k@T`[0 Y ANP@>d8Y#8WD@ 000 #4060cUS8#8 P >b8Y#8 000#406 B 0cUS8#8@DHR$H&"0("(P P  0#4PP0&0bTC8 B#8V0&7 V0Q PV  ANk`P弦P0ᾐ:`i8Z#8`I 0 00#4 0编0iUS8 #8 R0἖P`U0S P U`0^ `0 V \0ʀP` TH P尐P eY*P0帠PE0#406P0cY ) UV BU@X%Xk>PP@P.V@nR$ N D0Qi PU ` k Pᶐ>i8Z#8I0 00#4 060cUS8#8 ^S B@P.k>@P.V@nR$ N 0Q$ PV(0S `0 _28 #8 P `0^0  U4 `P 0SЍ@@DH$Hk>PV㸐V @DH$H>k.V0v `0 %0S `0 0S `0 ^ U P   @ Mʀ6O-SM 4004`003k^0 0300300 !A 9@b8 T#8@p000@p#406 B 0c^&6S6 @ 编0`$0 pḀ9n8 Z#8 0N 00#4 060cX8#8qX tq@DH$H>phW8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಀph>Y8#8H000#4060cWs8#8 p0@sWz `D B("(>@g8T#8?@000@#406pGp0cR#6 Sv\kN&02Pa8R#8  P`0`00 @#4PP0&A0b^8 #8k0&Ѝ 0&0p0v, 8( 0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&&)0S0 0xS0 0LSI00&&&&HʀA-Pk@8` R   pp "$ &bS1 B k>&0  8#̠   4##<V0 0 S000*60@-S S00k@@6 0C60k>@@@!PPƂ00@-k6 # S("(00@P P 0 #4@@06 c\  ( 0C"(k΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@@ @"$PP Ɓ0O-0 QR M@Y, R 0(p&]"P+|(+y0N  q/ ! RF@P j   Q& R \3 "[$k 0("( Z:38#80 00#40缦0jR#8 J#8+ ZB!(:ἦ 8#8kΆ000#4 0缦0jQ8 J#8 ! Z:ἦ8#8kΆ000#4 0缦0jQ38 J#8@! Z:ἦ8#8kΆ000#4 0缦0jQ J!PMk>⼦ / ! Z! ! 缦jR! J!^ἦ 1 . Mx  \ P+R +R ,RE R  Q ,Q3 "[R&k R0i 2 8#8000 #40&0bP8 B#8pk0&N.V G.0 0R0 0xS0  0LSI>X&&&& Ѝ R3 "&][Pj 0 ЍOb 8#8#8#8!88#8!28 #8t  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  0S A-P 0@ Cp`BVUV `%P 8%/@- M`@p)PP P倶   B `p u+ @P  Ѝ躼 0@0 Ѝ購0@0ꮼ@\+T  Ѝp@-P(@P @P00p蚼 00p@-@(0P 0@00芼 00凼p@-MP`(@P P @, 00Bp "+PЍplP+U fPЍp0A-S ` 0@ Cp3PUBUO 0 A%0PP$yara0A-S ` 0@ CpP1BU+ 0 %0PPw$tcid0S A- p@0 CP` BV `/0S A- `@0 CpPAU $,0PP>$/yara0S A- `@0 CpPAU $,0PPŻ$/tcid0@- M@ Ap  P Ѝ0謻 Ѝ0註0 0 Ѝ00@- M@ Ap D  P Ѝ0蒻 Ѝ0莻0 0 Ѝ0yara0@- M@ Ap D  P Ѝ0w Ѝ0s0 0 Ѝ0tcid- M Ѝ- M Ѝtcidp@-@PQ$0PPptcidp@-@PE$$0P p00ploobp@-P`@PP  DP#p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@/ @-@@L @-@@e @-@@~ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@@@-@@3@-@}@J@-@w@a@-@q@yp@-P` @PP  P#pp@-P`p @PP  P"pp@-P`^ @PP  P"pp@-P`L @PP  P"pp@-P`0P8 @PP  pP"pp@-P`& @PP  ^P"pp@-P` @PP  LP"pp@-P` @PP  :P"pp@-P` @PP  (Pp"pp@-P`0P @PP  P\"pp@-P` @PP  PJ"pp@-P` @PP  P8"pp@-P` @PP  P&"pp@-P` @PP  P"pp@-P`0P @PP  P"pp@-P` @PP  P!pp@-P`t @PP  P!pp@-P`b @PP  P!pp@-P`P @PP  pP!pp@-P`0P< @PP  \P!pp@-P@;"(0P p*0P 0pgntsp@-P`@PP  9P!pp@-P`@PP  (Pp!pp@-`P@"<P pP U patadp@-P`@PP  PF!pp@-P`@PP  P4!pA-P@!X0P p(%`P  P `m'gntsp@-Pm@!(0P p0P 0pgntsp@-P`*@PP  P pp@-P`@PP  P pp@-@RP P pp@-@Po!$0P p00ploobp@-P`@PP  P pp@-P@PP P p@-@@ @-@@ @-@@ @-@|@ @-@v@; @-@p@J @-@j@g @-@d@ @-@^@ @-@X@ @-@R@ @-@L@ @-@F@ @-@@@ @-@:@# @-@4@6 @-@.@N @-@(@e @-@"@| @-@@ p@-P`@PP  2P p0p@-P@PP dP pp@-P`z@PP  Pp0p@-Ph@PP APpp@-P`W@PP  Pp0p@-PE@PP Ppp@-P`4@PP  Pp0p@-P"@PP Ppp@-P`0P@PP  Ppp@-P0P@PP P}pp@-P`@PP  Pkp0p@-P@PP PZpp@-P`@PP  ]PHp0p@-P@PP P7pp@-P`@PP  :P%p0p@-P@PP lPpp@-P`@PP  Pp0p@-Pp@PP IPpp@-P`0P]@PP  Ppp@-P0PJ@PP #Ppp@-P`Q@PP  Pp p@-P?@PP Ppp@-P`.@PP  Pp p@-P@PP Ppp@-P` @PP  Psp p@-P@PP Pbpp@-P`@PP  ePPp p@-P@PP P?pp@-P`0P@PP  @P+pp@-P0P@PP qPpp@-P`@PP  Pp p@-P@PP NPpp@-P`|@PP  Pp p@-Pj@PP +Ppp@-P`Y@PP  Pp p@-PG@PP Ppp@-P`6@PP  Pp p@-P$@PP Ppp@-P`0P@PP  Pypp@-P0P@PP Pgpp@-PN@(0P p0P 0pgntsp@-P`{@PP  YPDpp@-Pk@PP P5pp@-P`a@PP  9P$pp@-PQ@PP mPpp@-`P@<P pP U patadp@-P`K@PP  Ppp@-P`Z@PP  Ppp@-P '@PP  Ppp@-P 7@PP PpA-P@NX0P 2p `P  IP `"gntsp@-P@0(0P p0P 0pgntsp@-P`@PP  Pvpp@-P@PP Pgpp@-P`@PP  kPVpp@-P@PP PGpp@-@QP P=pp@-@RP HP3pp@-@0 P |"z"p@PP!0S !p;!0<@- @@!8lP 0R @-P Q Ȯo//T H P ᴮt0, @-HL @-P Q @袮0ft0 H;g0 H4 0S p@- X@`@@PJPpP p@ (A-P`p(" @P  }P` pp8!P` p/!U @!&!!!p@-P @`Pp:P p@0@- S@P $ 80 0 0 |A-pP @@P  %0 0 0 ᄬP/`P  ͱ` P((0 H⏰@0$ /@-@P e@ k0E/Hx }-A-M `V $P0 P:@PpP  0P~: EЍAЍ/ЍAЍ/>Q/HI U 00 @-@P @ $0E/H1 }p@-@P x0 0 0R0 P0P Q " p@pp$ p@-@P `0 0 0R P0P Q " p@p P/0 0 0R /P/<0 0 0R0/P/// 0P p@-  o QP  QQ w"/ P/ 0 0 0R/@-@P \0 0 0R   0P Q N"00 P/00 0 0RP///d A-PPM 00 0/o"P R Ѝ R0 0 p`P 0 S  R L  Y/o9 P`    00 A-@PM 0 0 0R ЍQP 0  0p`P 0S `  Y/P79 pP` (00 [?-H ; P H0-0 0/o"^ R  Ru/(P/D0 0 0R /@-P )o  P/D0 0 0R /@-P op  P p00 0/o"\ R RP Q  Q /  fP 40 0 0RP ګ׫/  f(0A-SM`.P@U Ѝ0 PP pP 00 0P+ S(P0S0"Q00+ @P \ 0 0 0 @Ѝ, gP \ | P 00#0 0 P 0S S R/P/ R0/  @-@3dX-0p@-S(M/ {@! S   P{  8` `P ,P 2(ЍpX  (ЍpD P { 7$0\ xⰭ   t P $@-@V@-$@@R  00 S 0 P :\03#/S 0 P \0///A-P`` @P (pP  @P ~QW@r$$0 x)4 M 00 S 0 P :\03#/S 0 P \0///0@-M @P  @ Ѝ00@-M @P  @ |Ѝ00@-M @P  @ nЍ00@-M @P  @ `Ѝ0@-@P ,0 0 0R? /P/0 0 0R / 00 !S R!* R0*/ - ^0 : 0P0*  R*/@@/ / P $0 0 0R //P $0 0 0R //dP $0 0 0R //,P $0 0 0R //P/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/@P/x0 0 0R / 00 !R0* / - ^ :P/x0 0 0R / 00 !R0* / - ^ :8P/@0 0 0R / 0 0 S /P/x0 0 0R / 00 !R0* / - ^ :XP/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/PP/x0 0 0R / 00 !R0* / - ^ :P/@0 0 0R / 0 0 S /HP/`0 0 0R / 00 ! R0* /  \ 5*/P/`0 0 0R / 00 !R0* / \ 1*/P/d0 0 0R / 00 !S/ / P %:/ P/d0 0 0R / 00 !S/ / P %:/P/P0 0 0R / 00 R/! /P/d0 0 0R / 00 !S/ / P %:/P/`0 0 0R / 00 ! R0* /  \ 5*/@P/`0 0 0R / 00 !R0* / \ 1*/P/d0 0 0R / 00 !S/ / P %:/XP/P0 0 0R / 00 R/! / P H0-0 0/o"^ R  Rz/|P/L \ /  JQ\/ P/L \ /  JQ\/P/P \ / Q/S/Q\/`P/P \ / Q/S/Q\/C-M0PP0p00 00 pS Ѝ(@Y` +0B( 0R0xSH  0Ps&*0 00 0S  P Ѝe 0Ps:Y0"ST0"SP aqp 0 00 P > 90"S O-MM(@PzH100 p0$`0(0 00[ Q`$ 0 `;/0 `P Mߍ ᇇP0 3/P 00 $ 0 :/P 000 dPMߍ\ d0p@-PP0:A@L7LT#H0a`L8 0L0WL8V @#88#8P0p ^pO-KM3 `0 0R@ @@@$@@@(@0 0C0S5 0fSQ ="SE [Sl2 0 @3/P 0p0 0 ̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RP0/S7 0(00>S: SA 0S p03  0B0SR 0 S S5 S3 .S 0 S S+/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 8 S =SB0"SQ0SN   0"R "R RAC$ >R<0 G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R@" tRT Ѝ mR8 pR oR sR ;R@' tR ;R@>P P"Pn \P@ V   WP UP PS00S@Ѝ pR ;R@  uR[R<\ BR  ;R@<{  @d0 8!"R /R  0mP 0 +("( R:Y Y +     SP,0 Rg \Rd  uR` > PZ +  PU6I0     0 # <  P,!*-"-  ƠP  *  (  ""0 . ".  8  ŸO- M @ 0D0S<^QQ@Q  0>S 0 T @P (0SP  R @ ЍT" T& @҃P0 S00qP @P T eP0S  0S HG-P-MH`v@PL ,+pC +-pF 0F fppSp>C0 PP +u&  0 p `,Ѝ00`0 p``,x`Ѝ q+o`Ao/A-PP (P`p @@PT@@@P p40,p0P4080<0  @-p@ |@-$@@u \ᘡ┡@-@@O-4@T ,p` ၡP @D¤@@`T P礀Qㅑ8080 0 PZ PZ Pܺ  @-R 0P< P 4Q ,  4)`0 00 0٣,  p@-M@4 00R1SP,0S@R 1`V, P` 0 0:P 40, 0C40P" ;`ЍpS" RdЍpЍphZ<.0╣PPj?.0⎣<co?.0⇣$$N?.0‣ yȸ iA-P`,p@P W 0 !ឤ,@0`H,@0`C-`0SM@PpH  P. 00Ѝ! .0P ,0SW ! v/0P ,0S(0S00 0cP 0S?0S0"SZ0:S Q0}S "S000"S vWP  QP \ @@ 0fP $$w?{/0آ먷 x , 0p@-S T  Q @PPp`0!.0ⷢ, 0S ,0 00?%.@-0⥢D 4 @-R , B04 P @ 00'>/0⎢o?/0⇢ ȴ 80O-M@ Ѝ@Pp4 B`P @ p @%Ѝ娒 y `P0 004QY  4 ,R\ 牱Q1v  蝟 P 0YIV  B B!r,0 ` 04 p<0 04 <0 a`,VM<V7V+Y& xx@ ` E ƛ`P( ~ =0,S<SS8 uPw @<0 0`p4 <0y<p! ,0` Y`  |,\\0\02.0ġLW?/0⽡4?/0ⶡH@p 2 p@-@PPg0S D  Q<0  0p@X`0/0② p@-@P 0`0V.PP h h0 0  0@S<0  0pPp `0/0f  00-PY 10Z/ @0R+ P$ [] P 08P 0S P( Hqp4` ЍO Q P 0  03/P  40R1# P P6>/0Ӡq 00C 0 P l`/@yTT?/0⼠@+? 0ⴠ<l     \@-@T0,S<SSz?/0␠ظ PG-V pP0`WSW@6 404 S @ 8 6S3 E000,0 100,0$ 100,0, P   @ ?o2\0S0S P@P :  404 SS@  @<<-B> 0)$$-F> 0!dT !4 7G-PS @- Y`' T 0p 0R   004 00R$ uP 0S 0 GXXG>I.00&0,S <2.0ҟ84 1 GFG-PP' 0 0R"p49`P 4 R @,0儡ᄑ1 / - ,04 儑@ 0T:80804 a`0P 0  Q@-P80080/Xp@-P@E80080p@>p@-@P 80 0R@ pP04@-pp@-@P \0 0R@ p`P00S@#:p@p@-P@@pA-PP 0 0R4p`40S @40@S ,0 P `A-@P 0`0VpP0S P @T <+? 0@@H A-`P 0P0/o"Q@@T @0R p @P @T @+? 0 0P T@- ^ 400\@+/<2.0⦞D 0P @-op@ T\ @\400\@/<2.0⁞p @-PP M 81 0R Ѝ`@/80  Ѝ@( 6P 4 0R S *,\$0 B!p@咆400C40<00<0``K.'> 0;HHK.M> 0300N>K.0 0* u| v\ w0P/4  ?o2\0S/0@ S/x0P D- ?o2 ^0S 0 S /0P/0 0@0R/P/0 0@0R/ P H0-0@0/o"^ R  Rk / 0S /A-`@P=pP (0Sp G 0P  pAO8`  `O-0S@9 0@S7  ` P. X6qPp@ P  P  P HXPU0UU !B< #1 0@?,B PO 0s0L dUX% X0@#r 1`P 00C 0P  I@t `G sL?).tʗh(?).tXd 0 X 40S 0C40/ =/@-t⬗ 0p@-S P  Q @P^PYp00/.t⑗p ip@-@P |0`0VPA0S R <0  0p@4,0,0/tn00/th  wG-S p)W@ `V 0P 0R 00 |` V 0S  G883>/t.s0,S4 @?A-PP 0 0R42pP 40S @,0a, 40a@T:8 8 40pH@-P80080p@-@P 80 0R@ pP0@p茯p@-@P 80 0R@ pP4@p<p@-@P \0 0R@ p`Pz00S@#:tp@p@-P@gI@bpp@-P@[80080p@Tp@-P@O8@@@Jpp@-@P x0 0R`P<40S ,0AT 3p@p@n?/te aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@l@44?/t+ ?/t$L  p@-@P H0 0R@ p`PE@pDA-PP0 0R`@4P%80,0!qW# P P ,0P < 0@ 40< A`A4?;.t˕n?;.tĕ h 0P D- ?o2 ^0S 0 SG/̪0S /p@-`P@P (0S p p@   0 //@-SP0p0 u O-IMP  @T p `0 R 2/0 SX P X @ 8/@0 pPP @TL0P D003/X@ 8/Z RZ Z X" 000 R 2/0 R# P/0S% 03/P& Z :/ RXL0p d0P Iߍd0p h0p Z :/[ 0 03/(0p ܔ8 8  ܉ P0/O-MM(p@ ET 000 000R+`P$  T%0 `aP4  0@ 4/@P`P@003/0 @FPMߍT00 0P $ 0R000 Mߍ((0 l R00؇ # 0/0/@-@@9A-pPM`P1 @T. /0@0W  WN 0/RA 0CW /RW  W0 0/Q B H!0C@T@!  X@0 0.0 0 0 S* Fep@  U 8P0@1Pۍ,?00@ۍ S0p CPAD p p P@|  p@-R 0@S PR:   Pp0P  , 0T90( Dⳓ<:p0( D⬓$;0( D⥓p ̅ p@-@Q PPpQp0C-S M~@; rbp`PAQ <Q$ >Q &Q ĐQ P ЍP Q Ѝ輐&Q P괐&Q xPPU a/U`U"0E'S0rP\bP ]P PU /U\U fPnPtPbPUt 0 O/ K PQQ 8P(0F/D< 8 4  P 0S p@-P@ Pp 0@Sp/p@-@QP Q  PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@0Q/D◒딁 #0p@-S+@PPU Q PpQp<Pp/P PQ P Q>p@Q0Y/D^밀 0p@-SG@`PU Q Q rP<mPp PU Q aP QPU Q TP QpPQ GP Q/?P >p@90-D ` cA-PP` 0Q ppXpW`V@PR  PK <V`p p0 8/PP`<`nQ P P 0S 0P P PPT T /P P 0 P~ ,} ܚp@-P@PP w 9P`n뼓`p {z011/A-\@`pP \1S 0 €  P 1P1 `p P 0,0A0 4TB`0 4M~ ~ @-@^ P ^%QRS  T00NQRS"  TŒ 00Z0 4} G-@R0(M0QP P 0 ` p Pt p `T0?o20S00(Ѝp`0 ~ p@- M`P@000 00 0 0     SЍp0@- M0P@ ޑ ّ000      S Ѝ0 0p@-Pb"!4Mb4# `@0弑 4 40ᴑ 4 40ᬑ 0     SЍp0@- M0P@ᕑ l,0p.l ኑ 4!40⃑0$!$       P Ѝ0p@-@P(MP`/ 0S, R00$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 FV P0V00(Ѝp@ R 0S V00z @- @ېT00@-@p00T0!0"0#T@-@T @-@T000 000S/@-̑t000 000S/@-㼑訣t000 000S/@-㬑ht000 000S/@-㜑(t000 000S/@-㌑t000 000S/@-|訢t000 000S/@-lht000 000S/@-\(t000 000S/@-Lt000 000S/@-<訡t @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^ \#4srr001/Xr001/8r0 01 /r0S@-@1/00/T0T0p@-@ P`\ tPppȐt/000 000S-/@-㶐-萟t@-000 000S/@-㣐DtAo//p0@-@ MP 0 P Ѝ00;0 ⬎vtt p@-@M H P pЍ 0;0 Ⓨwt@t p0@-P M@ T T T  0 Ѝ00 @ Ѝ00:0 nt0t p@-@ $@ 080 \^t $t p@-@PP (P$Pp070 Kt p@-@PP (Pp070 < t p@-@PP $Pp070 -(t @-@P  Y.<+ < 00;0 t @-@P (070 (t @-@P $070 $t R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@. P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pᴈ8000 0@0 !0#2 /UUUU3333  |lp@-PQ@t : Sj H Sd a Sp  S?c r0-0!-w- R00E ?Rx  -  d r - w- Q  8 'Qx-1r-@w- T% Tt0 T-x   p Ss  Sw S?lQ s! R0s  S  0TS S?bAa-090 i$n O-P,A@:  pP? >P?  opP% 00!` 0@T% dP0=S AP` AT BX!  <0>0  00耕4m `2C-0@TM PD@0H LP@h X`P ㈐@@@@@ލpk pp ׍p` n{ P  {j{{cp[ X0p 0S00R4@8@<@@00000+0++0+럄@1@000@0  00ᬄ+X  "괍0S lp@ ㍍ ㉍  Ѝ oЍ @ꑍ0 0 p j f,m l O-PMp 0GW"S00` 0w@-P-TPh +T@`0? ǿ 0 q 0 q P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP P"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`000S   Ѝ p圀圐 p XR A B0A PR `@P0?0 ŊUWp psW ꙙ h 00M 00Ѝ63O-PMp 0GW"S00` 0w@aP-TPh +T@`0? ǿ 0 q 0 q P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP RP"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`"000S   Ѝ p圀圐 p XR A B0A PR `@P0?0 $UWp psW ꙙLe 00M 00Ѝ6ꐋ3O-M8@t P T0  `suL P T0  `hjb 4b 0a a ` d` <` ` _ @-M"{ @|d{ @0S H @0 0 |0 30Ѝ  @/P_ -M{(, {Ѝ 0 0 9/'mNA00/l'G-@SP+ pE`J0Q" 0Q JNXP0 S0C0 P Y 000 ه^ O-QI,M 0@pO Ra 0S 9 009 P0S009`0S |) l)l  `)`   @~PT0+0CP I @p  q 0| 0  0C 0B00 S00Q? 0X00-SQT0w~P0-S0 !000 ,Ѝ(8(H(0@00q p7 0  ,Ѝ01 0 B0C0@崧 :Q 5 0+ B Ray0 P( WY :R 0S00087@0| | -Q000 $  6 0R&0 0 `=1yPt A 0Z @P @p` P@T Pዂ2 PN v `  Q Q 0@RTZ@Phv 0 Z Q! 500S 0:S  0Sp5 00+ C :S:P ? ,Ѝ0JS0 SP0 S,Ѝ@P2TPX `0 tW 0S 0 jTPX` H0 ` 0S dH0 V,400S 0:S ( 3 0 h0X ;q;R0S00%X03 00S 0:S h3W 0 0+ C}0{ 0S /0:S  X 010300 0 0S000200S 0:S H20LQ 0N00P200S 0:S hR.Z; 01 S0$0001100S 0:S I00C 00!S 00 00+ C H0 ᡅ 0Sth0 ᙅ|10 Ⓟ4 h08卅0 ህ88!0 00S 0:S 000+ CR@@q 0  10R|h0 [<D@(%] ] %%|%\ |$$L$$#0[ (#Y XY _X X HX X aW ,W 0V lV V xU ,U 0O-pQ ` V 20 R" P@T6帢 0 R01-[@P-T@PC T"hRPP :wPA -@3w0P  :R9 $2 0 0S " 000PP@:T0S! 000100S 0:S 1d 0?@0Sp1 0 0@TQ 0:S  X 4 $1$Q0:RP@P 0S 0 0P00P0 0 R0 ⅄VWST0 |OQl0l 0 x|M@MpT L(S S (S 4KR pR R TR @-@P  @T0/0 LdR @-@P @Z 0/0 =@P\R @-@-Q" Q Q S2r0!# 0Q! SL^" 0r0!#   ^00<H0 ǃ$00 T00|Q `Q G-P @p0#03w0q0W`@DT@! ׄ 0 0R ! 0 P   Gw0 @pQP@-p Mp @`&P PP% ,{0 @p{`0 @P  Ѝ莅00@ Ѝ臅p53@倅p}@+Px@0 0 X#q($$0 -0 X+#q(p@-@PP` /o"0 p@hI040 F O @-@P 0 @WI0A0< 5N p@-@PP /o";p@ CI060 !N @-@PM 0 0TPЍ000  N 0 p@-@PP U x00QUPQxp x00QUPx00Q0/0 ߂,N 1-R@ !0/A-pR P@a@T T 1 !03/pWG /p@-@PhT 0p@/pA-`Qp@P RJ~P0D00 00㼀p$`,@(P0R00A-P`p@PE 0U0" V W0 p`Pp`P~P/ 0 0 00㼀@D $P,`(p0W pPpPV W |p|`p`lPP```T`TP`PD00\\p@-@PMP% U 0`1S ,0S #$0S  pЍp4<80 0;0 K J @-@P 0S# w0 P @0P 0 000 01 1 00w,0<0 ԁӃ 0 xJ p@-@PP# U 0`1S ,0S ⿂$0S ⸂yHqpp4980 ⥁080 ➁I I p@-@P w00CS00 Pwp;P070 }I --M  mGЍ Ѝ/ -- M0 0F ЍЍ/0P0@-$M R} P @0S'  S%}0040   B! $Ѝ00|P0 000 @ P S0S$   I H H H P 8000S(/00// 4H H ŸG-PLR 8MSQU4`p1 Y\ U8   Q Q  2 m |V @P  m .@|PV$!1 0 40 30=8Ѝ@@(4P0 ὀY) @@P PU }P 0  0 | 2  R| @Pd@P@XX0( 4⒀X0 ㌀=(h(W8gG DV0G G F F - M ЍA-Pp!p1 0!M`P@0<80J 04p0040 ,1p僃@P !1 0 <8 309!ݍ0   @0@p ;PP@T Cn`0 P8TVP^}P @T@,0,0 'e`eH LH !1 A-@P0!M`0<80e Q P00 4 1 PA4pt1 p0P5P  0$0(0,0000@ 0ppҍPP"@T Cn`0 P8TP|P @T@0S  T啍| d0 0 <8 30!ݍT00儍D<0<0D J'4d8pG F b|7h7HF O-@$FM`4 M 0PQ␤t嘄0d40 T V Z XX ( 0K0d ;0P0S 0K PW  0 P(00~eP $ Py Pt$Wk ,Pk(,aeP a$W ,  ` $#3 0 d4 30Fލ Ѝ|0BP3ؒ M;|P6|Pj / P@@W  QRC0Sl SJ\"0 0W?Y/@'74 Z 0 INPB0 ~TE0 ~V>0 ~Z7x_0 ~/\! 0W/60/$0S㈀! 0 -P6 0 0W?.@6 JHB&pE; b`4D D C C \C 06 000@p6@0P}?`@p, 0 Gp! / 1Pj0~00S# z0=SPX PUPVPU uc`@Pg0#S< v<@T< @00C@0R뀀 0000 00 ,5gP%A00@0 0 00 4SP 4 3n,0$z-j00$z'j40S@00C@0  0D0p@ 8t@`xPp0/x kx0Y056X`@~X0 0 yPڶ6 J‰ Y400Sg Se @zx :$@sx 3(@lx , FPD R3<)"2 0 4 30ݍ Ѝ0@~rx""0 <  T 40D@0 D0 S   P @`V 40<  0000D  PP PἜ P|*l0. F|P0. >|$0S,0. 4||i?. ,|80Sl0. "|d!~0S %#80@`xb)#([[T> D> @> \= (h< ; V(: 9 9 9 8 8 8 p8 D8 8 7 G-`!p1 0PMPPpt@0L00F VM WT X[ 8D#@-@PM 0d  0\00 08 @YЍ030 Nv,& % @-@P(M" $0 0 0 0 p0 =<P 04P  8< $0(Ѝ BX0d v% 0% p@-`P0M@P! T( U. ,0 0(0 0$00 0 P<P$! 0" 00Ѝpx0 uTX00 uU<0 uw 0 $ d$ @$ $ "2 O-P0TM`0L00s Vj  0 0 A000@080 0 0PPP @ pR0 p@P< 0+S+0S((P,00$00(0 P 0$f,$.,0S)/ 0 0 L0 30%TЍ0 KP SPq/Yw00L0Y0 Nu4X0 Fu$;# @# 9! ! !1 O-IM0p010pWX KPPO l@ `0 `@P; 0+S+0S(ZP   0 P   0S / 0 0 1 30Iߍ P rP.v00,00.t8`! @! 7 0/` 0 0@-PP0M@000' T  ᲌0MP ""44  0S0 0h \0 0 0 30Ѝ0!@P(040 t:6 p6 ! 1 @-FM0 M@Pp0d40. ` PPd@!$+ P `v@\v R@` T0 0 d4 30 Fލ Ѝ,NH0X ?t5@5 @-P 0 0dMpP`0\00 @̋ ]P H0 0 \0 30 dЍ(hd0p t4t4, 88@-M8@8@ a0 Ѝ\\ ,0`( "4`3Z1S // 0 0@-@P0MP000' U  0 @  ""@@ 0S0(0h \0 0 0 30Ѝ0)PP(0F0 s\3 2( G-p!@1M 0砐 040 U$eR)PF0Q W0Cp +@P1  ZPUo0 ;u0 U@ @P  GU0PUo0bu@^u@  s 0 0 4 30܍NuPJuTP  0kQXp xP|`p2T1- M0 Ѝ@-P 0 0dMpP`0\00    )P H0 0 \0 30 dЍ(T0` r|0,0t /?O- M0@Q000 0S @ TsTX a! pP.b"? a. *b i!*DPP\@]!  "P dX$%T\dT%``.lČfH&bȌ̌$DLfD$Li.`  i,-a.d`ia` hh(&d@plhphd&%gX'%T\gT%$l͌hx(b!aA"8'tp @|ht'aA$i) `&@(l"<`t`i(aa.%jh*M`&dlQ l jd&Px "lQ%P d  'ix)  l!!'t| it' "(] n(|d!. i)dd!"*hH($Di*LhD$ + e.  '0,k+.-ak.eq! `&p*eq'4͌epiX)b!} %Tl\iT%, ( ,(o&@$O$,`ba,`H@@@ba& g,`hH($D !LhD$,++ ,+0 ,+...$吠bj*. j."$ " (,+, $ , 4P%++H (" m_%_%` ,P gQ PO$O$gQ%f P $@gA , $@..@].apf!O͌@f.e! OfA O@lea,`?ea&e1ꯠP* )!P@,`(o)_(0P(P **P!!! n,*pyM !`nQ 0 P%P =d  ]n,c1d#!.... 4 0 $ ͌e# dq .O,p/$/"p/"  O$O$4 O$leq, @O@p'?p(aA,}e1@$n_@a1. P0#0_% ,, _%_% M_% g.$P_aQ)0_% !/!,_%_%_%(PX=dAg$_P*㝉cQ$魊i P%䗟 ៉gw Pc.p )O$  O$'O$(' wO$],@jA.cq@$@ ?'?#$ 0/# 0''坉?'eQ0jq%?0 p'p?j1i%诊_o%o&Mo&} . dA$`_%i1$0#_%` 0ദ_%PogQ$iaP%Po&,((=o&(no&o&g.o `(]O ca.午gA`&eQcq%`Op'@@ pmc1 /'/"./", ... 0 ' 'M'h%uf! h!f10/  Pd1f1d! 0]?h1 $`d `10f0.,,4..-. $(`e`e d@Ϡ0,`!! ,,4=,be bχM` cbc ePd,pcd b/p"++0/"/"/"`d( `! c?  #`!o!`$`?#?#`͌?#n`0n1 -0dlAnA0lO=`A`bAlAbOnA4`O.O$$@..@.cA pbAca`OlAϠ`,(@))@ ,,aAcA paqpOmbAp`A aA`! O}cA, fA0P`Af10OaA_!-_% 0_%4,P(P!!!$PgAfA0gO`A @O   ,= bgb돉fcbca`ꏉ g`acaqpP菉b /c!0O$0O$㟠?')?# )*0?#*)' m) P?'0`1' Pϋa1` 0P捈fa0忋`!&a "= - 地 h&⿋` !c1h#  l( ⿋ ⿠o+,PL o&o&_ꯂ$`` +o `b1# /yZnܼbl  0 0#+⯊, +/ < 뿉⟉h⏠ 0()d )O/ | (⟉ abb!! "= `!-!c1` `#P b1#0# 0a=bAb!!`! "! Q @-c1(O`A`# b1# 0# 0a=bpb!!`!!$@ " -`c1`#b1# 0# 0 abb!!( "L@= `!-!菄c1``# ͌8<@plDPbb!# "0L"0P2  0 0 30Ѝ20 Kn0S_X0 AnW@-@P LL 0DDD   00,d0t (n#EgܺvT2Ì G-PPp`6 W, 10.!00% "0 ?0%0?S @@h  o  0hS@H"p ` *0V@@p`F  Gn80 md0 m d t!t1 p@-PP0M@0 00@ TG  R00113 R0a `0~? S ` 0~? S U PE "001<3 R0x l0 0 0 30ЍpPP0 mT44d0 ~m/\ T   0 0@-@P0MP000' U  |0 @  ""DD 0S0(0h \0 0 0 30Ѝ0)PP(0F0 :m 4 G-p!M@1M 0砐 050(U,ePG0R W0DA +@P2  PUo0 ;u0 UB @P  U0PUo0n@n@  r 0 0 5 30 ܍ЍnPnTP  0dQyPp pP|`vo- M0  Ѝ@-P 0 0lMpP`0d00    &P H0 0 d0 30 lЍ(X0d l:\ {$0 k $0{0k/ܺvT2#EgO-0|M@@ 8om @/LPp8`pPp, p'+phkg| `<뺅Th,`&P !`l[kP@a lK+P%@$P 8@g[h[DHhKh )k!.h \ 隠fl j (nHla$j ,L͠kˌkd . @艠eg g*Pp` a n,+aTddKdi{ꨠfpf p' pl +@Hhkxe{ `e`&lP `K 4XnKn`!+\llˋlj[mikPiP% Pa$+ Pg\h[h) `ɠ`ˌ` d. +d` a at霠jjfn,* (X hgghpꨠddKl{ p'epl@ g}n{+n<@@ffK`k*`&i`pllk+lˎ`@dIeKej['hP% Pt+[`[` Dani+iˌ hd g&+lʠhˌ;h+ )Tkjf+% f+"j P i#M(a, ,$ a+n Hꬠge+   g+e( d dpX+)l hlpfd+ !kK*@ f+kK$nDp@ +` ik n+`&T`dL< eKj{(p Me+j{'ph$lkly`k{h+$ kˌh+"P! P`[*j+d'P%P jd,\i[ L8&a it.ˠhˌ g" n`lhg* %f ꬠDd`)b , db iaLఉ @.eKhg a@$l*@gl!KfK`dp)n{fp8` p'bpj `ze{bkj(MѼ`$ik$e`& `h\l`+!P l[`+" L(j+a[(Pja[%lnk Pनt'd [@`[n,h" `h.X \̠ iˌipab% & ag b+ h ` d M,ќf$d ! d뼠hhXeK.0H @MeK$ь @$ggI\pbKb; l+s "Mx |b-$pf+f{D`n+ ndn*hlj`eek`P nTk(X\芠Pnn[<0!`;0#M08$l;l@p"a{Ìp'MȌp̌ `$y`{`` pdk&`nČiȌkǩkˌj) HP#b[nČP%iȌdP̌ dˌh tZmČƌ͌3a[aˌ\@@ncK$ j @ jf,LKm3bKbt n$g.lɠ(hˌ,  h+i!< m$&-3 cc+X0n4e(8f<  0f;`+" D0舠m46g`=`30g;dk&`<0)n48i+p<p0Ti;l{'ࠔjekp00 en;#@ 0xt`{PP `a[%p PcpmnܼvmzNSaP<@nKi[%Pze\mb[ &cK vg@b.cK$D @lJiK`% hhi ,`!f+  hd "฀ac e$ ce)H+g+gtp0.l;zt0#imx`0v|d! p`{d(lpc00P``` 0 ``(`0PPP#P``p` 0``(`P P P @ \``lЍlЍ'2G 0H0 ct@B @- M PXpqp1p`@PP@@T 0Q P Ѝ A @XP @ Ѝ` XP"0S, -S?@0 0000 `  V RP +R@@D!0DS XP0S +S!@?@!@ D X ?P L0P00 1 R/@P/!R/ 0@>S 00 00//@-Mp @Ee``PW P0D>S 0!3100 0,eЍ>SH 0!31005e001e00h/-p@-MeP@U@0 ` ` P|0| 08 R;0Ѝp@Ѝ/0 a0, ,  l   XA-@PP`p= =U( X0ES  S0+0E0VP00V&2!0` 0`00+WP -W =W00V-00`00+0+0`00@@00(0]0 b00 < p@-PP@F 4a `0RuSpWS6X0CS0p à 0R Q PSPQPQ  0    P0 0+S -Sp0 b40D Nb I@ O-TM0wSp @@0 0P004080<0][ 0(0.d @('d@T$@7(`0p00000G@  @ 0a0GS00d00d@d@`TЍ+W = W0 -S0000 0P X B R = GS/o"!!   ( P:0,`c ,`c R(""@,`0 @(  ( 0S" (p W:,`cp ,>c0S"@(ppG,`p(pW 0[ 0I00X00p(ppW ,WpPxS(P Y0,`cP ,yc Rp"@(P0PE,`P(P   sP(=W +0GR?o20S# Y,`Wc P,Oc0SF(P"2PE,` @P(PU 0[ 0I00X00P0(P 0 U:,`3c P,+c0S"(P"2PE,` @P(P0X0 0%0() KR;%I?#I0!0 KR<I c $0@$00SPb0"SB  U*(@ T:,`b @,|b0S(@,0@D@`(@Ty -00+0"00 P0TЍ'pC  001]0 `1]0 `pꔱ1Esb00(0VpJ 0Xp+P-@ +B XR R  0+B -R +R XR 0 -R  X@PPQpP0]0 Z`~80o0P S`   l  0@-@PMP 0  P@jp`Ѝ00:0 -` P 0 @-`/o`/00/00/00/ 00// ///00/ // /A-@p`eR+PRU PU  0   P+@P PPr`P \000p@4000aP\ZaP $ 0p@-P@`T K@T0rS CPp p@;9P0+Spp@+0@-0P$M0200n 0Ss 0P 0N 1 00S$4Xp@2 P! IX0rSB | 00Pp!  \1 P @00S5$Ѝ00HP0T X@\4X'a@X0 00S  a@P"9 00Pp 0P$Ѝ0T 0 ^8@0 ^t4 h(  0@-P$M  0d 0Si 0P0@ 1 00S<Xp@& P 0rS:  00PlP! <1 P @00S-$Ѝ0O`0 00S@ IGE`@P 00P1l0P$Ѝ0P 0d o^4@0d g^xtLxD @-PPPA M@I D1p0S+41@T4 `0`S@' 0S[0V0, 0S%P:`0S  ?p  Ѝ50@T0S h+`00P$D  088l0x ^`td G-`PHMP6 0p0 0_p@  ,p@ HЍ ZP 0 Hp p@ ~HЍ_0S @X@0>0 ]@0P R@ O-P4M\p@Pw WmX0S0 `00 S 5/040 00!S5+0$0 00!WaW0] Y[ X00Ud5S`50 0 0 0 0@P0` (0`0r5`0D0$0XY 0S20`iW A, 0`XVW ,@P(05#[0tQ` 2P X $ 0 4%*&  # #.ğ BPU 3 2#0!/#1##* 0 # `V4Ѝ3+00 00!n|3/00 00!f`30$0H\.Ld0a#0L0|2pST @ P, ` !LX`P 0V ^ ,@Pw ^[X"$:600%$0<"%>4!!!0C$"0TAP%"$A0O#QX00 0 0$00?S%4 P! (`1T101! T$?01>! R01"_0A`(0l10X00`d(0@t0P`d(0 ) X  R.!AP5Q4 0A` X0A0PE$0 `0P 0  ;`1`190T d.\t8H0T d&\`T , GzGx Q)\(\ ( SQ O-PP M@`o Tu V| 8p0T:R P- Ÿ P2 1L PPm@pQ @T*RP P 1L P R 0Q[ SQ Ѝ\ P @ @0<0\; \ @ p R@p\ p W R:\#Yp 00 [T80 [VllD0 [zp,@ \?[*!]-  p@-@PP U p@wHHT0` V[U((h0` M[p@cH4  EG-P@U T\ Pp ppq W00"1aP: P] 0S\ 0 R 0C ` PP0 X= V  00S0 0 Q 0  ! 00S-*_oRe`VUP" U ! [xxt0 ZT\\0 ZDG0 Z\00Pl H ( C-P!1 M0 M@P`040$ Q? U5  00S0 0@ $03/!1 0 4 30<ۍ ЍQpp0 ZV U G0 Z0 wZtt0 oZX0 iZD40 aZ Cؽ E D` O-MMMp\&0X6 PL0 TDe040_ XB 0SI VP 㰰5\U\0U@@ R R 50B?o2 000RU$00S0E0 @f0S0000SgV 40F+0 G 0@ 03/[o 0@ 0000,00G(00 3/ P    0S00 * y 0.S Z~00S Wx:0S 0S , P80: S $ P (0JQ/030J1 1000 @P}000$0 000S  0P)80: S%V 00S 0  000S0 P@T  00S0v[4/P/ 0,0" $2 MލЍ  0.S0Sn 0.S}j0S  0@0L  2/0S0>  000.SQ ` %P J0 @P@ @h  2/0G(100+$000  `P0hh0C/Yr0[ R 0 wE0$0 X0S0 XV0 X0 X0$ /QRZ0/ 0 0@ 0 3/0{ 9E 6E0tj,*Ȼ L / | X 8 O-Pd#``3 KM0MPؔܤp040; WB VI YP \U /\@ 0@ \/\0 U'"2 0 4 30KލЍRZ/\3/00`/\U\% pD0G/SXW$$0G/JXV0G/AXY0G/8X@`p `hP 0   R  Q 0T/S 0: S+ S 0 0 0 0 `X# +00S0 0@ (03/0S0: ST/03010301:l R0|`|`0I/ WG 0 WY/0 0ᲰO(  m n oD SO-M$M %5 0P`P0004 UD @0~S<    pH 0S/S;RL 0B0 4ZS 0H*0 ;&P4S 00C PR- IR*00S;R# 0X @H p S   lll *S1 0@00S ?S! [S!^H QM00 S@000XS 0H , R @ 0<@Ⲑ 0 0R  R QR Რ@  +Pm@PU 8#$3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0n 0]S 0 00-S]Q 0]S  0@< 0<20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 !GY0 [0!^0  @E  p 4` M0P H *; RP 6010Q@@Kp0 oVU 0M/hV0K/`V0M/YV 0lSV\0M/NV@7@5?**<[-]$ ! \ @ O-`QMM@p R W T  D &WI^ @P}\ @\ [\ {\PU PE0]\\ \8(<PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B00S08( B0 SV 0F0C  0V0 0 @ ]RR ]RR xdd0R/UX Wf@FU?R/U\$$0R/UR$  ة p@-@PM`P( V/ 0  0 S /0{S 0\ {\ 0 P# Ѝp0}S0S Ѝp@T0.CUV40.:U9W 0 Ĩ A-MMp`@P00P00 0< 0000000 < 0 ; S \00  ލЍ℀ @R0B \ 0 \\ 0\@9*ލЍ0[/T\@X p@-`P Pp@0T1@D 0CPP |@T*x000p0]/TȦ 0S$ - *S ?0C\S0P0S Q 0S 0 0/l 0 RT 0@-@"RC ^ 0QP BP'  R7 "R- 0 @\R "R  R&   0BS0 R 000 R "R @0 #  0 @ .R0\000/< @-P a `1 QM0 MR050 , 0 0 5 30,Qލ Ѝp p @, 0 0p @EO0 P@ 0  0P0X  5O-0$eP`M 500S E @p#S!vU0 p4P$ 0S (%P @ 0SU0SЍt `p  0@S0 04 0  0Sy t匤匔匄p ,p<0fS0fS 00#3R0 4$ 0000@SS 0oS 0oS0nS 00#3R0 # 000 oPP  00#3R0000 4]PP 00#3R0 (# 000 HPP( 00#3R04 " 000 0#S 20@ R@@ A0$0 0  0cp P2S<000S[ tRU\ T'H7 0 0 30Ѝ `s?0l0` 㰈pp  $PWpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #S R BQ #S  I BQ #S# H BQ #S" G BQ #S; L BQ #SP M BQ #SF N BQ #S< O BQ #S5 D BQ #S  E BQ #S F BQ #R 0S:U 0p0S8 Rg BD{P 0`000  00  L$   ,40000   $   30000S0 @  # 00   5pW p[ pR00c@R@W 0[ R000S R 00RY 0 [ R00=@R@00h@p00,(@ (@(00,0uX X[  ȾPk0Sy[t+Q _0 RPJQR00%R P ppfT pw0`00X0`0 0SCQ DqpLp Y*0p0]0 R0SY00P pn0S02 `00C0* L rp;pRpOpL[? 6pEkp0pkB@ ЪP 8 8 @ L Ж T 0 -0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpF2pP P Ѝp谊@A-P`@ A@0S(A@Q0,pPpPR @3M@@ P p0 @BA QA  p0 p0 $0<0 ZO$ p@-p`pP`P^@T T0T0 R@@RpP00GDЈDA-`p@p@P90S x@@J R"@\+P@mP00 Q@ D\@C@-@ 0 0 謇@-`AM@PEpP 0SA|@@0V ! p @UpЍ ׸0P  R 0QTG B&R 8A@4PRS' Sp@ S'@z@ @S@u@@S 4@q@0@@4q6@4q@0P@@4ٚq; @В T8 ԑ t X D 0 PP5PO-BMH% M08u0  p0$ $$ 000 0000 00 00+0ᕚP 4 @0 4;P (`P,@\ P 0S x400#S \ P 0S @D@4@08@\ P 0S D 4@08@\ P 0S 3 0   \ 0P 0S Yn30\ 0P 0S Lnl30d3dSd@F0P + < `: @P\ t@P 0S zIPPU PU JP20P0xS~ "x2 0 $4 30Bލ ЍP@\ FP{ 0S `200#SJ \ 7P 0S (B(2@0@\ (Pa 0S 100xS0xS0S& 10 0sSA0wS>0S;!  A1@0@ \ 0P 0S m\10\ 0P 0S m,10 1P0P!0 $ 0 ⒙0xS}0S y00  00 0000@HJP d|L  L ؃hP >D ́ X ؀ p`Pp@-`@@0S P Dp

PP$Ѝ[S5 \S/ 0S@0?Sc S *S0@V0*SV0 ' *S0  0*S [P$Ѝ[QLpW /W| 0p!S^SV J  Ɵ  P 000@ 0]S2^ -Py 0]S00S /SD .SDB 0S} = 0U/S:w\Qv 0@r/P P]S /S \S$ S] -P8 0QV]P 0XJ q  0@PR ?=P@ P0V@0S 00T+ 0-S T~VP]P0 p P]P \P^ S0S00@00  $ P   R   U/R S /S pT 0-S T@00sQ@0QOS@00]SQ-P ]Go0⨂\ V@T S0TF 0X q R[WP 0X q  0@PV<2{0 zJ0S<|<0 pJ4Qo0 @z^d 0-S5 ^06 Q@RSp GpP@0V0  ! @T6 0 Pf/T @00 #0 @@T S0T0b /3<20]Sb /Sf \SP$ @0P@-@ P K 0 Q <Q ?o2c   p@-@l`P`FP FP T00pT 00pK 0 p O-M! 0 "   pc P   B @10 230Zߍ PT 0 p H  ҷ P7 R @;` 0  0P 3P& PP 0 pP 0 P0@T*p@ EJ 0 pP 4K - R  ꈊ(O-M! 0 "  ~pc P   庹 ḹ10 230Zߍ XPT 0 [p H  J P7 R @;` 0  0P ᫸P& PP 0 CpP 0 (P0@T*p@ I 0 &pP J - R  S hO-M! 0 "  pc P   2 010 230Zߍ жPT 0 p H  ¶ P7 R @;` 0  0P #P& PP 0 pP 0 P0@T*p@ 5I 0 pP $J - R  Hp@-`T@P@@ [PPpPP px p@-`T@P@@ PPpPP pHx p@-`T@P@@ 7PPpPP pw 0 00 j-H- M0 S0 00 0 0 0 00\100M\ 0    RW8 00 0 0 30KH Ѝ/7Ȃ8-H- M0 S0 00 0 0 0 00\100M\ 0    R 38 00 0 0 30KH Ѝ/܁H -- M0 0'--M  --M  A-PPp`p V Q @Q PD@h0 0000Avg@00 G(80 G0稀t t 0P R   0//p#H'H7 O-@P0(@04!50;:`P6&`p`3x@y66U`1p 010000 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C J@ @-p A J@ @-p J@ @-p J@ @-pPP `I@-D00p@-@PP   p@4010 Be p@-P@` 8Ppp@-P@ 8Ppp@-P@`D 7Ppp@-MPP`V ޱ@T |00^CЍp 0 : ]*p@`$ pPccd 00 R 7b,@-jD00 0S@4XbA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BP`= @6P PXY  P A-p@  1M00`0S 00S \P#P3.000R`0@ p `0 0 2 30ߍPP @@ @\(@$LhkPkjO-PC 0C,0P(   /"b!!A0,0 X0X 0P(*XmXH 50 09P(C(P000k c0 ,P(4 00 000a4 ,0 4,,0 v>C 0CX0P([ 00 0P 0 w0 S 00X(H(P 0 fP(< ;0  0 S[ 0s9 ` 0 0000LSvΌ %@|@ dRBnnA!AAL L! ,ßR1c@Dnn B@ b ϠNll B00 0C 00PX @$`(P 00 0P,10PX @$`(P 00 000?3c112A  K?#cQ:!cR # 3 2 ! 01 ,0 B00DRd , 0 40N0 S0(0!0⠡堑@ZPO{"  HP@n 0 40N Q@(P0^P^ 0(P0 06(PP @ ACLC ^ \JS S  0 0#3P0 z J(/o"P?zZL (P 8ja P)\(\ ף` ` ` $IQ[ nY X W l'|T 8Q`HUS< ZSP @  0 0$0h0P0(0010PE0,P" ( P( P!/"b!C;R, a2ba12TQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @ 0 @[X(  00 0fX(  00 0^0@>0S; 00@70S 0@0 0,0 0 0P , P(01(000C.$0<,^3000c^\0M0c P  0P , P(00(000C.$00 0#   0P #,   P b((0$ 00M 00ЍU1A-0QPHP P M@S Q(h10d0 P1&PD@@\p ",. R!  vΌ @p `BU# Ѝ0 P0  $ Ba @L  p `U>T 0 ЍL H= >00|KN N *dN N N M gfffM xM I@-0M@ W0P ~00Ѝ@-0M@0P q00Ѝ@-CP@e$Ip@-P5qύˠ@Ѝ,0  (@P . P |0 0 5 30ݍ Ѝ\0D0 :<00@<00MM8LG $$0 M000 ЍL--M  Ѝ Ѝ/ -- M0 0% ЍЍ/O-@PℒM p` X X00?/-00P @ P x00 00P ! !  D1XPF .VP WT V[XPVppPpW` B 0`f0` pP `PED8 0 9W`!00 ! 1 00/ Ѝ%0XPC0 P P00n/ Ѝ 0 Y9`ᶧpPP V ᯧpP `P00?0 A9etK\E D @-@ M4/(0S2 ,0 `(0` 1/qp0Pp)  0 0 PUR <0PU/ ЍPPTp 0S  0CP/:00Pp.@-P M.(0S: ,0 "p(0p 1/qp0@`/  0 0 @ToR <0@To.1`V ЍP@T` 0S  0C@o:T00.:00.p@-PPD (A0S5 @Tp1 Rp0P00 ? P 0S P05 0c0(0 0P0 +0 S&,P "4P 8P p@HM@0 ^80Sp 0K0 T8eELA A p@-P$@@ZSp@S$;@- @@LS@F:p@-,PP? $T@8pt:@-@PQMPE 1 `0 Pp00S   0 XR0@ @ S6 <$ \80CS0D0 S0^U(:Ѝ\   "^  U #R.S(@ 0A a 0C0F0 7 "U #RPEUU E0 0Q@tDp? 4  R  *4 8/`8 0X\S 040:8 R РS /JbixB@-Pp`a9L@L0@@D尀 U  ' ]zA(L> @-P`@e90 A-pP℆`@P( T.  0 SSS8 S00 S 00500000050 (7T40 7%0 0  00`50000  = 70L0 20-V00 ^V00;\ 40000 0K/l R000C000LS0 100C0 0?V`00 0 00000 \ \ 00y ,40000  70L0 0 h", 3010CP;\ cP3`b0D001dP0j R SXc\Qp3 01K00 M \; =\J \7 00C00L S e0 D100C07"00 0 0  T 00L0a" 0W0C0Z2 F0nR \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00L0! 0W0C0 0 #\ 0 0 00Pi00L 0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP>cP%dP:00L000L0 0<00sP00ndA= > = ,< < ; P9 O-MR@p 8 0S? XPF DP 0 0`0 @F2P?T@D 00X `R%R% V 0@F 0x700ЍU 00?7.f50S`?7.\5 R @T  0E0ЍP7007 7 6 0  00  㯻D@ A-@ R`P0Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@"0081003/0P !p0 $@0V0 00 R (@000P3/0P! U  R  SV  0SX7P000U //>3.8.(? -L=A-@R`P 0Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@~!00810 03/0P !p0 $@\0V0 00 R (㮢00 0P3/0P! U   R  SV  0S㥣P00 0U ,p,<,p< +A-@P| P/`Px rpPh  00^c<!"#b!0CaqV8 X p1PXU $001p00S  \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000( P` p  0000SxP0000H0003/P 0p*/>3)<t)D),)(=A-@P{ P'/`Pw rp Pg  00^c<!#b!b0CaqV8 X p0PXU $001p00S T \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(sP` p  000$0S|P0 $000D0003/P 0(l''&&Hl&SR: G-P000pS` 3/0Y @IOP | T0 0 0 0 Y @IOP i TT0 0 H H0 0p`P   /@%X%H% %$SR; G-P000pS` 3/00 Y @IP 4 T0 0 0 0  Y @IP ! TT0 0 H H0 0p` P $  /$p$8$($#p#O-PPM M Q \ /\E ޹P-P:p/\ p P/ `K`\o @ /RR.\)  B R/0 D 0 3 I # pd 0: S$  S/ L/o" R/\ @  DQ7 .PQ X0  [K/R 0W0[0娐 !uoP-U  -   RW  20/\0#p0@ /R0 X0/ ލ Ѝ@  ]ލ Ѝ.003 X 0/ ?     PE3003>00300300{3?00v300A-@P Q P`\P5p@P P`V X30"S P300@p@- PHaM`=  ,4QP00土 P; 0^0% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P <0 0  2 0 @ )hx`p@-@PP`2 U( 0Pp:P@ P0P \:V \0@Sp\ \@P :VP:Pp<80 0 00 0 p. l. 00/p@-@PP" U( 0PER R:Q|Q00Q0SP0@|R  :RRp@0@0D y0U(P0D p0p- p- O-M M ( 0P8$ p00D40w 0S~ 0S 0S t4!S S4h`P PP7  㠞pP 00S RDP 0P'DP ` P@U"0 S* Z :S `\S S S 0T:Hݟ@DP U@p +㑶P `0P SZl[@00#QQ AP6P00@S0 60000040 p(0,P= P 0:R pR0t4@00 0(<P G<4`PD pP? :00`00 [00S   `P  ᝹ 0 ` P*Pu0S;00`Y@D*0 S :S ``[ ` @d `` 0:R& PR0 0E`F00S:S:00` F0H[0 D0k  g 0 @Cx `! pP H @DIpGP @ p ,P pU ߵ D0AX0$0p#3 0 D4 30ݍ ЍP Pp῟ 1 00%@ gpP 嘡(3@00@S0,P`U9 够`PU03S< 0@ᗟ0@0080` .0SBh0` .0Sy``t0` .0Sr@@P0` .j j f0@a0S> 040Z*0S00S\S00 R|AP 0S7\S5 00S1 :S000 0 S4Sl A 00S :S|S@0@ A@0S'!|1 0 8 30V ލ Ѝ W @P 0 0 CT1 0 Z P @P 4 @@QP P + @1 0   0'P 3~t0 ,0 ,0 0tP_ @\x" l|,  t p@-PP@ T `` P 0 0d0 0p@   @0@0 ,T(t0 ,t P \ < A-@P`P V Ux = @P dP 0:SS   4r`pd \S@+  R0 0:SS ^S0S:S 0 R0@Ad6Pb 0:SS`d A0R@A0,`0S:S 0C^BC@2P 0@0@^1 0@P0 0 0 00:00`PМ! 00 ,~x0x0  ,Vt``80 ,l@ @᭜@- 00p    A-@P`PF VL U: = `P\ d?@P^ 0:SSpppdG0:SS   \0@@AdᘛP@ pd@ \D@ATp"ᆛPp@^+0 +00 +V80 +xF0 +p\P @@1@}- 00@ $  " # p@-PP`@2 V8 T& # vP8 00S 00XS@<,00A  RaPAU70AA AW0AR^p``F?C/;+H0H0C/4+V0080C/++p s| q\ rO-pd# `3AM M 0@P`0(0 0 0S4 &/4 APP; P0D 8T  0婱,00CS02 0x<4 d `<4 [0:S 84Sq,0S,00X"D2 0 (0 30 K, p!P) 0B.K:SS B000$ 8T S#葟 0440<4 0 S BKI ; ./04$ (4J+<4 0'$CB>K0CP04 8 0S:SYD H R0 0  Q!0A00@M@04@0y+ 0:S m, 00UePnaE40D P\*G0 :SS008$ 0:SS004 0d   P   `  0 0@-0  -H-M0 S0 00 0 0 @0  00^100M^ 0@    RL00 嬰@ 00 0 0 30KH Ѝ/ |  p@-(@(P@HPp  O-P"2 @`0,M0$00㺚d20 R[ 00@`pR 0 HP Z p 8P p J  0J0PP0 S": *$ U10 r 1$4S!$@ 0$ PᆳP0S "<100S (!1 0 $0 307 ,Ѝ U r pP Р ,P 5SX0(, VT00#    j&PP PP0SX 8 l  @-;(@M@@00@PЍ   { k{ {G[F { //=A z z k [k'kFKE{{ //=A  { k{ {G[F { //=A A{ k [k'kFKE{{ //=AQ@-@0M 0 0$0(00 0#  ,0T *P0 0# 00Ѝ *0Ѝ-$M0 00 0P$Ѝ-$M0 00 0P$Ѝ-M0 00 0 ЍA-`pMp0Ps t `P冰@Ѝp@Z*X00 p0M*̩C @  0A-` !1 0rMPPp010, V2 @X0^00pAtA)0Oe0 TA0Ό`p 00`L PP0x @h0 0 1 30rߍL0F0 'V0G<0 '0 $$0 M000 Ѝ -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/</C-`0!,1 0sMPPp010. V4 @X0^00pAtA媗0O0{PP0P >TA{ L#0 0$00 @0| p0 0 1 30sߍT0G0 ~'V8H<0 u'&L, $$0 M000 ЍO-pM/0? P0030_ We 000!R !X P  "P4%X 00S)00 R 8/0? 0 3 30 ߍ / `0zS 000P0C0 pXP l@0 0 !P P0C SP @>0 $&W$H0 $&a`0`F p0p0S8@0 !P* 0P0CS00000偼0S0p0@0 0 !0P 0C P0 S7P 00 pj0p0S*P 0Se0 0b00S 0p000Sp000e  0 P_P\+PV  PR00SVp!p3`0 S`0 ٰP 0P0 0`00050p0S 00hʠ@0^T@pp,(0&TIN 0', 0$0 0$`-QQ ]QP0 ` Q8 @$00!0SVp!p3@0 0:0X0`P0 vP$ 0C 0 `&0  +p PTPpG@0SW R`P 0@00:0偼0S [P /00S?0p00p0S00 7P 09pG0W[p8pFW mp!@.p( H 0+0AMS00 [m0H000CS0a000pWH R0XS 00 ( 0z 0        0H 0 0(0 B0P0030F SK*N (@ `Vp0t7t'000l7(`0 p>(00S vP V ,$00SGV`@ T@0  R  R=  0 BV0 5 RJP/0pH  R~ @0H  R'  `V B   H 00 0S$P HX A 0p0 0000P00s BH H HQI@ `pG00P0W0S`J 0000PX           T0p080$@0X0@ 0LpP00( ᯔ P4 0C 0 .$0 cp P p/ ap \0S $0 PS0pS`F V { P0 0@00bP ($@X T 0@0 0d0SxP [($@  ( 0w00 Ci00 >Vk5$   ]R $R@Pp00@0 000Pr$ ( n$ 4X @P0 0P 00,p004@m P P P P  Ph P tt0 $m"000C,00V[ 0$@(k ` @vV @ ^(0R0BH0R 8P-@0 `)V`p ,X@0Tp@H0 H0P`V B   H  0SP H0 p H00CPSX0p050X@LpP0 00 V?o20SX 0p B0V 0c RvP]0 P V0 P P 0C ?0C ". 0(  p0 P s HPX P`Fp0S ;P [[ (0 {/(0 SA-@P`p0 .P@-` MHP@p<0P000 P} ЍA-@Q8R`Px v $200S8 ^0P1S010r G000P`$ pW@0PD PP^ 0 >"00P0 0 C `C00060  Q  Q*RQ1 <0@08 00 0B`0P$00P0 ^P 00+ B #A ?#@ 0#L0`0   B0 `< p@-@P W}Pp0@-P$L MT` 0S pW 0 7/@P Ѝ"@ Ѝ0804 H 0p 0 00M 0Ѝx0A-P$LMT`p 0S $X 0 8/@P Ѝ|"@ Ѝ p0 Hp 0$, 00M 00Ѝ0A-P$LMT`p 0S (X 0 8/@P ЍG"@ Ѝ y0 H; 0(X 00M 00Ѝ0A-P$LMT`p 0S 4X 0 8/@P Ѝ"@ Ѝ >R/H 04 00M 00ЍO-MD@@`PVpZ T6 0US`$[C 0S@ `V= 0 6/0S) $l @V 0S HZ 0 :/@PЍ!@Ѝ0$lV?%.H0Hh[y?/^0HJ>s/H0`$}>[/^ (@- @MЍ0@-P$L MT` 0S 8pW 0 7/@P Ѝ`!@ Ѝ ?/HT08p 0 00M 0Ѝ0@-Pp`!x@x0@p@  @U  0 $  --( 0㒥O-$M03`0H0  0P 0u 3p000ʿ0P0! B0 b8<B p  UQPE @4B 0L3@0S0 MTT  MT  ^DQ #2!Q   "  R  R  \000!#300@ 00@00 @0`PU*$Ѝ@0 0M  0叏0P- S@0^^?0 0`0  ጏP 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `000C0S\000000 0``0\  a  `0\  b  `0\  t  `y0\  n  `r00PU 0 D RQ0\  @`bHH qA- Q@Pp`" #P=0D! D?o2]R0S p0$!0< @ 4 140= 0 V V 0 P0 A`  A-P@p`᪎P.T T x0! D32 0 A_T D0$!0@<  1x x0% (0D,TSI6p O-`\(pX8SM 0PP0D10880 0t10x1 0 ?o2V0S 0S W w@P  0P0 X00 p1# 0@S P%T, U T 0 1 # ᔎP00? PPm@T`P @  TP 0@T0P 0IC1S@1@!0<0`ⱌ0P0; p 0S V <0 0C BP0ap1  $6* 0_?  Rp1  5' 0>  Rp1 00p1 00p1 00p1 "00p1@\00p100Np1 p JP@T`zPH> @L$$I?  HP1 NzS?   vTPQ{0 0 0SE? h T $P(Pp `@T- 0 P9/P0075 31#3 0 D1 30 Sߍ0 <čpA `aIꐓ $P(@@ 0S`(r 00S  Vu Uz 0 0p04 00 0 `P, $ L l7 ,P`O@@@Q@TAO ,[M* 2,@*$04)Aq  0000 0R$00#(00S(0 00 004P 0 0S0"700 0P嫌 ᩌv0S 0Sd ew? (0~sW(@20 0T400IH1 `@0`PXP 0Y3*  (0@0S(0 0 CQ P0 S @V< 00P000 Et <  P 0  L L@- M@(  @0 @ 80 0P@ 0 30 Ѝ@- M@, @0(0 @ 80 0P@ 0 30 Ѝ$p@-@QM`P0 0 `PgЍp0@-@RMP0 0( PQЍ0-M 000 AЍ-M $2Ѝ-M $(#Ѝ@- M @}ό @0 D <0 0P@ 0 30 ЍY @- M0 0@}ό@0(0000  D <0 0P@ 0 30 Ѝ+ \0@-@QMP0 0( }ό PЍ0 0@-@RMP0 0,} PЍ0 p@-0@QMP0`0 0( }ό `ЍpL <- M}ό00 nЍ <- M}ό \Ѝ <- M}ό $JЍ -$M 0 0剠$ЍO-MMn)`< R 9A P p@0  @p IBTIp`$pT ` P 0 ST U e ܍Ѝ R U Y PP 00 @-p@-PP@ D!!!!@Y0P0 @p00 yp yA-`P@PB T% $0S:0@@T(0  0 E R X( pP0S$?@04 B$0S%*>( p̿60S$ 004 ( , @-PPM@`q ,0PXPH00PW0: S Sb  SЍP P 9P p`P@0` \0`D`@.S0H08< 0L R$0L R 8< \P@D V^0 0U :0]0S \040. SЍp $ph Ѝ0:0P  $ A-pP`P% ,0@P \0 00X0 0 0P$05%0`߆@P0\X0@00\ qP @-`QM@ ᇠpp-  8<0RP@D0RP VP00V Ѝpp fpPB@>@ЍPPЍO-`P4M(v ,00P0(0r S , @C0SOoB 0 0P0 0 -0 0PP0,0 00C /R 000,00$00 ,PHL0000p00 R 0$0 0500W000p@@ P ,0  0.Sn P  ,@P XG0 0L00, 0 0S5050S 0SK 0S 0E,0\00 0 0$ \0 ~ R0@PS000B 02H00#0Q 000PPS0 0u P 0 0y0P0S , 0$000 0H,0 0\00 05~0S 0.S P00 00/  00$0T,P0Sq,0B 0 S; Y $ 0U0; (0YS7L0S,00 S." t P& ,0 <%,0#PpχW P,0%<,0p4Ѝ0 00P 00$ 00BUYd (0SY 4ЍOPᤇ  0[5P0500,0 00C /R} 0P00S  \R   B  0SL0S0z \R   B   R00L Rj0)0h S050$0$0UC L0S,00S (0S05SFP e0$0SW 8 H O-`P MPp U0@Px PV(p,P X PUP1QP UfP[R PPPP [L PP P[!  PP P\ 2  L,  PWU0 PpP[WX EwP P0 %,0K X ᾆ P庆U ᶆ崆ᲆ@ ЍPUP1X0000x0 `Kx0 e ^ P+P P0 %,0| Xp,00,0 P , 0    p@-PP5 0S %#L R3@T@CL 0R=@T @7TP 1/,0 *@p(%0#p@ H0H0 c@`` V X` A-PP @TP ,0,MQ Q% R ``@T L0S 5S0T 0  BQR@( @D Q\! 5`V `ąV`05,0$ t P ,0<,0@`V   <,0`塅V`P@,0   lP@ 50 $ 5@T 0   0S00 ,0 C/P0/0 \ @Q20 X@TL0s ,0 `L0SS 5 ,0(EPv(?I,0;P00\p ,0/P W@ `& 00 00@kS <P0 05 2PX,0 U<10p(7 505I,0 $0S005@?@p(0S P -,0 00⿚p( 505΄```(ƚ`0 $ 5 0 $ 54  4 U  Pp@-@P T UUp 0 p4"0 00 $  A-PP`F L'p@,0 $5 S9 S@T @uT V,0`<,0L0`S00/S , @ |00| ;pp@ hKP E 0 0 9 1p@-@PPP 0P0S 0`0e0S!p@({(x(v(0B0 \t 1 0A-P (M\`@ @Ppp 00 0@ P% 0 0CS%0 p0 0 0 4 5;1:(Ѝ 0@0<0"0 0(Ѝ0P 0 00M 0Ѝ p@-@PP P PpPp0*0  p@-@PP U p@ D0B0 U(C<0 p@ ` p@-@PP U p@D0B0 U(C<0 p@ O-PMp 0GW"S00` 0w@_ P-TPh +T@`0? ǿ 0  0  P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP PP"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0` 000S   Ѝ p圀圐 p XR A B0A PR `@P0?0 $UWp psW ꙙP 00M 00Ѝ6ꈫ3@-LMp`@$0 P 00hP LЍ`0 LЍC-P!1 M0M`0p0<0t @PU h1 0S P(0 េ QP( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nSoP0S  f@PbP`P(l( WPtnfsuniop@-`P@p@  P@P p=`9`p`@-@P @$F 0 (&@p @-M @=p 0: S  ỗp  KЍ 00Ѝ3O-0-,M$@`0@ \P;#;S%1pp{V00Sx00w e0$0P@P`0  U 0 * 0@Px `FP@` 0 |p P@PE0S7 PUS0  Y*0Pp R   U T 0G UA~PP @Vi 0`0D00@ @$0,Ѝ0 ,000 <$00S$0p0~P P  0! p W p @ 00 0o01[ 000 p 0 0 S 0S[ d P p 0S  [ ׀L00 $|~ @PP p p@-P 开 @T @嶀T0 0pp@-@PP U  p@ $ 80:0 U;<0  /O-pP M0@`& X, @T fP W P5@1 P1 5* P 8/P  00[W@D:P PU Ѝ8080 X @0 T r4 sO-PLMp@< [ TW> <000D $0}P [ <0Sy 0PD0W`p000G< 0 000p `;/Ppp Xd*  0 b @( `P RPp`,004PZ` ;/P  R ,0VB^P5P1@1*`Ip ;/P  R <0 @I 0 @W@ 0Y:W0@  Y:p I0;/0P  <0 0I 00 p' R` P0S <0pP00Z ` P@000CSv 00`  F Q0#03Q0SU (p, 04P8` Pp ;/ P0 P0R` pp`;/ PZ PW  0X$0 S 0 U 0 EU B  3  S0 0 SQ1:(p,04P8` 0S"*$Q R0B0C0 00W0|@D 0pS+ 0Pi< 0 w`<0 S<  LЍ <` UE 0N W00 Y ( 0  S``V 0`S`j @p@pPꊠ W@[` ;/ PP @ pT00 501 *p`p ;/ PPT: ` 0PX$0DSa0 U 0 EU B  3   S 0C 0 JU 0 U0E0C"030 00c   S & @0PCUP00p 0;/0 P0UpJ< p a%;/ P`pZ0 P00 JU0 U0E0C"030 00c   R 0Q$ @0JS J 0 0Q $0S 0 Q 0AA0 $0`S 0JQ 0 A <0SD B 0`0 P`( <0 0I 0p' 0W dPh `R^t0l  }xxL0\  [aXy@0\  Y<<@0l  a00ꨭ ' d D &- M0 006 Ѝp@-@ PU 00S  RQ Qp{0P{ P { 0pD0D 0 Rp@-@(|P(|p訖tp@-PPM`% @T@T T0 Q 0QP ``E0`P 0 RЍp0i0 $h ̫ p@-MP@bPUP`0S$005000 0  P& p" PQ! 0 00CR 000S 0S$0Ѝp&00!`$0L0L 0 Rp@-@(|P(|pXt00p@-@ `0S P(|P   ({P   @p({@tp@-PPM@  0! @  0 `}p@ @Ѝp 0 S `0<0 0 X!X1p@- @0(MT0$00: 0PS` RT= 0TS@ 0 0 $0 303(Ѝp > (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@  뤒@ x \0P@- D  R4 O  / ( h 0P@- XS HH@ 20( ( @ 긐, A-`PpPp@ U T 0`F0 P\ 000Q A@0?0  U$@\0  (Px X T00@-01@UT0P 0 !04P00@-01@UT0P 0 !0ЉX0@-@UTQP  0 0!0p(P00@-01@UT0P 0 !0̈000/1/1000/100 0/1/10P /0-@PQ@0/0P /0P /000S |0| 00 9/X0  \\ $0 /0H11mNA1x1 A- `PV(Ep@0 Ï@hC12c` P@ R0h0h 00 PQPP@@U0P100<1_ N00p@-PD@@ y0S,000P p@ y/ 0d/1A-@Q`pP`FP t y0dS AA0U0FU0!0 0p000 0 y?UU @P P0p0p@ ^  B0B10U  ?ࠃࠓPL0V0 e 4` py///.h/.<..Р -1A-@PppG8 `0#P #QVy0S PFA@@A00 0 0!xUPdPP h0&&```YXX00A @(y8080X  .X--- ,,H-x p@-$@@ @yP yp4,0p@-@P PP P @p@p0A0 , A-PPp` @P P iP  P@3* "00@ 00(0V0<  00@| Q:// BQ://@G-04!00S(03 0p00Q= AQ@P``P000QЀ @P  P 0R@ yTl@0@S y000  B B!G `(,+܂*8p@-@P P8PpU0 =Sp=Spp p@-@P LPP@Ppp@x0 $)X p@-Pkv@P 0 P0@p)p@-@PP DPp P3#p0D $( 10O- M Zp @To p `P P0=S] @PT[^ A@ZP1Z04 S@@@S*Z3 cx<1 0    `: 0S:a  D!N0 0 @ Ѝ0Z   RS@}  ` v 0S a1S  Ѝ PPꀃ ~p@- @t,PPp 000ppXA-PPh`` p\@P 0=S Sp (00@0 ,@-w@P! 0@%,@-w@P 0@L%,@-w@P 0@%0!@-@!0!1100 000Q000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1   p@Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPG-P@U`pV1S @P@E  8/P?@P@@@0@ģYC !Qp    / @ q  0W000 @0S@0  pPT1S1 S Do 000  q@@0@@@ @@p p  qQ0 @-@"P 0 PCQ0  0 R QP 0@/0p@-P`@T0] \ = R=    T0"] \h0000000000 0#0 0#0000`0`000T ^pp@fR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@7Q `T ` R\ ! O-p`7sP$ Q@@P0QpG@`X 0Paat0Ot00pG.wTaX@Z_B 舏 004 D00.R@-,@@0@P0S@ M-`@P@_}P(p0@aavt0Ot00ZO.TTaXPB, ,0( 0  xruxr0p@-05S PtP0SZ sX@ 0CR\tp@T P VP@t@r`/p@-@P $PtP t$tP tp@t00 $  Mp@-PP@ T $0! 0p@/800H $T\0H $ꘌ x p@-@PM# $`0. U  PP  P `l,P00S 3/Ѝp0 03/0Z0l $ C-DM$p 0RP 00(00@` $ NPP 0 (0G,00S 3/DЍ y,0 0 (3/ 0PP A-PPM@) T/ 0S Ѝ$@ 0 P t00 `pP nЍ00p8080 $FT 0 $=܉  O-pT"`P2 0yM(010r PP{ r@Pn 200*s10 RE #s!1 $@  0  $p(`Lp4` 0 . ,i PM 8003/```rP"  !0 0 1 30/yߍ         kisP escsPpkZsTkSy4pp \Xo((h l L P/00/ 0@- UM0H`0L10㳪p! 0H1墊p@9P:0P`p  S 0*< ,0 0 L1 30Uߍ 04 nH|mp@-PP`M`@& T, _PЍp cP ^P ^P p0000 P@0G0 $T$HL0 $,mT$  O-(p,@P_P ` V&S/Z V@0Sr000S @Z 9/P V@PV RqP< j0SZ@P V< G-`R p@P8/PPV @!1 G-@Q0MP`000R U: U30p )P00 S0 0000 ZPP 0 OPP F0SP !1 0 0 307Ѝh.00P0p ]Up0T  /PPppP P$p 0 P@500 0Pji/ B/0  Q B  / 0R % B   %3 %//Q0 / 0R ,` , `! B  // R  B-0  ` .$`$"  /0S :0Cp@-@0 P 00 0p/0S :p@-0C@0 P 00 0p/0S P@-@b" M0Cb! 0  00 0Ѝ/0S/p@-0C PM @`0 0b"!4Pb4#0 PЍp0 $000  / 00$0xY\Yp@-PP@ T _P 0S Sp@_,^Ppp@$^800 $TTH0 $K ` p@-PP@ T _Pp >p@,`4Xh0T $00W0T $)~ ~ p@-PP@" T( Pp _P 0S S]P p@]p0p@/80w0t $Tx0t $~ } p@-@PP U  p@_80g0 $Uh0 $} } 0@-PP M@ T ]P Ѝ0*_P 0S\00 0`<00 $T 0 $V| | p@-PP@! T'  0Q  pV]P ^P L]P G]P p@A]800 $qT0 $h{ { G-PP@F T  R! R `V" V  0 `PqPp$, 0G R R/ 00 0 `V00 0`V 0.'0 F0R"  0 I0,$h 0K/ ` 00 00 0000 0 `X{ %z z  @-/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0 0:0 y y C-@!P1 0MpP`030L TB A< WP8 $Y` {0S `!X1 0 3 30Mߍ(#@+ R> R/ ! T L p0S Fp% 0 0 D0 200 +  T %  RP R0꿥^]x x |x `x O-IM4M`p$@PPJ d4 0I ,000 pW W0  $4 I0, 0 30Iݍ4Ѝ0 SJ=00SX30"l @ J- 岰p~ # 4+4J8 #8T  ẇ hJ- 0S 0UV  SV S RNJ= 0012 00d$00':00H0 40 ~RP @,VU  W3 0Sa0S  0S0s S0S RJ= 0 J= 00ZWJ O<  VP^  0SI dge1a! 4a4#Q #< p0<0J8 0J= 00$ 0 X\0Pl J- 0SJ=  02pS SuJ͍ 0 %! 00S`LP P P J= 00W0  UPJ͍ YP ꕤ[[v v ,v O-`H$@D4 0MQP@pDH0000$0C S0#3 0 0 30Ѝ#3 0 0 30H0 D@pЍOWXf t4"4 8 #8 ᕆpPT0S RM 4"4$!$("( #8 #8 D{PT8VT00QWX00 R0SY 0Sf S4ZP00SP"0 T OT@@O 00QWX00VT<x!  0T  3 X: 9pZp  0PȐpZ@D 0   T00? ,!0 piT 1i # Z3䐟P p0PȐp  T00?pW@D 0 DׅP^T[pAL  ɅxxPWr VV0r q q p Dp o o n O-`!p1 0IM0107 P@Lp/ P PW PWD ?0@S0h 0&h00a 00  0{P 0 0 1 30!Iߍ Z b0VX 0S P 0 0RQA-@ 0P`p0 { 0P p@-MP`UP@@P@T 0S  R0S  P@PЍpPPЍpp@-@P PuX%Xp0@0  J 1 #E 01p $0p8 `<  P0 0 000000 8  P [ 00,1040300؍<Ѝ0  R 4"48, #80,000(0PU,(Q Z Z Z[ ``x0 ^c{[00w[00s[00Hd @TFXb  @-`0!p,1 AM0M@PP0 402 U P P0 1 P-@  0 0 4 30$AލЍ0SP @0.Sh P 0 @ HHx0 [00꬟Ea Da ` @-`TT!0 $MS@  : S, V& p,0< S9*@ \ 0S PU S  S0S \Rp`Vl d0 0 0 30$Ѝ ]4 01 KCBG-@P`p W"  gPP   @  @!y<<D0 lW 0 c^ l^ O-M4M@<($088Q 0$h0,00&<00,`0 $0S 0S P0 <0&<00!S2 &<00S &<00S @'t7 0, 0 306ݍ4ЍS@70 000 S _>`C @80:0 0ᶀwYpP0  03/P 0@&<00&, SS 0040R0SY pWp@`$`4(48X#8C 0,P: P00(Tq*0C 0 @00@$0 `` pY:9 i2 I520Y0 0 S   S  R  R Q\z  ^ \Q/o" S R0S 0 PQ 4-0 0S Q0S %w0P 0 #P7  B  0 (J(P?Y 0( P p0`8P<p`P,@4Y 0S@TC 0SV 0S S 00S P(0 0; R=P R: R70S0S `;0S PUh;35 \ ^ 4; 00U Q  P \ ^  R R  p Y P` 0S   0?S C" 0c6#PY A ^h #\S㔐Q^'@ pTp0S 0` p$p@ T :4 d2 D52H 0SE0 S > S PR  PL @0P0 0`P`&)0 0e?0Y?P/ @|]( 0@S0`P@T $PP@P ``T$PY@T@ pTt W 000 P` 0`pVPUS }_0P$0M PH0:L0 0``H` bPPP<$`0S4 0S ` 0`@xx?3.QRSP㔐  P  P \R?o20S c R㔐Q OP\JR PMVs `$p(,PP00 00SrP@T0 H6$p0(,PpP S 00 0 P@T 0S00S`<`:  0 P pY 0IwP-v0 P R 400S R00U  P3 0 PW 00S*%S㔐R#0S  =6. 00q,@P8P p<_RSQ \@` T% PP@ __TS㔐e ``_@  0K 0P  0GP ` @P __Y@PP?/ ` `Sdb Pd_` 00 ]P  0 ```PPH [:P\P HHH HL0[`0L* <_X2個0;>(0$00PpU 0@Yᠰ @H`}대pPUp`K|0`B l` 0 0( TP`ph !;vP tP20KD  Dp,0vP`K(,>H|,<0[ Sh S \` R` 003 Q  R0R`U`P t+8+TA A @ ,@ =<= f; x: Ii $@0P0 0 a[0"0S0$0^H@P P0U 0P^P0U x^0$p(,P` K b_.n> f5 uP1x00x0 T^uP@`H`0V00L0`B^P``O-PTMc Zj  5Q1@0P=>p=^0  `Pp 'PF 0p R R R0 T@0P p R 00 00  BP0 0 V  Y [ 00  [ YV,@TЍTDD?/Z((D0/6 6 @5 k 5 l G-XMp@_|P `P@ 00   0h|P 40S0. XЍ TP ]  0J|P y]8<8 2P 4PPO 0 4 4 O-"M2M 0`Q<000 Z 0Sq ppr@ p <  =~A. *8PPh 0#S( ;P$ 0=30P  @ PRP R R UP P ?tP4 @ R0 @P1tP $K$ (0K$ K:P0(X PPU 00   P  0@PAwP0 x0 0< 0 30ݍЍTTD0/i<<x0/_ꭓ3 3 X1 X0  0  A-(M@0 p`pPw .P @PP $00S(ЍX0 @-@ =[P 0  @0O-p"|2 0M020) `@1Np! P PX PPQ P Q,p!1 0 2 30`ߍ&0@SPX 0@SZ00 0P] X00 0 T P ZY0 Y  0 0P Y:[ 0 0 X  R  XR P 0 zɒA-pP`P@ 0 I 0P 00 $2 0A-.L RO-LMP `0 D@00p840 <0T 8 0  0%00#0(<  .  " xb*. ,\Hǂ@# @!p8Ha@@ 0"00#p0H<@@ ,  " p Gb*@ @!@@$$ @ǟG #!(p ǟa 0"00#,p 0ǟ<  $ 0p " b*!){G OpGp,XG4pǂ@@# !84Ga@@ 0"00#V 0:  + C0hS@H"p ` *:0V@@p`F  G4\0P  00P ' `' !1 p@-PP0M@0 00( T/ `  !? 7R8 bx b   x0 0 0 30X Ѝp@Lh0t T,00t l& Th& D& C-8802 M,"0 P00  `p 0R @  0XS @@0 T .. 0N l!\1 0 0 30 ЍT  0A a 00C 80BS.R ^V* 00RP 0FS0 S S^*0X 0n(."4n4#0000@^0 8< 4^*0 8<- McP ЍH!H1p@- @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0Dq4# L# A-P!1 0rM`Pp010: U@ @X0^00pAtAV0OV0 1TA Ό 00 LTP2  0 iwpP# 0@SVP 0 0 1 30rߍx0<0 jU\=@0 aP W00Z 0P0B! ! $$0 M000 Ѝ( -- M0 0 ЍЍ/-4 -M, 0 0 pЍ Ѝ/p@- MP| |@|0`  @  P` @X@ PU  Ѝp `(LL1 @- 0M`!000mp P@   np l@ 0 0 0 30'Ѝ~lPpW @@T PU 0SP@]TX00@ZiT 0p@-P0@ 0 p0JV(0PGV(P,PCVt` 0`0PP 0&P 00 0ppP 00 0pp 0@-@ 0 0 0 0 0 t 0 0 00@-P M @0U 00P 0 @?o2 c0 Ѝ0J2 00 0p@-@P 0U0 0pp@-@PU0PPU(0PU(P,PpO-p0Pm `,Pe 0@00 S S0 S S |0PS 00^P U(4"<8#807 ,,P@P! 0P,00S S S@ 0AS AQ@P$ 0 PS0Q0000TP  ,TPP@~@PP \   O-P Mp@,0(Sx:  (T] 0 T0T 00SP 0 RJ@D@T0`E   RA 0@D@D0`0S* T0T 0 1  @D@T`G 00S#0A S00H ׊A0S000 7 Ɗ00S$ ,p@T0ppT(0pT(p,p@ ЍSP  (,@(  Ѝ0 00@- M@P   p P  Ѝ0 0$  0$0 P Ѝ08p 0$0$ 2 Ѝ0O-PTMe Ep@,P<@0 ppUPb,R`P^ 0 ppUPS,PPU0@ \ \G \Q \A pp 0U00S QP, p0 0; 0@ ` R  R2 R[ R 0 @U ` 0 T 0JX0L 0 TЍ @\L@ 0U  0⼰  80 ` ` SPE0h ?4 E0 :0; 0Y= S81P3 P#S41PE2s2PEsSPE0i !0 E0 809 PEPE0i U0 8PPEPE0h U4 :P 080 4:0 @-pMgp) @wip, `0v0 0 0 @XPgu l00 @P Ѝg200@Ѝ,ig / p@-\ ,@\ \ Q :\ :Ap00p00A-@$MPJ P 0( T 42~|:pB8N87 @8nj;p$`137<Ǡ  B- @0NQ  Q  000<8 A90><à 0 (0 AЍ00 01 0 0 0@-S@ 3/@IQO-M@Y Qs 0`  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \᧗" 00\ |3 L0 1 00p0` 0`Ff& G B$"II࢖)0F 0C)6# B B("IA!0C0C1# B B%"AA!0 Ѝ ZTr ` /  P* 0 p$ 0 J 0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧗# 0Z " Z Z 0 00  0 0 p 0`\\ 1L0 10`ZZ- Z) Z+ 0 p 0`p0L0 1 0p0`fZd Z Z Z0d0`YHp`F8p`0|0x0t0l0hy7   @-@P  @I0/0 T 1p@- 0@P0 00D@1011.T 0@\0 S@ P p0  00C1000L   00LDL  ʚ; 0  Ã0@-lPP B1!1 M@@HD0 #( 2 AD@ i;  Ѝ0̠ Q2Ÿ0@-` 0P 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> 0pC0@@.SM 0@00@000@ 0pp@qE0Cp2Spl 2S 000 @ @  @000n l `Ad Dn l lAp00@  0pGqqAp00  0pGq@p0000pG00 @ @@j@p  O-IMM4`'D 縔 $ `!P@@p7R@@T0`0T7L0P@0 4p0 0 x@ N'7 x T &0 8 H < 0`,P0P06 U0X06 0< ` 8 , 040P<0, R00S D0`1  P0 R 0 0 0R PT i00S2x0S 468 0/ⲀHp0p 0W9 X%U80 P?Ⱀ-'d$ ( d  @  h l 0  L   O-lM8@p P Pv0H 0 H`W 0 0 L`!0(RᴴẤ,0  |&| p&M B.P  SD00 0Y0g`!R   ;`!R0  e[0 0 Pa0 0 PM  P90 0 P%0 0 P0 0 P0 0 P0 0 P`!RwXy PP Q< `0Y  0R  0f R 0 R  0Q(0svf Rn 0 Ri  0Q,0sdf RN RK 0 `SL 0sSf`!R   .0 P 0 P@0 P0 P(0, 000Z lЍ   X倂 O401h"40 t  e($8"0 t d/ "0 t d/ !0 t d/ m! 0 t dŸMMpS elЍ lЍ@0 o $0 n 0 m0 0 k 0j0 i0 $D\   L  8  | H  x X 8   @-`0AM 0M@p 0 40 0 <PP0S oD 80 0 4 30AލЍ.*|0,@- M@ pp P<`PP 0SD 4 Ѝ00S.S 0S ЍP p@-Px AM p00 ` $ 0 @P 8 ,0 0 4 30Aލp蜁0p@-S@` P0 @S aPV 00pV00pp@-P@P P  ^U00p4 0 t cU00p 0p@-S@P  \ \U00p4 0 t cU00p  p@- P8  UpPX``t 0jcU:vp(@0@ ^cph tQ@-@ ||  Q< 0 TPcH  t 0=cZ  O  @  p@--P<  UpP<\``t 0c3U:p,@0@@  cp D $ P} @-@ P P= 2 @0R8  P@ &@Pm P.P]  P:  Pc  P P+ PH Pp P\ P HP4*$!( /03b3'}{)t/h\% | D  | l \ L < ,  @-@|( Ptp ( /0Jb h h @-B.@M  TPV0  t 00bM耺 Mp@-8MD` 0 I0PP@0400 0 -.bT @D J000` T0 0 40 30 8Ѝp@Ѝ/.0 L0PIt( O-@Mp@@ ` P0 Q ЍSq SR@@ -R 0 0+R0  0h300 00 B10 11 .R 000 @T@0✑)SQ 000R#3@0SQ #3 00R0#03!3 T$ (<0(80(40%<0%4 0)< 0%()4 0)(0 P 0R0P 0T00@0SP 000R#3@0SP #3 00R0#03!3 T  0T00@0 S\ 000Q#3@0S\ #3 00Q0#03 3 T q  00 Q @0N0000D00 0 0 >pO-`QtM0D S 04   $ 8  ( <cH#  $D ,Hb"L,ĠcD$a8!b,#4" 00  8  /_Pc$Ѝ C-`@P@P MpO0(?͍0,0= 000=00 0P8 Lp4 H Dp 0 PW *0S@2 P_P0⯭<0H0 0 0Fp 0(00H=`0= <<0@PV *, ?0 > 0 ;/0H=0`F$`x` 0m `d0 [ 0 p ( 0%p Y1 Y> H= I0R# P0⯭<0H0 0 0p  R 0S .S 0S 0S00S.S=L@0@=00Sༀ@tL 0@d/ @@Z 0 p 0 D;0Sf*2$0墏#8(08$0000(  C0 `CBZ 00pP@<00dd ZU@80  pU Z8@P@0 Z~pI 0 0@pA 8;0 020#80B,; B00a0.0 .0 V0$ V@80A  Qp <0 0S 0D;:04H+B 0?R0S d d?/;:00<*: 0  0 30  ݍЍP0⯭<0H00  0p@ 0 /p(ꠉ฀> P0⯭<0H0 0 0p0< 0@08 BP0H4 0R0IY0S ?/=00S3(@ R/dpD{0 YP 0  p < 0@8 B VPH=00S2Dpd^/0WWD{ Y 0 pd =00`C7 x @P T T㐀 p`P 0U0 0 F{pF 00e0T0PEm ) 0 mp7<0@p8`P@C 0PP( 0 Tp 0  P`=00Sx2`@{20@DKxdf/`0 4Y 0 (p 5P*=00CF@@LF0@R_ d Y 0  p  0D;d0 Y 0  p /2 d0 X 0  p `0pVD{ -8 zOP0 d X 0  p 0SD[ =8803Y t p 0p 0DK`VD @0TF1!PDQn `  0 PPr DD0p@D{ 0pe =00YU   0PX=00@C+Y =00SCD`@R_0 d {Xp 0  np9 0 d nX 0  bp- 0PU0D[q* p`zOUD[h 0 d TX 0  HpD@ Pc @0TDKT:UP 0gP+@0T 10"3h" 01;@0==1;@020!201;@000301;@0<=1;@010 1;@=0;@ 0 p 0D 0 S 10k @`V P  @$`U 0S @` 0V4 ] d0 W 0  p @T +A0T 10"3  01;A0==1;A020 1;A0;,8 X <    YȤd  p .4 *` p \ $  ======T  VUUU \  ` D ,  ̿  +@0T 10"3  01;@0==1;@020!201;@000 1;@ >@ C=0;@C+A0T !1 0014!;A>A C@1;3@ ] 0,p@< 0@8 BP0Dk 0PCU.ȁQk@p@T# 1 W2  d0 W 0  p=00S!)0@&0P#0p"PP0p@ U/2D{V` 0 p < 0@8 B@pPH=00S/SP@/0p@S/2DpD{V` 0 p{  @ ` 0Pr Pp 0 DpD{pf 0 P_ 0D0D;P 0pS 0 0PL $0D; 0 up@ < 0@8 B P6/@/0DpR=@ 0  0-pAP`\/x%@105X0DK 0op'< 0@8 BPU 0P p jDK5/`Dk 1d 0 U 0  p $/`Dk  d0 U 0  p  /` /p /0U/dp U 0  p H=00S0H[=@0 0W$P{ cT` *, (7(0 t7 0 8/'=P@D `0.d@ 0H[U 0 pU 0pWD{.*`0p] @ P0D;0 V 0 [lp7 `0 d kU 0  _p* `F@P0 S 0ZMpa=00Sgy.H@dR/pD{0 @U` 0  3p <0@8pPC 0 @P 0 p 0 @PH+=00S  I=@0@9=00S I=@0@-< 0@8 BP0DK 0S4zPpk@X: `D$P PVP. 0S @ 0T8 Q d0 T 0  p X <0@8p`@C 0`NPz([ 0P pq 0 @=Pi 0 pb 0DK 0CY@-0pD{ 0 `pL 0A/d T 0 ` tp?  0 p7 B 0 ep0 -p 0 PDXp# =H{` 0 PPV *, <0 < 0 9/=`F``p0H{ 0 Sp } 0p E'p a-  0 D Pp =H`  0n PPV *, =000 08/=`F``0H0 p ~ 0p p %- 0 DPp =H`  02 PPV *, >000 08/p=0`F`H0 p n 0` Kpz ,@ 0 DKPpn =0H{P @PdU *, x?x000 08/=PEP_`P0p 0 NH{{pF 0 p> 0 O lpT6=00S /0 S00=00S ?d0RO 0 USP 0  Hp `0 dD; 0ES 0  9p 0 d 9S 0  -p > @0DKR .$0 w/d S 0 p(< `0@8 B`P`^ 0P p pDK/, 0@+,),dv/0 R 0  p H  0PM=@0@=00S 0]/d R 0 p PUpDD6 1R`@ `$ @@@@=0Hp 0J!Pn VW` *, <0@ @04/D0$ pG0- p UD0HD; 0D S\ @ 0 xpC 0- <!?C0 S  0obpv,=00S 0D KC@@=00S< 0@8 BP0DK 0SS`+C100 SrD  0o.pB0Hk=P0 0 P U@ *, :0 : 0 8/0-`PE@ HkDKP  0p0Hk=P0 0 P U@ *, 90 : 0 8/0-`PE@ HkDKPI=@0@9Y =00S.I=@0@=0@lI 0D @C@TI 0D @C@$P 0PU0D[:=0}` pP?WW @`P 0U0 0 FpP 00e0W0PE3 0 wpA0`hd`/ tQ 0 hp3 U $pPzoUDK 0 d ]Q 0  Qp` 2@PT.TW wpp`P 0U0 0 F3p 00e0T0PEV 0 %p0H=P0 0P U@ *60,& P  5/0H=P0 0P U@*h60  0p@ 0p 0CF@@ $f ` 0 p  PDK 0 PP 0 p 0E@ `@p< MD;  0 pw 80 I CPoD;V0 0Npb)% R/d0D D P 0 pM)` @DKj_d 0 {P 0  np9 )@DK d0 iP 0  ]p( )pdR/D{ P0 XP 0  Lp < 0@8 B PD  0`C 3 $P@PI spp`P 0U0 0 F%p 00e0T0PE 0 ps p 0 p p@⸀@T N 0p "0 b/d O 0  p 0p @RWT@ 0p NT 2@$` 0`@T0DK: 0C@` PP@U3U qpp`@ 0T0 0 Fpu 00d0U0@DX 0 pf 0p_ p_TUp p 0pJ pD@0mȀ=0@帀t L t h 8  VUUU T ȹ D  @  з < d L t @ *ı D  | D د 0  Ԯ P +E T0T! ##,00 !+E T--!+E TT" !" !+E TT  # !+E T,-!+E TT! " !+E T 01;E 0 p `VDK@J@- R MA P  ,@@0(@;@ Ĝ0S ЍԬ M-(040 1 2Ѝ/h"A-PS`/p@@W0 V:0 $4"48#80@PU <'P@(00T0T0@DT0S$0l0 (P@ G-0PU!::0` @4$#4T00 0p4$#40  @T#0 T4Ġ#400S X T0 $( ,0 P @Z(00QA-Mp$0PS@` 0(010$,0v(`V|0Sx(0S! 0, $P(0, V3100&Pi,0 \, d0U4#4 00,004#40,T(0P0T(0 S0P$0Q0 ( ,0Ѝ0F "P5, (` , Q/:04800XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQ 00000  0C Q700C20@?D0 :$0>0 3(j  ġ A-p`@HWP. T @00V 0Px0PV0 G.`U` P7000 200p0 S700W0 U00gD0T 긠 /$o/ ///ᨈ@-@DM0` p <2J0 RPV300000C0< 00 0 <0 30DЍ^hHg fO- M`r 0X婒'`r@B( 0 rgqC0ሀB"RP C@$A i!dP @3@CG*TNXWmY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 H}p# W0Y[0S    00000000S 0 WZp@@ 0 DO p XW  0 MBp Y H_0$ 4 Ѝ @ꉈ%I$: fP A-`pP᰻0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0. 0 @@( 0 0p@- M0P @0 80p k`d p Go4 (0 0 8 30ލpOgcbPRp@- `@PRPIP0 ?p@dG7{00pPRp@- `@P0P'P0 ?p@EGY00pp@-@Q `PPP0 ?p@G900pp@-P@GP  p@ p@p@-@P 0PS <0S P 00p 00pQP@- 0R R  00p@-PP Q@ @Q Q Q ARt032 00p{P @ppP Qp@-@P P`P q U 40,E0S 00p UPpp@-@PTp (0":k0cSp: A pO-0 -tMP@0 Z/8up@6(50S @P/00% 0<0-X000X 00H S0 100H < 0H P-\\Ё0HL4010X @X `V @ ER>    0S PtЍ P EXH  @0@ @{ǻJ{ǻ3 $SQ 0$@ TPR 5o@pD 0H5&L @  @R[PQk{{+ Up{ L( k`Q Q4QK`7HpLL{@{0S0H000S0S0SJ Xxk@:p8p6p 4p 2pU  1j{ *0S  0Q$@l\ 0jP`0\ 46$ sL@V$ (0~ S \H0 H{{7{P*XH0/SL 46S00jS^ *k&0B:H{{{ qqP) qPU L L00jS5?55??P9H00vL 46Sq000kSm0S0Sg 0 p 000Dm0T00XS<@ 00DA B QR ap `> S0T1 W  0ptt p 0`@> p PPD1?0 0p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP ph0p 0> 0W 0@ p p0@ p 4333333@q 00M 00Ѝ2 r  Q0?0S @-[[-- Mo ЍЍ/G-P`pP WV Ꭹ00`F! R !V6  ጧP 0PE (z`V PUU@@mPP X1 00i  @@PE  PW00Y L000@00NH0B0 ;W,C40 29hn Hn A-P`H@H0@@@p )>U  R A0(0n p@-@P 00CS0 S  P 0` Pp~>`@-@P  0`00@060 ײ m - M? Ѝ 0 0@-PP0 M@000 T!   ᾳ o0 0 0  ⳳp h0 0 0 30 Ѝ0H0H0 ➲T00D0 ╲FZ /.tl MTl NA-pP@`( T/ V6 0S 0S0P00 00S0 00000 R` F`Q000`6P0\ WT@@p0\ NV$$|0\ E\k 8k ak bO-p#@3 0OMx0410PP`1 dh`0 V Vw Z.` VP 30 00 [ .Q Q\.Q b :0 3 0PY [ 00:[.[#4O[0Q.SI Yg0IS00`0 0IZ 00 0W 7 0 P00 ` `v0 0C SB: 忲0   ` 0 #+00孳/00H!81 0 41 30EOߍ:[ 000$0( @,E0 0 00 ` P P00 ZW00z000 oB<4 PPH U.R|  :ᕣP p Y,,*%(h x)g BO-`PM@p  0W0p W0_( 0PD ,% 000 00 P @ ppP 00 0 "P > Q Q 0` @V 0`VI:`F0V:\`FX @p pZ`FG R !0 0 00@ߍ Q Q0 S S   办 pP ` Q PG PC T :  @DP  0RP@- #[z0dpp PX  ᛱ[`F Kqꑱ `F  W d 5 Z V P, 䠊0`P `p R R R RS T * P p RP=(% @D PPT @`V0 uP& !T<: `P  dP T014 @1:o0 "0 0 ; 0 @ 0 @0`P` ' 0@ 0@ 0 PP P 0` @f 4e c b ^@-@d!d1 0LMpP0D00G DP0`S- @.0 rP( V( QPP0 0w 0  :?P  i 0  0 0 D0 30LЍ?PlPPP L@ K T88C?F/ ⎯?W#Ha (H"t` 8` C-`PM@8 pPU* Y @@NO00  0>P  0  Ѝx@@JO @ T Ѝ>P P$$C?R/ >G_ T_ ^ O-UMM( t*0p: 0hz0L50`P|5pxU別0 (0S 0 S00W :0$0(u0P,0 0 @[ S#p`P ,0)09 0 L5 30VUލЍ50 0 eP0 $03/P @[:0CoᨂS  Ri  剪P0 `PPP0,4'4Wp8#8X uD PT4R pPHL@8< `\ T]*`P0C 0 `PR0 $03/PJ @ Y%  @ T`0@ 0S4<0S 0 S  R0W6P0 0S!0S H0S0PP0X`*\0L 0R *P  WH0`0H0LPZ84H0S , 0d0L P0QH RXK p XPHp `BZO[ P0 0 00PT ! R  ȠLȠQo \ V SppQPW  WX0 B@GAq 0SPSPڰP!^P"@Qp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @֮L0X C0 0CS`:Ȯ040$0S?0@0 (@Pe0 t V?@]X00`VX@ `0@尚``(PM S  C'SRG 0fP 0` P 0a`% 3V?Z/ {(0SX]?Z/ qP(0P04D0,0_?R00 @P0 9 VT D0,1Q;*,`PP P`P0 CR00Q 84,`@IPPp0`P CR00@T@6P`@9$03/P `1,0D(`C 0T00Pv  , D00D0D0 (4PH0 h@P0 E VH0S0P T D0,1Q=*,0P,0ᎨX@LP  0%}   Nȭ81p᪥`V `p 0  0`!L1 0 <0 30GDЍ(PE P Pp 6P? P0 0 0 0 0Ip `pP 000ec  0W 0000埫00pIQp`x,L dK HK p@-M`@P 808 0 0 ɠjЍp8/P/@-M@ ((  9Ѝ..@-M@`~ ptPP0@0 ) <0< 0  0 p @sЍp..0@- MPP@T x 0 P00 000Q T 9 @ Ѝ0@T? 00 ..-C-@PaM`P^ Ud !0 `   p0S  H  0C ^0 .SNW 0@ Ѝ0 XR   9S 1 @ pG W 0  RU 8 <04 c#!$c4" 0廩\0m0 ⭨U@n<0 ⤨ @S LHG (G O-P#3 0,M@Q`0$00 UN Ph PV`0:V000 0k Vm ß0 0 HP @`0  ᠚P \ PUW @ZpWP  p$`WH(4"<00S W0G> S0 s fP @(rJp<0p 2V VS ./ 0 !1 0 $0 30j,Ѝ!1 0 $0 30_,ЍO`:V@ \p <P :Z<U2 0S 0$ S$!, `PqIp0p U V V0| ۧTT0| ӧ<0| ̧E0S@dp$`r `.V0p$`WPdgOWpH`F dE h4D C @-`!1 0,M@PP0$00' U- 0p0H 00000001P* ᗔ 0 0 $0 30,Ѝz 0 L0h0 nU0i<0 eOlC B B O-ptM8%045 Q 0@0l00 W P P* H/ 0 $4 0 l0 30.tЍTIP`<0T 0Tu T 0S0` $p<0`  0 4$ ( , 0 4 8  001@ R@0`S U P Q 0S0@S Pu0Su00 Y0S @\T<000j0:0@0T0` 0> Zg 0Sg* 0CR00`:˓t"2 0 l0 30 tЍO@PPUF*0: T00S DP"H 0l 0[P3@T` 0Z00S RZ  @T`0zu YPr S 0 S P0@n Pa0SA:[ 0 Y Y Y@$!0Q 0 H P x8 @R0PHP`0T 1W Tt T0` &uC@0[& + zP$p 0;/qp 00P @ P i00 0 00ᶛЍp  - P0 Q+ L WZ p  0-P 00 0 SM  00 0;/qp 00PPßQ <PU;0 {0p ;/qp0P r 00 0PUßR <0PUß`X0p\ Rh00cX0P[NS  00Q[ <P800CPU0& Z  "  RNLP0Pe? P ;/qp? 00  P @ P 00 0Z 00 _P(0 S%: PE u ?J 0C09PPT 0S  0CPß,1G0 ѤAPU0 Z 0CJ P%JPP @0P g0000 00ᷚP0 ⤤0᪚Ꞧ00ᣚ480 ␤0 <8 8 7 O-P,MPP`p@ T 000S000Z00o$0 0`PPW0 00 @P $ 0R00SQR+XP `  ! 0P 0J0  UPP`E [XhV,Ѝ CR_o$ R  B0 S $ PRPPU8 0BQ: `PP$ RPPURP%X00S PD00P \[ TP|[  0P \ `PdP^[ ATq [H S ` P$0c z P 0S   00S S0S S ^ S@@T000S00Si0\#00% ^@ [ @@ S@ S80h0 ₣0则-0D4 p@-@PP` U 00F Gw p 00pt060 ^UX7<0 U 0@0pM0TSI003 3 - M0 3/Ѝ/0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ04P0  00 2 2 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ04h0\ Ԣ00\ ͢1 1 p@-@PP U 0S S S 00p@/p00p@/p40t ⦢00t ⟢1 0 p@-@PP U 0S S S 00p@/p00p@/p40 x00 qd0 D0 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ0440 A00 :/ h/ 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ0440 00 . &. %0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ0440 ϡ00 ȡ- F- E0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ044>,□0Y0,⏡, e, 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ044K?G/^0a0G/W+ + 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ04iS?O/&00O/+ * 0@-PP M@ T 00P00 Ѝ08080.T q[?.* l* 0@-PP M@ T 00P00 Ѝ08080^/ޠT [?^/ՠ) ) 0@-@P MP, U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ044>a/⟠00a/☠) ( 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ044j?g/f00g/_( ' A-PP`@7 T- V: 0ppgS S&0 03/P" W 0  0A/0 03/P W 0t 0A/Co<0<0m/(#[?m/l' I& *& A-PPMp@`2 W8 T& P R P P P @ЍPX 00@R X ЍA|&w?q/џ00q/ʟW>q/ 9 P` Y0SP@`$q{% % ^% _% p@-@PP U  ;p@8080,⎟U ?,⅟$ $ A-PPp`@, X2 V9 T P  R 0 R 0\A/W 0A/|| =/Md0d0/FXLL?/=V0?/4# # x# T# A-0M@PP` 0J U@ 0pS S P R`V V V ЍW Ḛ 0SP00Ѝ W` 0SPVll>%.ڞT0/0%.Ӟ K Pp%{! ! ! p@-@PP U D p@<0<0/⯞U$ >/⦞(#Sc B P_^p0Q ^ QC =(00H0S 0Q* 0F S0S 0 `  0AS"`!0}@T`0\0Yp 00(00@$ЍATw0S@A@"@pZ @0Ġ?  0^0A>Sp0pS000^ 0AA^ AN[ ^& SQ0SP5 Zp? 0.$ @C /Q Rv?}/P⪘ꤚ00@G0?Q0Shv?}/P⑘ Vw*p.Y P LP m?.P~Bh  p@-P0 0M0 10 `00Gp !@p < 40 0 1 30ލp@@ t A- `0 0M P0 10@0 (qp 0 p0 (0 0 1 30ލ?  Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ (000 R!  Q 0 ARL ?R@- RQ0A  RL ?Rљ00Cʙ(00/C/G-`@pTY( V W TP@TY 0P?S  00藙(00 QSp@-`P@ oP`VP@  0R p/pA-APUQ?UU@A`pp W ڀ1APT(00O00K?00Q A@-?SSRB 0@S A000+(00/-- M ЍЍ/@-M@ p TЍR/0-S0 \ R ^000O-P MPp 0EU"S} `@ᩑP-TR +T| Y >p]00D`" [*SP# K@00D P a0D0SW0DA0D0S70DS| Y[SP;+Ꚙꕘ0S \0J0 ЍY@0Td UFap P 0A0C0 A RSkUPPh]`g>pa00Dd000 S   ЍY @0T+ U#8a Pp00D0T00XS"@ 00DAA PQ0Pp>ck p>cP0?0 ,CPp>c00D[00XS UPpb 0O00XS UpbPPp>c 0@U0@PP1@ p>cP433 p 00M 00Ѝ O-@SM ^ YXb 0pS000!R !3  PP E`#3`9P*Q30A 0#1#2#4#8  P8   ඖ0 A 0U0 pQ5PP 0@pQ 0S  Ѝ蔗T000@0000@0 ↕ꅗ00004 A-@`Ppv0 }Pw$0$ 0 M Ѝ꘹ P0 0p@-00St@@@pdddPP7&@P@P 0000 0` tdxp@-P@. p@G-Pp`t@t0@l@  $ U  40 q   G | ( p A-P p@` F  }000 @P p@-@P Ppp@O-MBލЍ P (@P  4/P Q Q 0 0N0 00P 0 0 @z P 0S 3/ H000P i;뼴    a(a0@-@P$MP U! 0 P% 0 0   0P $Ѝ0XX<0H X⃓U<<|0H Xz@Xx ~T O-@PU  RM `100Xqp0S@ @@@ PⰀ $)A0PS,00a000S 000  000 000 000O ;@00044<0 X ( A-pP8  0S@`$ 0`S @0PP0S `V @P @V000 zT@ 0@ P ((<0B/Xdp O-RlM 0 4 吀0 R X #`000Sa# 0S00 *#3 0 4 4 0P Yڀs倳3@0p P0V^ p p @QS  QN OP0S h @p $ 3/0  0PY@@RP00SS" 00C0T@lЍUxB@@@0Ld20\ 0 00SN  R002( 0 @ (,03 @p 0TTsP 0S 0@00D00 0@0cP 0 S PW @@(0XS, @ , 0 R1 1S@X  1( 0 @ (,06&>I/X͑0S XQ?I/X@lЍE?I/Xⶑ@^(  (,0꼮 tD\`p [ZL|ZYLY p bD aC-L"`H2 DŸ0M000P/"b1?2cQ 11QAQ@PϠl R QE00å?8@ 0 t0 30|Ѝ x?@O3d11 "@(,p0p P$;.#"0.cR:x.c2Sp>  PP 0 0C@aa0C0C Cr  \\.N2?#c!!"N -  ! bQ@.5:bQ,. 18.#c!!2N0 ] 0@ S 0Yv0 `R 0o S `k 0@ E``0 S0C0t  B1<0Q/,0A!b0\P  @8YF0 `R 0? S 0  B1\<0Q/,0A!b0\P  @Y%0 `R 0 S0 @`;Q0,0 0\P  @Y0 `R 0 Sh0 @` (;Q0,0 0\P  @Y0 `R 0 S^0Q!/ b !S: 0,00\P  @Y0 `R 0 S>P:Q0,0 0\P  @Y0 `R 0 Y% 0  @h`@0l @`z9 0Q,00 \P  @\Yj0 `R 0c S)Q2?0c01Q 009 00\P@0 @<YJ0 `R 0C S8Q0 0\P @0 @#Y10 `R 0* SP8 Q00 \P T0 @ Y0 `R 0 SU,P!U(P7Q0 0\P @0 @Y0 `R 0 S~l7Q0,0 0\P  @Y0 `R 0 Se040080 0<00@00D00000 0 P0@&\P Y0 `R 0 S> 0@?0@ S0ŘY0 `R 0 S'Y@ 0 `R 0 S00&@2?2c  1R11Aãd0Sâ/c1S0c0l5\P00 QY_0 `R 0X S 0@0   0  +00 S0R05`@4 0\P 0 @%Y30 `R 0, St0 @`0\PS0044 00 @Y0 `R 0 SY@0 `R 0 S0 @` 0@S0 @ qp eqp  0@Sj" R-Q RuŸ0c "QY22"0"b0@h0Z YL `Q \P Y0 `R 0 Y0| @_`z0@S !YrI0`Q0i R`eUPy 0@S]7 P  P Y 0 S `Q0"PE0@ p@`<0@ S~ 1hY30 `R 0, Y꼧   lP)\(\ ףm, < d * ( h  t t 0 n8 $IQ 0 0@S 1Y0 `R 0 Yu 0@P !  P$(,p0 VR\ 0gS 0` ` D ! D $0L! P?A1c$(,p0P?"dN2c 1 11N @1?2c1Q11@  ã/ d0 S  á/c1S0c01\P00 kYy0 `R 0r S042Q0,00\P TYb0 `R 0[ S  ` ` o P 3 \2A A-MPp@`40@0 p0000@p T p`0FЍ"00Ѝ(@- @MЍ踓 O- M`p@P댠 cP0 X X0 00p0 @\ Ѝ辍@ Ѝh HO- M`p@P눠 4P0 ~T000 p0~@. Ѝ萍@ Ѝ謒 H@-0N \0N@ T \vT00\m00p@-@0M-S` +S`P0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-@0JS( MS 00C S!00 [?P 0/S 000 0 0P 0.S  0{P 0.S 0 000n@0 d m@-10#Lc\3j*0Sn SW @Q 5?0cTa0@1L 100\_?L1ceSe aa p@\0 0 @1\00C L``S0B0S0B\D@Ql`LPQ S5 0S``Tàn 000@002c2cPÌ 0;S0C l là0Tc\0#3S l là)\P*Qgfff$I | ף404 @-0,@ @M ЍX P0 0A- R`P`$0S@P 1Pp@ P  tp`;190@-mΠ0l6@NbG`122d3c@By:E.€Q_uk9"mnףp= ף Sc$IųQ\(\D Q)\(\ c 0ׄ0 ):60 0($0(>! 0)Q` _P!!!0C0 YÏ(" ?00 #2>PVX c 0㩄 ):60 0($0(>! 0!‚)a!!!0C00!YoÏ(" ?00 #2>[?G'PE@@Gp1#! +"Q 10,U#1 ?0 25:$20 #4"".<2Q D2 30 #1d0T\`"2? B4sppp0/SX0 is c 0?"):60 0($0"(>)Q!!!0C"0Y_("Z0%R^PVXPo`v c 00#&: 600+$0+.P3& 1110Bh#`V:+"#2 >t3P0 PcRP@ U0#V B!a!b0CX0 c 0݃$):60 0($0!(>@$ 0‚!!!0C0\$)YÏx4(" ?00 #2>0r/D B  1?A1c1c0R@ 0B05@ @ 502c,%2c2A@" "b1C S/  0@ p0\X%`;#吅  00u!ό#1 W?0|:5&  +4Ϡ! 5+111A V 1# 00! C2 ! 02">"`V0t&`000  @000TP@DP0S@ @0 @ 0$ Ѝ& vc 0 #'):60 0($0'(>$!!!0C4'0Y)("0,".L<0@0P<0000' 0 P<0@0PnT 0 O-@P`Mp 0S+  U 0&ZP? ԂŸ01# 00 0 Q 0  ! P i800Ѝ0 S! 01P0 U 0UPz? ❂!01#. 0!U00 R㨡!h&0pP l6m&NS@0HSH0P0 0Z0d 0S00Ӄ!10001[ 0<zhhpPx@2[ OX10\10 01@T% <T>0pS0S >S@p=S*S0S -S0 C R@0H0010H 9 b@N h&lFpFtF0 h 0@10 0*T@T -T00D S0@0JSl0S,S  ;S  RfH .BL S] ,S;SZd00PS 0,SPx@PJ 0SGH  L t& `h& lp& u&g.l600%( ,0P ş pP$D $cR-:$cR 0#031d002c2c# b?0cXZ  ^  RPp N p$lpLP 0H$,0P 04,004Pğ P0 #cR":#cR 0#031d002c2c3?0  cRp c sP  R PP# x3t3p301c00,^004P0@380@00000 00N  0h @ 0@y @u 0048R'0  Z0S  *` ϠϬq^Z R pSH H D WPE&@@$[j( V.i5:IPI%^ 3#adO0RS@lXEW`` ( p y@F@Fp pX%HpI@@HИ@'Q_Y$AXO@P1:H.BXN T3#dPPS@X0 pTHP@1S\p WPE` 0 ": 600,0!,>00Cࠇ0R?#00 nC1( ၢᡍ H 0R0`(4&^  ((`3`#`a P p WPE  U6 00c\;S9;Q$0(080p P`P@Lp40#XT YV V0Q#`? 00?0S 8@<V 80<8`<  05/P `0Z\ QX QT Q{P QwL Qs p0pS P Q(% Q!S, Rl0S Qh 0 SeJ1Fp Pe,Pxp BrIX 0S@`TJ#M @A 0S7 0N080+0z+P0P㧾 0` [*[:[$4[4*[\4@E$*[OoB@#[1 "*[$![[*[[ *[ [$Č*[[ *[$[*[ *[$ [*[ Z2\}Q [ *[$ [$ R S X .`,^TE 0 FC9 0PS.`Z00æ0@T )9 F0 0 30LFۍߍ0/S <0BQ 0R/S  8P O(I@@K0 0c?PUV ZSZXQ  @,`3ODp $(004U? \0 4 Q"<$1Vp- ⁡ZF` R!X@0( $,004`^`Tz  \Ot`0\ \0$0\4 \$!?8:[ S^0J08*S RY RYP 8ZC5PL L|p@W P0E+C;E?. @a 0Z`0Nh@@Z {P0Z00 @PW a 0兑`Pr VP{P  {P0/SO0/SLgP0/So C`Fh QP{QPv Q Q@Q@QDQ PbR8 僯AN h 0 : 0Nh    Q!j@P h`p  $0(P0 ^0 4Q"<$1 X W  Q\ p W`@0^ ^04 ^$0^$!? L\ @dj0S PW$@0W\0 S -=0- @0 R s Q t̔<\070A+- h@0`RTRPP0SZ0P?0c@T`↡a`Z` }Tx``Qa00=00 RW@0# C !pk~@pZ! A $0(PpPF̉S n 1 R Xo0!0S 0J0B 0 10S01 R  0SO !0S RE00Nh~0 0P00W0 @0A$<02sp ,僯Bd L @ 0a P 8 hhNA-pQ@Y 0Sl ɀ001N  hh6l6}`P`P 0:S  KP `VpFPPU N hiP0T`VNLg@`_ S T 0:S*S+0C013ZS@Sa0CS[`P ܢ p@- 0P0@P@MPp p@|h 0 00P/U t,0, 000S  /U tP/ @-\F ! L3/L2S @00P2S T? # 3T #0R00P0P@T@@P20CP2P2SU PCU Ѝ\00P2S `@T 0400P2SMMMMdMLLXL LK A-`!`\1 0M0100P0Q0S@P1 V7 T=p`0 80xq|qQ8OT8@D@@@΀TA `pP1`LPP0@ 0 0 1 30ލd0P0 ($vVHQL0 (vxT 0 = < ܉ 0- 0 M Ѝ$< @ - -M00$  0 0 0 ЍЍ/; 0--M0 qЍЍ/0 0p@-@PXk`00CS`0p S  P X0` X PXkpXH`d; (\ \0 `00CS`0p S P X0 X /X ): (-40- M,0  XE ЍЍ/P: (-8 -M0 00 XLЍ Ѝ/: (G-@SpP\ 0S:X' (S" WH bk0` V V,* Xv0p0J0/PM`IwT000@00 `pp`/P,0`VpC0 00 7k +v0 0SJ 0 00(kQ40 up0=0  uIqPD@0 u0 0Ck Iq ؅ --M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-PP aM`@8 .pP& vp@P# d0P S00p@$ 0,0 0 ( 0 0 Ѝav0000@Ѝ 0lЍ00>0 t\7 8H` @-@P j 0#C@j0;0 zt$ R\@-,p@-@QPI 00!R ! 00! \ P 0B RQ`' Q0AP R 0 U00Sp[hP hP `hP 0PW40 )t 00B(0<0 tv 00 A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`20[ 1!pP  w0S<0[ 1!prP  w0S p w0SB0[ 1!pT w0S,0[ 1!pE[O[Mw0S0[ 1!p4 P>   w0S pT 0[ 1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% 0[ 1!p0 *R# 0B Q@ 00B SP i  w0S  p q  w0S op  ;  w0SV0[ 1!pw0S Rp 0[ 1!pw]0S0[ 1!pw0S0[ 1!p~wR0S0[ 1!pqw0S pw40S0[ 1!pXw0S0[ 1!pK pu pn pgs R  0 0pZ  [@ 1, pJ pC  w0S p6 0[ 1!p  w0S0[ 1!p I w 0S p J w0S0[ 1!p }pD vpp T  jp$ cp \pI Up)_ w0S0[ 1!p] w0S0[ 1!p , wy0S )p 0[ 1!poE w0S p$R_0@' p7 w60S py 0[ 1!p@w0Sj0[ 1!p3w0S pXw`0S pL@ wC0S p? 0[ 1!p  w0S p* 0[ 1!p p P  pC p pD |p P  0B Qc@ 0B 0B P$R= w' R 0Z0p @0[ 1!p P  P  P  P  P  P  P  P q0 S p 0[ 1@!m P m$R@00 P b P ]} Pz Xx Pu Ss Pp Nn Pk Ii Pf Dd Pa ?_ P\ :Z PW 5U PR 0P PM +K PH &F PC !A P> < P9 7 P4 2 P/ - ^  P( & P# ! P w0S p 0[ 1!p P  P  P  P  P O-oMMD @/0P0? PL@0060 D0S 0P00!R !0s00d00 O 0SL   RR l /0 0 D   ܰ00040, h0 \0 0G?@$匰H `00@T `%T @T0PFU~ 0pJ0(0QPPu pT 0P `@r01(0 `0 0EZS00PbP   R00s D0S< P=*X1RRXOX`>pTQ`C. D`Pa,`  : R 1P0 S0r0<0qV ]00,P0R00S 0 ,P `S-0`r020 @\ sMdpk`pGWdW3  r0WX0PP@T080@0Sy H008 @0 10R0bB+ S- C S!!?/.BcSC0P0`EpB00Q0@N*n0 BPk   B.Q r0^0P Q0` 0 0YJ( BZFZ#匀 0 JZ R Q  \ PJZ$0$ 0  \0 S0u$0 @ R| R4 Hp8 @GT@T ڐ 0 R`@0 n8TJZ^\8 Y`   d R0M  @ 0 pGWpW ڐ 0 R`p0 ]WHXX f$p``@HX 0R`0 S \000P>0Tڤ$ ⌀@DT 0R0 S [000P@DT0 8'0 P @ 0eS0 [000P$0W[000Pg  R dPM@H00Q@`0 S [000P$ 0HLXh0P08 Rڼ匀  K[0Q0S  a[000PK[$0 d0^ 0 rQjQS$0ld0VrT  0WX0#S] .[@@PZ08 ( 0PBU$U4j$p`@PEU 0R`0 S [000P0PEU0*0 PP0 Sp<0 0S$0&P Z000P H0$ 0C`0 A0@P0`08Sq Z@@Ph >00 00$ . 0 R +0    d   d 0 R   0|@T= H  4 pC @s0<0\0 , R MRd  d`0!"0 , 0f 0dppG,Q0 `bSdp`F00dppG`pG,,0B<P-0  P0 St EZ000P oS0 9Z000Pdr0Se 0rQ00$Z0PO$LS Z0PB$P400NS `Urxn`(`0P@p0X@T@8@@0S80Sp0pS@@X%n$p``@HX 0\`0S Y000PHX0 x0P0  -@  RC ,0P 0P0 0  SL0, L0Ϡ 0Sq-0r00SP @-TX  䯟/s@  XP@@P@T 8pUT`ڐU@ PEI@D0Q 0T8 BXX ڐ0Q@0SXpApWWڌ 0p`P@JZ R Q 1Y P\JZ$@0P` pT 0^p0\S0  Y000P8$0S*0$Z`ڸ-$ @⌀JZU 0R@0 S X000P 0 X0P$u 0D \0f% 80D \(fl`0`S0$6R ,0PX SL0,  !00L D, 0 P  00S0 X000P$0"_4`@X0T0@050\Myo\ { P8 @TX@ `""   . B Q/\;2#0/0 0 !.BϠ # *@ Qʯ P  A0F,FP# 8 `P QP Y <N8""P 8@N@8@ @ `N  BP(Q B JQ/P2#΂0/ 00,# $!L Q. ! A0  @8ϠBP!.up p0D \Eex00CH0&S0_$0 ,, s 0< 0 <M,dp\ ,P`pG`, @0ojo ^5 ,  r0R]P @[@  S R ,0PϠC 000SQ<+W;T ^3 ,0r 0SϠP SL000 ,pL0`b, @0Bj? ^ ,  r0RP @0PSL , 0101,0@0pML ,0,    S ,S0;$0+; ^ ,0r 0SϠP `U2ڀf` `0p@P0rXT8\0S 8  B0S0S S0p\8 TX@_4`@@e`,`S0$0S  L000 ,pL000xex`j S |0s8 H00S0$071SH 000S00G00$F@ 00 ER0 nn"!  00Bh00?R0SF 0h Srpw@p_4`X@T@8@TPV0P$80SpH0pS@0H00$0 zV000P qV000P ^~ 0, SrP  l PS,L10L , SL0, @@L0,p0^f 0S r`P @^O 0, Sr^P ^| 0S r`R ,0P1 ddR ,Pu V000P 0U@000P '000 a`$` Q`&  .! FtQ 0#e 0 M 60 c`39![U@000P S  L000 ,pL000U000P L0 RrL0@ L0 R rL0?@ 010h0X@Tdp@pG,ud ` 4 M M 3L tI xF E dE A ? | t = < D; l; 9 9 >S 1(0P`Tp x0@ #RppS 00C?@0oS$0qt@d@pp$p⌀@DT4 0Rp0 S  3U000P^0 080_4`@X0T0L000 L0PSY U000PQ =!0  P@0 |@n? PecP 0p@S 0 @00#L 0L ,pL0PL0,,L0 00rRL0g0 PlL0P00L0.qL0 00rRL00 PUP$$0D \bx00CH0XP8p\V`!GL0LEG040d 0 0SL0,L0 00, H 8 BR@ c@`0`yyT 0P$,L0 RrL0L0 RrL0&@``0A/\aSo , ,p1'h > 00$ Ry ,P1^ ,0r`0S @]^m  ,R!r0nM^ ,0r`0S @E^>  ,R!r0?~@@L0PL0 QQL0PL0cSg|@$0a0 \UaL0 RrL0xL0 RrL0L0 R rL0$P @ 0D \*ax B0?V0H  @ S,L0L0 00, 40D 0p 0S*L0 ( L0'L0PL0Ϡ<S 0P|@$4L0 RrL0L0 RrL0L0PL0L0 RrL0L0 RϠrL0 @|L0 RϠrL0o @o 0@00p0X0T0>0S* P,pP`00E SIpqp00A S$Q0!S- 10P`b 0 0]  S,L0L0 00, 0D 0pkS,L01` `0,, L00D 0pU 0SL0  L0 p,P#@-` MHP@pBV<0P000 P?V Ѝ A-@P`p)V0 P*VO--@0pj/ H30P (  O{(0:j0P00JPP+   ! G\,0P00b00P$@ 0k0 ~K ( {{[F8N:N0CB:N@:0000 R0 R Y Y 8ƋF* ,@ 100@QN0S ISj 0,0@10?[k[* Q BT@,(@2Z 000SY 9U& PP00@P X0S0$&R0!**R 0P000$0y0P$@?@0 p0< RTڪ@,(@Z 0G0SQ0 R f Yd Y S` p`Pd  P9U $01P00P00S YE Y 0p[P (@,@@,(@ZM Q QD Su0P[p00C0S0Sh00 S000 p @(@0S0SP 00r0S V00S>0S 0Q0Q Q p 0S0$0G$&R00$0?0!**R8 0P000$02100@0S@(@P+ p0 0[0S0SU #G00S Y Y P  p0P0 4[4 0090 0pG04a^ pl0G040S @(@ 9U Z$01PP000 0009 0 00400@- M@P`e[ p cZUT 0S**P  SZ@N[p Ѝ @@EZA[p Ѝ$S 9[T@p5[@P :#46*0/Q /46*0/P@-@00 R@P@Rp@-P`0@0R@*0Pp@  R 0 R Vp@ !0@20O- M@SX@DPa`101 0lUYq`": 06  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ`P0-UM0P,@.0L10rY{ {{{0.y      ?Z/Z   @-KD @-, @-p@-`P@ TP 0FP R @P  .Y00pP P 0?0 XP p@-@P S`pPP  Yp0:0 X -M Ѝp@-@ P` !LN/U !@Ap- Me ЍP/L -2M")2b3c1@2`1  0hЍC0@-@PMP 0 00 0 Pp`Ѝ00;0 W 0p@-@Q r  P p0 S 1P p PP   ! X @0O-M`pDI@0D0Q0P+5X! @0S Sj @   b 0P18 P T@@  0  WT` ЍW Qz@ 0Q AX00@P00  j 0`00QB@`VRTQ`p0 0"!` b  V0 ZT@P@0Q=W 0000! @TQG 0P02@0  000X"000@000, @i 0Se0T0 2aPPlv"! 0#000 0 0 @ 0j`@Pp !R/0S 0C0/ 0RA-@P'`Bp1W@* R0C@C   %WV X@p@p0 `f360@p1W@:b S PPO-p -M0 Q '0l0x0 0 Pt0-P000P00 00@ S0,0r `@ a`0`Ft@00@ STT!Ђ 0 B0SpЍ 0 S0 EP 00Sl 0 $@ < SV ?o240$ 0R0$0jTpg{p TGڬ5j0f1k5ZT 0 S 0SB %0dS{ 0|  pDpW!0Sp ,%W 1  @pPxL |0p0 pLW|0V |0 0p|0  A R8 ( QqpCW px Wpp\ws0p000,0( S|  800S(08000 0$ 00M `۟<0 﫟T˟ﻟ 0H0 0DS?<040 B 0S0$ L0D@_ P  H ! \Vx0T P x   !PVp@|R PD0P 0 X$0<0 ( @pC0D$ pW pGP/ `Tx 800C|0p PxSt@P5P t00Ct0- Pt00t00000x l0 !\ \  XXQ+tP0C0@00a` 0ES00 0wx0000 00P0(^  < 0H`P00p 0P00H `00P`@`t`00`@000 0 `:S4 01c:6||00` %4  0!{5Sl 0'0  H P 00pP0P0吚00cP0相 [ 0 @0 X54 0  d{  A1{'kl00 {'0G GP] `T(A4000 0P000pP0n|0050`0000(P0l0!S!00 `Tl0Y `Ti 0S x0p   ~}\ t(   B!0p| l0Y `T^!0Ul00( P80SPU@Pj PPr0S 0S 0 00x lT Abg `Tx 0000(0|0P0l0}*$&%&x*!z(GH pG'U!08 l000#Z00S5x 00^ Y^ 0l0U0" R   l L Px  pP1XPePPp00p0!0l06 `TQ80( lPS |0x 0Cp|0Kx0! l  R!0S,00,0000|0x 0C|0 0pl0Pxg@-00O-@ 0Q@P MP `PO p,Q 0@  "($(!(  X"8H XA3pIqW K "8 80W#8S 0Y  0  0 Ѝ@P   ! O#``3ß0O-M 00@Sp 21`C`0 00 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 Y \ 5 Q0R i T0#03\0SWe* G0V*0F@S3 F BS   3O0WQ 06S OW*@DPD@ Q0A Q0Q l l > U00XS Q0Y j00Q )Q 0Ѝ|<^0 n 2>0 00 R)AoᨂX 0v Q>0?0l1 c 0R:j O-M<0p 嗾HJH:@`00S 000S 0P0S EA R[ % @E  \  P 0PS8 Z@@@Ѝ @0Q[V R 0 BPS10W ^@0D0CSڣ0SqP [ IT 0 TD\ @N Q T   @T 0CC10B3P0DS0 SE@TS@DTDX`  `R ߰ BP[10@0+S -S0 R: R800BA\ @@!~s 000AS0B[0bZE^ @d\ [ 0 S S80S 000 0 b@0N"00IZ@0E^0[ @T0 QL 0SP00S P3 4^E *@C $`P D21 `2 Q\` V00 00S@0T@DUQVD`b 21 8PE : @0T0 T1 T@00@0PS  Z PEP R, 0 R Q 00PS00= 0@0@E IP 0 C0 RZ@Rh@DU 0S{ S SUUv E Pq C0C01` Ѝ00S/0 R /@-pXaM@`PB D1P5PP3 ipP-0S  Q4 p 0: S-QBP  8#80 @0 $ 0, ( 0 0ЍH00Ѝ<0L0E0 FH00~HO004 8Hxjp@-@P l<00CS00 Pj<pP0=0 SF@-@P 00CS00 @0I04 ;Fp@-@PPD 0rS= wS+ aS3`0S  +S" e0C\S00S``p0S0S0S`0`SG 0 p`0>0 Epp@-@P8 0S< ;P00 P! !' 0S 3/PP೼000P @ P w00 00q00`aa;\0`` 0pb^9P,080 EG 0P0@-@P 00!R !#P 0C 0;0 E@-@P 0 0 S @(90;0 qEhp@-@PQPP 100S3 0  RP 4000S8 0"$0 3/0:0P3p00P @ P 00< R 800p@0Pἵ9K᷵8P009\0J08 E 0 @0 0p G 000@00y <-Ѝ/@-@^S S S  \0 @b @0 @fF00 0 @m6@000 0 0000/@P@- 0At @F41Sx O-@ MM Q 5/0Q PP $d |@ h|0g'( $g* ph ` 0 Pp$   T`  8 X| lp`0 tP  !p$%d),P 8 $10-` (4 td8 T59ċ<= "< # &'(* (+p. x/`2 |h3P6 lX7: \; >, ȋ? $l` ̌+$a(!`+" 0 b"a +4k+b$! 8 ,` k"!$  Q 0pkP4Q 0pkP*Q 0pkP Q 0p{kPPQ 0ppkP YMߍFEOCEp,qMߍ/aQ@-P @41S  P mP0"EA-4!@r pPP/1S 0L1弳 @P!嵳GPPPUQMoPP PQp ᛳW Dp_oRDpDppp@-@P PჳpPA-@`CP] VapP6PQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ  V fDPDbDPSSO-P M1 Sz$aVp$q q(SSp A`TR X`D (0Pʀ 0S `(q\ 0{ @P A Ѝ C$oB/갰[" (hr 0^ Q `VH$ [ pVpGp@(VJ ($ AT$$( 0 [ `( A^% \ :0 + @PC@@,A 0 S$1N(!r5 V(* T$$$H0 A( [$9(~( 0Q0 0 $A$!@`$ A(aV 0 $AP(` 0 `_qP_ 0Sp{$VHO-,M R0  1 rp3/,0 (Q0 P{ @`P@P^$$P 0BZB  @PUpWW 0 `PS @R㲀K PUJ[Mp p,Ѝ 0 oPPu6  $`p$`P  0 ]`P) @R㲀 BP  P^ ^4 ^%  gP 0  jPp@ P`@@,Ѝ 0 j@ P@⁠Ằ[ PಐU 0I   gP(A DR 1V(Q0  oP 0@-@ 0! \ @!B,B00,1S@-@0 @  B00,1R@-@1  0@qB,kB ,!O-`᜙0S ]M9 pPwԯ@P Uq   @{ NB0S 0 p/  ,p  8p4 0 1 D@@ @& P XP $V  PpW4p^ Z !3[@ @8([[@4<P30Ʉ  D H p $hP00 A G, <0(  Q PVY[ P  0~p pt 0~ V% 0S" A/ 1L*$ <)$p++ *<(),<('4 '<.0<.,4,<0!4<!< 0!4<!$0 #<$!<($0!4<!(,!4<!,0!4<!400#<4!<840!4<!8<0#<<!< <08 8 8 4  4  | pp ̀ 4 (  ( $4 |($  p, p0 ,0p4$( ,, 0484 48 x< @ < +4  8| + ̂0@ >$@%0S 0@00@@Pq@Pn @P @PdR0a@?^|e Ta| tHt,O-@(P`P5f10pSp(P6 R ؑVP. ( ,0 [ D`D` S`1005,`5Ohꂡ P ر % Jh> _ؑ@-@ 13/, (Q0@-@Q /00 2? 0 O-SfM `$ [pW 00!>0S >` ?-P  9-`P pW0!10 ! 0p< - -G=O00000 0000 -0%L00KPdd0 ,;w?q尀Y 880b1*@-`@MpPP  -00U' `P$ 0S r?(p0 4" 2 pЍ -Ѝ -pЍ=00p 2/QA-@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   *<0  '  P        P  0  V/0 0 0 0 0   0 0  0  0  00   0ЍR 0B8#8P P0#0BR0``      UЍ40b0 $: 0(0S"( S:ꠦ 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80 `PT  R R8#8Y **P0 Pg1 "0C @fT㴐:b 0 0Aᴐ@DT@* 0H$H @DS0COo0B 0 xp@ 0S0C@0  P 10CS0R*8#8STP@ I!pP 10CS0*8#8SE 1 F10CS0@ *8#8S"P !j !eTr*H$HTtPZ 20 2Ѝ4b0 $/T !4b0 $/ !T` }!0 0 P-  0SB L @ `S: Z a!q,`W@ H$H@DX F Q!qWo 0G 1 P AᴀW@DT@:b0 $7/p3b0 $0/ .! )! pPZPz 3b0 $/02b0 $ /D@W1@H $H @01p 1 0@1@p01  h @P Iy0  X P 0 r@T 5 T/000 `    Px ,` 0R pW  뼁V@D 뼁0V% @0H 1 PX XR   B1* 崠T0@D1 $!0I@D*0t崠1 加1 0 { P- 10CS㣐:\0b0 $h.  e P~8||{z8zzw@-@PM 0 0 P Ѝ050 ?.,wO-p"P2 JM0 M@P`040g VW00?2$0S 0SNIPIT/ O P 000H"<2 0 4 30Jލ Ѝ >X@00 0UXS 00 I;s0, T:)[' P0K/S  0ݵ00P0: S /000S0I S/?00 1X0 -QP@PV# 4- Np!/0SY  \0 RK Y P/00W ᘵp zᗵP /@oo4 G8 tvpuXuR Q0P:Q0Q:q.@-$@-@@w $ @ p@-@P#)P$  p@NG, S d0@-0 M @ 0  @_P 0S  ЍsO-dM@\0P T 0. \$.\p @p.\0  (0 .\` D`.\ ,-\ 0- \@H@-\ 4- \8-\ <-  \PLP- ( \40 0 ` `0< ,@8p$0P` "  0#0b0 P%a8 p'egH` ,. alngx+b(*`gLb0l$`&0feX)c8(n, e cl fj!쬊̉b,,g|*gbH  ,l*錈e\(l$gx" fe!c<+b(*cig eX(enl*c8+bL i!c fj$ n Yc:0 $6&600 $,&hbL0d p$&L0 $&`0pW^][YYxYXYC-Mp`@P' PP"  0   Ƞ  ,Ƞ 0 !! 0 04000000 p@PЍЍO-M@ 8pPPO 0 0 رR 00㲱 1 1`0CS㣰H* 8#8V: ر ,`PF 00 0000000Q0㲱1 P 0 0<0 00!&V6@PЍ/Ѝ000100@P,bL0d ph% eVO-`0\MS0:℀p3< @0‐P(0$  r@T X>*1 #0C8 #  b#Ȅ 0 E 0@ 0<S@@ a,^p  800|8 00,0F 1Pd `V 0`h0 &h0CcS00 p㰑1 0CS'*0$ S 00(0pP `VP 00 0 00CS001!R p0p  0  00#0VS00 0 IY㩐* )ቐ 0 0 0 LTPH0PH2/ 00W p0 01p0 pp ,0!0 B(S"8110  p"      0<00@pS- 0S 2  0 w  o ka0S @ L3@ 00 ,j 0 S<@p  L H D\Ѝ3<S00 01040封HX㨀*004 1pCx0'x(0qqᰁpHX㨀*0(03<S00 01040封H⨀X(*X 0 08#8S:00H4 (0 岁ᴁqpGpWx'x*W 0 08#8S:00T#(@ IY㩐i* 8#8V * ("( B``F  1`0100[p@   @  Z`V<@p "   p    D$D P 0 0 0|각HX㨀d*(ሀ10406각HX㨀P*(ሀ1040RbL0d pZ# 2  0+ W)A@P00,bL0d p?# bL0d p7#0bL0d p/#IbL0d p'#pybL0d p# 0!VbL0d p#hbL0d p#Lq0 $#@pKT UUPNMMMMTM(MMLO-M %@ ,p0`Pq0 p VPK 10C0XS%X:*U2 PEpXXP+U px'x p @P 0#0!01p0 P [ pKx'x 0m0p b$" 0 0Ѝ 2 p  @[Q\@10CSP*8#8TQ 00@Ѝ P   ᴡj PP ]뼡 0 W0 8#80CQ J뼡P W 0J 1P 0ZK[0嫰:2b0 $/" 2 p @ P 10CS@d*0D@ 1 PPF 뼡 0 W0 E@ZTj 뼡0 W P0J 1kP ^1b0 $!1@DHPE$H up@! @10p  JP 10CS@: B01b0 $!A  ?0b0 $!0pPEu0) 1 01p01 0P@D1H $H @U0PE10Z!08#80 !hMJlIHHR0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/x @-@P , :"@ (! 0"F2O-$M p0P`  (@$\0 0 p 0p pP`@  "l(,"$l$" %  0f  X Ơ d,  .d, 0! \ p p P`@ 0 !b!!    !`.  . "  @X!)!   $Ơ c,c,.    000 00 0 0 00 000000 00$ЍFtE 0G-1?p@P` @g(X, p! 0P0 0$0@`F0($0`2#?V@F?p@pp& 0$ <@P U 0$ ?@PP?`V (D! 0$ a0 0$ ?V@F?@(p@ 1! 0$ <@P U 0$ ?`@?V PC-@P MP) $ap6?`V&7 ) `0(0 `!W``Āapa8!#4a4# 0 Y@h  ЍC  08R(@R )@ b (`8  )8 b (`R @-G/ @-@-@P 0  @ (g 0"@R @-(/r @-@-@P 4@  PG 0$$X@ O-LM( 6,p0`00( 4^_~?<$P,< @$ 0H@0@8`8@40P`pp  00$(0 P00p`$P`p,0 4E e0%)'&ɠnj)000000%  &') "ˠČ ˠČ "  (0 00#0')  ,  ! 0 0 Ϡ' . (̠Ì  ! $ $ ,  ,  ,0 T(03`0~?008`@P p480   @0  @$ 0p0 01!  Q!声#$ ,኿+* / 3< ( +1牑 0媃(३1p>ဦ*1砹 1ᅶ>%S 0#] P% #$7$ ᇑ90#  ..YW([T0#P P[T(P  P%0P P P%P 0!(pP00,p/!~,! rp', /!!0 (,#p'\ )S  $( "P p P% p PP%4pP8p p0 4PR8 P(,P]<` 000 0 00 0 0 000 000 00000 00 0$0P(0$P0(0,000,0008 400 408 <0 0<0LЍ?=p@-@@DQPU  0pRPQp bPPo QP0P0H @ p@FR Q bPP;p x@0G-1p@P` gPX? @0D 0 #@0D  H00H0L00L0`FP`P6VFppp@0D ;  SP@0D *H0L 0 H0L UPP`V Pt@0D a0 #@0D H0L 0 H0L VF Pp W@0D ;  SP@0D *H0L 0 H0L U`‐V PR @-t/G-@PM ,PH8 I `p `  U@ Ѝ@-@P 4@  P 0$$86R @-</nG-@PM PH(  `p ` U@ Ѝ 0` a!, a c,/0@-M0<P0 P:7@0;P5zP DP6E@05P(6P &ڼ6P 0P0@$  004 P0H p Hߍ000ߍ0?CPq 0P@  @0H 啎p HP ߍ0L0@$EDCB4P0@ PH AS40pH<,+*)(&% @RPA@  0@$  00P\vb^GhFdp0@$L+X0@$<@0@$=951-)3/H㭣P H㣣P h0@$,H0@$|00@$d     d0/00 0H pp h0  00 0H _p D ? =@00S, x0@$d`0@$]P999T8d6h6L606T5055 ip3L303{G-8M(`pP {{֋@W@V@U@T4 0S !Q4 0S3 Q!-VM W0`c U pq P\L 0 020  @ਊ ㎋8Ѝ0S[  Qq {0 0h2{`" P0x ! ("(R  #m:VW$ Upm P`10   0 0UU0  P R& U  Pl\ P0 0VvW0 UpM 1 P0  `  | y00 Rx000 ;P0SQ 0Sx Ya @`U] PS`0P0  S~ H~ ~ } } | | | ,| | <0d{ z 0 P0  7p@-0@T 03/@TPP 00@T 03/@T\ĉp}H00@T 03/@T$ࣉpz z z Lz Pz z @-M@@P Ѝ{ 0 { 嶋p P(0A0 z.H-Mo 0ЍO-@Rp M ഁУP  `C80 S" 0SL: f0  0Z 0"80S8  0Q@0 P 00 Ѝ 2  Z  00  00 0 P 00  |P00 2  ؈P   шP  000 0@-P RM@PQ    s/ r? DP 1013/Ѝ00 0@-P U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpC- MP @`( ``0pV!ؑI@ T`1 `! @D s T@ p PP Ѝ Ѝ0pP p`O-Mq  PpG  0H PU @P U`1`!  E[  0PU0 % ЍЍ@- M` @  P 0 q@pG{ @DP @PPW : Ѝ Ѝ P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:U080pO-@R"2 0|M`P0t00] 00S80S p`"X2 0 t0 30|Ѝ4P  لP8~ 01 0#\ %$`0P  8 0 0ᐈ Xp; P&8Z> !10! ` 04 4^ 08P  R8P84P@P`0XP:A@8 0801248 Q:%0 S P8͆P8vP 8 ` 0;pP 800P8密P8m00phꦽh  @|l O-M$ ) 09 @,0@020D2(0S} pWw 0H"4SnSl90Wo 400l0h00~0P . Sd e  S h` I dPP& EX 0 #0h00 00@0S000 R!@Q  :SY 0S c/d Z c/V0 0U X@  0 S  0S$ R0b00H2S708 R400W 4p\ p0r4040p0눐4`0ᢃ 0 ` jpA 0PW:: w` 77's07_U04PP8 W00S  0 \' YPPU PEWY0– 2\8 Q(( Q :PS 0 SR7@T 00$0S  00@8Q 4Y  [` TpJ 0S8 0 5 P 0到SqT2 c/00< SG 0 SR@T \00$0S ,0S !$0(0S (0@Tp 9 0到S c/d g R   P 0 SRPU (00$0S  p?00 0 SR@T 00$ R 00\"00#3 0 2 30ߍc/d &  p 8Qc 0 SR@T 00$0S  /00@Jc/d@0h@ .rX *2 `0 R(S Uᅀ00*PHY`l2 08`0p4p宄Trp/ᩄp0 S ((Wࠓࠃ\^` `0\ᒄ\440 0 8 8 \R \P0` @ eP 0 SR@TF hk00A@ @ h3`(0PP ` 8@P@@ ` W x@  0 SR @T 200$0S  @ $ ꐻ j `i Ph P c c A-P`@M@`@`pj000,00(0 00aP\Ѝ,a 0 ! ƒ<1p@-S@P  0P ! "0 2pp@p@-@P` VP(p0-P@  P 0S RP0/P*0    PP0/0/R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/(!(1@- 0MQ020# 0S0* /!PR*  R @ 1@0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@1 ꪹ 4  /O-p?o2P00#R00,MSP MWC  00$00 R 0   00SW 0SS0嘣#f 0 00@C(S0 #@P!  7/ P7/P_ 0S 0 00P`cPU0? E B R Q @F"`B`FV`!V Y*0SE* Sb:P 0C 0 0000S0  Rᘣ#R0@@ 0 P   P7/ 0P 0@  ` @U* 7/PX X 0 0R0X 00  0 @0# 0P0 0 XP  SX0 00Pd" Q0P0 S*S: X  QX E ^ @F"`B`FV`!V C  B+7/P  7/Pz 0 S 0SS0#! 0 R 0S0壀S0嘣# 0 0 X Bv`S 0P1  0 07/` P 7/P0H 07/` Px7/Pڅ0`DP 7/ P^7/P 7/P^P$0@ " Q0 C  7/P @0@0Sz,Ѝ! ^ @F"`B`FV`!V  B&a`V P 0  %P 0 C07/PL 7/PPD7/P 7/P~7/Pl  7/P d0@S@8 & 7/Pe  7/PN0 0@0哤$ T P@`c⃰ @Z}* @  Tt@ 7/PlU U   0 Y00 #0Q0 4mL0 (0l0 (- M0 00 ЍDR Q0P:Q0Q:~@-+ 4A-SMP@  $3/dp0  QP0 0B4P4S  $3/000ЍE00A-pd 4V:@T@T 0P0 S  00 S  0~@P0`0dp@A A-`M p!@P0: Sxs~PP ˅P@ P 0 i tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04 0B0   0R 1  00 0p 0% 0|@8 (4 0@-SN  00AS 0;4O-S M|@Ap⇁0PS`*0S'  TP [ P0 00! Q    0     Ѝ P@ 0  QP30 0'~$R P1)000000S@p 0 q 0p4 S   $3/ Ѝ  00 Ѝ00O000Q 000A/0@-S@  R   0 ~0S~p@-P@T @T 0 `pp@TrP`p  0S S/P/$(0#   @// / ////@-@ RM`P:Q !S@Ѝ0 0p P G @~ЍpT000@00O-PP X 0SL K 0SH p@ap-[0T B,B R`  0S7*V5* A000P<0@D0CS0 T0@p@pT  T 1 !,03/P00CS@D0(PQQ  :  D R !,0 3/`Pʼ@00 "R(  0 T`1 `!0PVQlRO,0 3/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C 0   BR @pZT `@ 0`V:p|0P 00``F0``G  0Y0C00 00dP  ~ 0 0C 0 `t 000NP nX0G0 b X<H<0 Y X00]T 00Y`@p@-PP& 0 `V @@D00T`0@T` ,0 3/Pʼ0@00pD0Spp@/0Z0  0p@-PP0 @t@ p@ 00, P| @|p\ R0  R/ S/p@-@PQP; 100S" 0  R 0   p-  0R0{0  0 0c 0p/0 P @P `|0 0 $0 $0<0  p耓 <@-PP qMp`@* V0 T7 p   ᥓP0 :CoR  S L 0( 0R  ; 0 Ѝ;0d00 ^ VH<0 U T(L0 L D @ "2 A-@PR0hM0d00P= 0 C 00  \"P2 0 d0 30hЍ 0`0S$ pwy0PP ! WP00]0pS p 6PP0001|0`  0St$pl @PA L10F L<10/R 0 p6{ 0 0{2{{ 0SP ` 000p p00` ppl0`  xPQ  t`p@-@0MPz00Ta{V( {0T1S Oz0T1S{0`{00 UTX!\!R Ѝp@sz\!{00Ѝp@jz00UX\! X\!0 000S/0 t0 0p@- PUp@0Hz00TQH{0`U TQUP 0 p 000Dm0T00XS<@ 00DA B QR ap `> S0T1 W  0ptt p 0`@> p PPD1?0 $@0p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP ph0p 0> 0W 0@ p p0@ p 433333300M 00Ѝ @-M0 | @  EP 8 ,0 0 0 30Ѝs8x   H0 S8 0 / 00 @-~ 0 S 0,/00(@-H0 S8 0 / 004@-4~ X0 S 0,/00<@-H0 S8 0  / 00H@-o} 0 S 0, /00P@-[dH0 S8 0 / 00\@-F| 0 S 0,/00d@-2H0 S8 0 / 00p@-H| l0 S 0,/00x@- H0 S8 0 / 00@-{ 0 S 0,/00@-xH0 S8 0 / 00@-{ $0 S 0,/00@-H0 S8 0  / 00@-\z 0 S 0, /00@-0H0 S8 0 / 00@-yy 0 S 0, /00@-eH0 S8 0 @/ 00@-Py 80 S 0,@/00@-<H0 S8 0 / 00@-'px 0 S 0,/00@-DH0 S8 0  / 00@-w 0 S 0, /00B@-D0 S4 0 / 00E@-(w P0 S 0,/00G@-D0 S4 0 / 00J@-v P0 S 0,/00@-h @/ /H-M 0ЍA-p`@P0 8#@T0P@@-/"O R ?#0!PMO$T P!Ѝ  0S RP/0    P/0@-$MP  0  00@PP  8P< ,0 0 0 30$Ѝ0跫t t 0t A-Q`pP@ S V ("RSR P` 0Ck ?o/o0CS 00cÎ10VpS& /o?o BR Z 0 0b1Î0pϠT\ ^ R0V0 BV  T$ 0d0?o c007/ooAq!  R!0r b<·V Ve0o`100@b>07Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000 / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/0///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @P' TS0 C0 ^@DP \T^0L Q^ PPP 00QPS @R S Q0 S00  / 00/U/S 00R0Q0 / 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@0@-Q @P ST Q@DP  ST PUPQ P00S@Q RU // Q#/  //s R PS  00/ 00/U/ 00/SR  Q 0/ 0U0/ 00/0/R  -/p@-@R`P R U  V  R 0 p00 (QRp@-`P@ 0S0 000 000S0 0pP0l ($R S 0Q0 0S00/ 00/0 // Q#/Q- S$ PQ PP0C S00UPP-Q S0S P 0000S00 @-M0| @00000pp00j l4 ,0 0 0 30ЍLe d -BMMR d X @  P  Pㅆ1   d H40@- @-`x@t"pr M Mp $( PrM TE <" `0b0R @`$@  P0u!1 0 $8 30kލ ЍB~p\ @0p ] /0 xaB^`P.d0a/rH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A @@-00M>R@ 0 000P001 200 :P0ЍM00x0@@- 0M@>S   "0!,03,0 P0Ѝ)00@-@U@U0 00/l\ 0(0(0-M 0 0JЍL\ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/[ t@-@p@-0@ ,ppP`0Ppww////// //1O-0p,MWP` y m1 0  0 (05/,Ѝۈ@PL 0S LLL S0 S0S3*$! 00S S( S000S  0S S * RpC 0QW 00+0 0 0 0 00hT0 0V0H00 0N녈@xx@xwwwxw,www//O-M, 0< 00000P0Q0S Y [00<,0 0$0 0 00%SS  SN pX  0 HZR X: ,0 `P,@0 S     Q  R0 [ ʄPU* R [ Ԅ ʄ`V*  0BS0C [ ʄ0S*0 H0 H R;  d  \ rSi{- R@0%%%!:0Z0Ņ`% 0C RZ%ȅP  dV0  d/*00  D@D` prpo@pl 0 , 0r *XZ 0 H R 0^0100 H R? T|P @ T S  0Z 0 P  BS0 cP`C 0H p2 $P p xSPS P@ p`0) 0P  Q D Z'* 0[ʅ Q   BR B0 [ʄ R* 0N G   0lX pp|    Sp+pp\{#0S P@`0 0P  Q Z 5 4p,  S@ 0  d0R\ @RC0?T0SPA`B  0PSe     +  n P gpd R  ^{[y,  {UPP xr    S ǣp@! ""d   S   ~    R(0P0000pCP`@00  BR B R' R, Z  048D 0Tn  BR B  [ʄ R* R\ [ R   RR R f       BR B80`P@000 Z0J0(#3 0 0 30Ѝ    @   ,  0  D @A [  z 0 R*6 `  0P`@ RPP   ! 7   @. +  @( "(y   "@ (B(pp-DA@  @ !     Or(0D T$Y|0D T@   0 ? pT0 0@겡pLX N ` A-Px@@ p0`pP@PU J0S 8/`PEuX@pW0:0 K xt 0SS S  0R @-Ao/ 0R0@o/O-p(!$1 CM0 M@`0440PP  0 0 44 30,Cލ Ѝ 000 0@0`0 @P Qlx0 0@`wP+ nk 0hk/J TJ P p ᰐHP R!Rs )P PZ@ 0S 00 0[ puo@PPP0S@ 0Sʰ00 9 S  R-<0 d008,0[g040Xv?D0 0@0\4 ` 0S1S @ 300S S00T01@ 021QU[0H0St0(0p0<0400SyATv @0CPu D0PPPxs 0;b<@( ᅟP m @j0P eP > @0 40@ 040D00D0 0S \ R ) H0S 80S F<00p  R  H RY ꐋ*000ppt`|@0 0 @5/P|<+,; 0 6 30Wݍ Ѝ00S0 Q 4@PD0Px !~D0P0 y  0 : X0x PD0q4000SB0T0C@0`S\0c  Խ`@pV  `G00`P?60 0$` ,90>P090Z?L000 0,000F00001}PP- U;(0 0R0K `1  0 h9L0X0 80Z80   -080>$ 00 0 SKb0!刀?A9c!@00|P a0S ] @Z0P .i-0X , 8080PH Q!  (< 0 0 P_R`1  0 7P0X0 800 00   1 01 080<`(0 0|P& 0I PT `1 q 0 60X0^ 80^000 M 00d6T PL0&0@@ 0 X߀@Q1 0U0pI0} M 0 0W`@vQ@  2ˆW0000QP M 0 vp01000P w 0 H5@X0M 080HP *|P0D s @p0P DhR/00  : (0d00801h<K/0d0d@X0 0WʤB 0+S .0CS:9 P60@z1@ +@)0Pi$P AQPRl `1SC 0    R 0H080n |P8R9`!!! Q5   30 @| X0X  0H R. , qW |R*`P|@p t 0@7/P0 80k h`V q0 02@X0~  0`!01 @XUMS0 \01S@ 3`0`00S S``` `P1= m`0 |P0 `00{P101<0@PD WhP p0< (00 z<00Px00 P 㸠D-4E 0E <@x@ 4\LC@غ̸<T <8(Ю`@( TP B("(R D zP#0d0 P0@@ d06SDVB `s ;WXpl0(H0"( D0 P TP B("(R D zP0d0@0P f| 0d0S_(0 0RV 0`1 u 0 10XP 0)X0   gb f$ 00d@~0 42 X@d0rZ0   D PD pH0Se=00^ef0 d0~e0|p x G0("(0R D0 P T B("(R D  R,#yPʅax0A P 2@0 0{P`P "1011S1 9000 4(0X0 %<0d0(d000 X4h@X@" 0c~Z0   0 4 X0l00`d0+S .0CSP@0P e$X 0070' (0d00d0@0Ps e 0`0d0``0x  _s05 @X}e&00 d}w P0@n yeX&X00X d}a/ /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@zP$Ѝ0 zP0͡"c1010$Ѝ00@-$MP@yP$Ѝ0 yP0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-<#83 0CMM0,401S03Xd0P@,p 0$P0000 0 )| 0p v P<QP0\400Q PJ0T0= !8 S000 $0<o \40 ;0 P 0000 ; PP_ P0. T l10,430RCލЍS! T 0S0Q7 Q1 Q+ rT     `   4.48#804"4 $,$8(#8"(d|{FTBT?TȘ+ جܬ$@ @) |\C-PT AMM 04@`p$ R6 U{!0 @ `z P-8ĝ0  0 0 4 30"AލЍR PP 0@ .Rd @ @L zD {Se( P<l' tO-!1 AM⠑0M  0 40PxpPLpA@PF {PPB @ t+0<P7 0S4 `  0S+ 00@ p0P00@S 0S0S 00@ K@ @ Yb @d `@ ,0 0 4 30AލЍ& p& Ч % O-p#3 0CMM`0,40PX\$@@FS0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!  T00000 00P00S !  @D DR0$0 0s< R80 tP0 1 00S|z0000   Rl@00S}0000 q 0s0S0S uRvpR$ @# O-p0\M3@0`PiT V   U @  4 400#à #4:W 0 P 0FSX0 0 F 0QP0x 'x>R;R0SUPPⴠm   B RX00 0 BdQP !RRR PHRUT7H!0B 0   y0 `F 0S0   Q Q Q0 Q0S   <PHUT0XU `$0@ P\Ѝ<P0\ЍPHUT DpC-@0 M(p`P0@D T@B)Q0X Q0 & Q Q @4"40(4"< U @DT R0  Ѝ\xLL$0 P- Ѝ,@X@G- p崒Ḃ@P`. F0S@`>0WV!: JQ@FQ,@ 0G`D?o2V0S ?V0*G `D0Q0?U0S XHH$0 P,,0 P`Aĝ=(0`( "4`43Z1S//0O- M䑐P 0S2 s샟p @$` S S0  P$  <P- XPC  tP-0V _0  SR 0  SRS Ѝ d1 0P0d1 ,w 0P Hw |P vP060 0P dw `P  ZP090 |w000wt0:0 @P :P090090x *P010{  !P020r  B0P0Yi @;?P1?# ^ 02Z E0P0YQ @#?P1?# ^ 0(3B P< @ KP0102 M P010) @-@HMtxth { - |#0 %   { 0 0x0sxHЍp@-MAT jt P00{ ``u00 0nt 0 0gЍp@@ 3 0@- A0|MT0t00& :t0p`0# P0G : :@ 80 0 t0 30|Ѝ@@ٓ`  02A-@Pr1 0!1n0SuOPpp rp0PSp@-@QU x3s|p \01P \01000prctVxrP //P /W/A-pP@>WP``UW@0S1 S P  P ;O-_MM0* 0: 0@P050N0WU: 0Y`p+,= d!0  d!5. 0`1q1110ZPP~  ʟ0ʏ  ~Wό d10 d1 Y\P& `P U]`0SH _DPN p\ S S00 PpP0S SR#3:0 0CQS0 0CQS0000088vP >0{o000p+0V7P 1#S;S 0x(S$ 0l(So 0`(S@ 0T(S 0H(S0 88R00sS1 S S(0 n/ 7R1 S S0S00 S S SS@@ `0 \_A_t00P@0Q"0A'A+S}? H7R1 S S00R00S 0P0 S S00  e@@0S S| p0@ @@@@@sO800g/ 0050yt0G lPd,P R`P 0i,P 0R@m`<@L0d!S 0 0 2d1pO Qp @|]1|brp p0ό`0S W`0`SHPDHp .Sp0SWP`.TpGWV 00TPP /Q0$00x4 0 5 30_ލЍ4 Rq W W Zt$t k?00  $`k` V V` VV00;V0SJ`V 4 @0p ;V  00@`V  PP 00P 0 Qh!P ``V;V \# 0 00@`V;V  00P 0 Zl` $`| 2R1 S S0Sq00 S S SS@@f `P x[ _AH P@`0DPS \ S S00 QP0S R:0 SQ 0 SQ0000047{_qP.kP `[!0x3!|3p\aDP` DQ }o~sQ(z`,WP 0 Qh!- =pPB-6j`P@8pY2  LPꚐ  ĔܓD domasearnamesortoptionin`er|* list(ch̋!p@- 1hP@lHMP ^  T 000HЍpp Qx#r cpV p `0!0x= 06oPT $000HЍp$\$#A-P RP@0p`  R  @P  R0`\ R b0 ]0O-0PQM@0 TT40Hks0P 0 pV0P0 (P0$   @  =P  pPY& RP ! 0 !#Y㴰pGh 0`P `P oP ` R YP@`V% 0 0 pG`Q P* $@P@  a Q `U pG #Y [  0 {X00`Qߍ P $@0` `FQ*$ @10 $[   ` 0 Q0 :0 AQ1 :@ACp㴐R  pZ@Dp p$ /Y  zU @D ) (  p @DpW  Z   oY  0  XN0 0 0  0 00Wy U 0 r̊ XD0D 0@-@P @=4$$00HGr < (0( 0@-@P.00l 00/$ @-@P @400H r蠅 @-@P 00p@-@PP  P 0  p|L0X $p@-@PMP. 0 `   0HqPP0 IP <PΠ 0  ЍpƠЍp 0  Ѝp L0h $Ą @-`P`A M@I T!T1 PQ0 Pp 0 RpGS( `Rp; ЍA@D@WnP 0QnP 0S@ @R BnP0L AdY Ѝp0L `YY ЍH00 C00L @$X<0A-0PU" 0U"0PUP!q@@``FUP $UP 0!E`1$(`P 02~Pp''8O-0F弖@ RM ,0004 fv唆`{n$0pP`( S8 X&Q !GT@ d(!< ,&0C S00 6 0< (  A0dP@A <8@P( 4<0P(0P{ PQE@40Sf0S h 4 0Sm87S H% 4 0S4E@00S S504 RT 4 ,00,000S4 0ğ0  @( TA4*02P10S P1p1 S^ h40( \40 0Sp @4@$0 T(8P1(6VpP0440^ 30(P PЍpAR 0Q*# 0T!6# (P08Q(40&1pRv4"4# <*Ȝ1\ \0X 0T:p @( 20<1P6(P_4*20( 2 0< ( p2 0< ( \2 0< ( H2 0< ( 42 00 ( 2 0  8 ( 0 0(0 ( 1 0 ( ̡ (0( 10( 0Q0001刡0 0 0 0p10vQp ( 4PЍ>p M9p  u p\TmpP/ 0. S 00KL `]W d܁\<<`l~ ~pD}pL(@{{41O-0 MX B*1a001Q0,`P0 ^/^_?+~ 0 0@S@ 00T 00}O R :R,000P R 0Y $00 Ѝ\<,0, 0(@- nk (dA-@@`V 0 CQPq}SP pG ZPSP 00` @-@00 R \\  !$00D0 0@ ($ T@-@PL  0S  T0S@TT@SlP/0d 00 0Q,0/01P/0(00$ 0/p@-@P(`L  0PS(  1T  0 $000`ptp@-`0PjQ@P  PeQP 00p C+8 A- 0@S  P p00   ($ 8PP(p`P0  D +O- ,0ĻS 4Mt 0 +嬫   /+~ ` Px+ @0d{d[pP^/^_ @   Z@ }@Q0 :Q , @T  :R^@Z :0 Z:P00<0` 0 `@ P 00 H4  S   !d$R; PSu00Q0,090( RC 900 RB ) 0S  !R 0 0($ jIk@(p` 0!\90 4 R B<ɟ  B QR 90 `0 PM( ( ( X 0 80P `I T4Ѝ8 0É`P P l8@p0 00  H( 00Dw0DS:$8B0`800H@004  P`0 00H 0C 0 1 ,Pp$p($p,(\y*ppQq(pW pA$pW P$G@Y@`A$ppW0@  ^(0 1,P1 @P(@ @(`P, P  QP P  BR \`A$Ng0@(`P, 0 P1#S0 0 PPp`@(( 多( p Pr $0 0@SA  1@`p $P  pW+00^0040$p ^P;  0 @000`P000$4000C?00s( $0P$0( 0P A ,P$ppT (0$0 1000@`p $P1(P$@ k@` p$0 PW$000\KW 30$1,k, _0, $@(P020@ (kP P R-LP( 01 (0jPP$ 0 (P1$@;0 (P$@$$)QOSJKF 0ppP10<0S  p|! ^O0}ς00P +.000P4! /(1:Q0@ Q10 `{@ @0`.V  <~8~ }} }|x      P $ ( zd PX8(xt|HssstsPsspr@-@P  0Q ^   00$0000 0@ ($ @p@-l@@`VpPPp0U1pPE1PSp  (0$ 0pQA-pA@PT`QV0M@P  0 pPP``p`"@ YapA-p`@MPP T  !0 000P    B _>oo@-@@0/ 00(/000/004/00/00/ထ 00(/p000/\008/H008/4A-``PU 0AP p\pM0APjO<0< 0 ,(0 MwNTO/@@ <0 -b M00a.Q ЍdmD @-@P 0`00@050 xs@-@Q o00 2 f 0 G-PdsM@p 0 p T 0S00{000 00 000 0$00-{PP 0` 2# "Z &= " 28 +0 000 0qp| X X 00@ݤ dj <R 2" 00@ͤZ 2: 2( fP0 0] 2< 21!001 001 0 01001001 00RP 0 R00   0T 0 2 13/p ЍTh00-0.PP ` 02 2y00@Z@P0S~X 2: 2l ࿖Py 2 @0 2@001400` 48,4pC-`@ MpPP  m000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH nP (0 $( p 2 P7 ЍP Ѝ*00P("- $X000X "R0#03(0 $X "X002S13/p  ЍR zo@-`@ MpPP  00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ  Ѝ00P2!O-RPM4: 000 X'*q`I`[ p@ p W  A 0 PtZ 2< 2ЍЍЍ@LP 21O-MrX<*0`0A̱PpP W [K @DLP$ @̡100DS 0 Y 2< 2Ѝ10@D @ 0 Pu YЍЍ2!C-R` M.:rBW R * U"R  R00U00SR 0 { PpXB Ѝ 2< 2 ЍKP21 ЍG-Z RbMp* U0U @ RD0 E P XЍ@ 2< 2ЍЍG-@ap0LPP FPx1加Z1X%81ʠa%X @C !QA! @ 0S001Q@10CS㣐3* 8#8 0 BR ("(R B("(  0V8#80R!2 B0C!22pT00 (G<00 (@$bP0h t8gffp@- @ZP ` ~PP $p Pp@-`P@0S  00T T 00p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-@P4M0`S  00 Vv 2+ RJ 13/p* 0 00" "00  0$04 p`0 9/P 9/P a0  ^ 4Ѝp$  0Vqp 0 P 2: 24Ѝ?(0p0`,0 09/P  0ഐS0FI S)0 0 B 0V F B 0D 0\ Ƞ.,Ƞ0P0000 0@ @@T*80`F0C@J`80000 Y ,)Gd0t ]G-`M( yPXPpL P;S<03%R @@~zz0 L l3< 0zHp P4,0SJ 1 R ,  0#, ##$\A A0AW@S00X0;(0H8#80ᴀЍP007LS <0 PF,0S0S !Q #$ 000#$ P0A 0S"S8#8 C( 0"( 00 # Xp0h"@0@{@0@@@0  0 O00x[[61Sp@-@M PVFaP8 0P,0000P8ЍpHЍp/G-P4"M,2M 0` p0 002Wpx @^ 1 R2Y< *5S0@[ZZ 0/, L. l3.<  0GpF WP`!P1 0  0 30I؍ЍU9 0`J8  8000S   "4<Ġ"< ̌Q0Z0 "Q Cx/pa@0[@0QO00~P x lXO-P  `E@P H1嫲p0q1  J08 10000N`ⴜA40O-Sp M@`0S0040000 PD $ 0B;110C0 X0M ^ Q 0 Q @0 SX!B! 0PR|   R 0S  "  0!2#$ S C$ U@  UX SRRS5X%XpUk 0 Pc 000@@℠0ᄐ000ಀXcH0PIᲀ0@ ЍXD  $ U D ] RP1 PD D00CD0 0 10CRV  B Q" 8#8ᅅ0X%XP!@ 0C 0$ 10C0S  "0e Q 0S 0^JPM Ѝ1 \=000,1 r@0B YPUڤ0S 녅0P!D PD 8#8LPU PHD充ADSSdSSRO-M@P`pV 3Q3⼀ X j*^+PP @`V ᆰQ0  V\Q  X 0 PPЍ0S `0@ 00S#@P 0S 00 000S[ 0P00080080ЍO蘗 #0008(8u40PЍ0KⱰ Z 0 0/ K0 +ᰰ0  r [4:K0 +尰 g   `` 0 X0:0 H0ಀ00ര dd>I/00DD>I/&,,I/D0 OqO}dOu 0A-% !@ ::`0$0CQ @3A@D$0@N0qPW T002!@$!A蔝pPQ?U/NWO-@ P5UP0tM p%0P(0r 0  P4 j (X0%X 000 00`0SHH00@0@ 0 \ EP) ༼  I  ᲐP R@ڴ R  ED @0I Ƞ ,ȠP AL  H+P(0 4P`@AH$HQ 0,0080X0$0<00CS@H$H@0S*<0A0A8#8 @YᲀT@0:0@I@0, 0ഐ0ᓛ0P,0 R 80S* 80<0 ,080 R4*Q^P0@00Q0 00 RPP ` 000@H$HQ<08#80 ᳠Z100S B CX TP\J0S$0Q0 00 R 0P 0R 0 $0w 000 $PnQ0b80S 88,00`00 00 0 P)d0 0S% `P0U$0 h0`S,0 80q 0B8#8 Y@00:0 I 0( `ഐ0004 000tЍ( 0,0800 <0S80StB,0h800 <0HLUY?]/k0,=.b0HtHO- @T1T@0 pS0P`@D%P C BP( [  8#8R40 G 0 S(!$10$10 10 0S0nP 0 P0S 0^P  00S 1$10$100O-M@YP000X00 ``FV*:S 1 !*n `p pGx'x  F0 pF000H00 B 00p0@000 ``FVA*hY0&hP Vp `!pGx'x ĺ0I`h&h08#8አG0Zp01`*0ಠ0`0p00sPP% Y```0S`00Fyp0 ,~0xp0 ,u000S`00FЍ``FVg*hX&hQ p0 0 00000``FVH*hX&h9 Vp1p!8#8 R0C8#8p  ` `Fh&hG0Hpx'x08#8ቐF0Y`01p*0ಐ0X0`p00 00PP @Ѝ 0 ,0p0 ,p0 ,heT0 ,0Dkl80`0b ,F`FEE`D@DDDG-0p`@PRI 0S 0U@ TP5 0X RI R Q00S00ô0000 0A8#8R0 BY001"*("(00 000tUU800C80t 剐BY001*\ ]HHp0 ,l 0R0ಐ BR R0  P  0 0(!S$! 10$1\0 P 0 㼐ᲀ@p 0@p 0 S স10@Rx ἐ՗'xP $10 $1(!y00O- @1T@0 p0CS0 M@DP`!P A ?P' 0 0 cP 8#8R0 X Ѝ0 0S0㉗P 0 0P.000@- M@ Pp10 Ѝ0O-@Mp 00 pH`pb _  PPM0STD0Z 00 @@  0 pWM0 @ pGW 0G*0@p 0@000S  p0C8p#8W㲀Ḱ07*0p00ᴀPP D0ZPPЍ0 P0 ,x0 ,0 pLLp0 ,44p0 ,0;f::}:G-`"2 00M0,00w?0 @Rpq2SP:0JSM P P崀2Spp1!pp BRJ:0CS㣠o* 8#8X * 8#80C 00CM1!0C8# ∀! #(@< 2 0 24!,1 0 ,0 30B0Ѝ 8P1 ZP崀 Z (0 p喩P202 ᘶp   0  ` $0} 5p $0b0 $vġ ` 8A-p@MPP`  00 2   Q Y:1Q|ö0" B`1"0001 0 VA00PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E0 EP VP V$P 2: 2 07ЍZ00Ѝ0PU Q:(0 $P0PU`P<P  >P 21 z>7@--0M  Tl lP 0PS @T000S 3/ T-V̷L 8 80 $0Q/$$0S/M ̛ l5<<0 0R/( 0S/M | tt5A-@T 0Sbp`/XP0P@QD 0 <XP0 A/P&O-@$Mpuj?T$dHpp4pD0q$4SO 0! 0 0/TpC,IBP b0@S3S103 t733 $$3 $ $3  3 $$3 $|3 ($l3 $,$dJH3 $'D @OX$Ѝ $40$0($0,$0$0 3S000`V" XP  2RC?XPP2&C5 p000Sh'P`R0 p0 00CS0z ^ p` RF(4S VZ  4S8 0V$0R0S  W6@) 0@ 5000`006@FU0`00 ܆ 4S ! DW6@ 4S $Cbp ` V V ,4S ^5bp I1bp4S VM'bp -#bp `000 ^bp V@?0`maj~"&&YX-P&&7&&=|VO-@Mph`7iTPa> @@004#43|Dp: RPGP P af0@ 3 hP>  2H@ PPxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y ɄPPXPPqT! i`P "  fPP* ᒶP0SQ t㥄YhqPPSp@`< 㔄%,1 B R 0S ᾷV X i 0S X  R 7/P  R 4$ {> |$ r> \YSMN&X-&_ O-yMPIhv=Hx0`00 00( 1Fp8`K[( 0RJ S| 00 0 `vPePRPGPʎcf0@S(H0@ SaP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SRK,0&R4$R q'  P M6pP/W  0 1x0S Rp0S &0S0@0@P0P/S R 0: S00! [sRq0: S 00000#/W00S %e0S0(00S00JpW   0P0M l50 0";0P @/P05,%0CS0$ `N=   `pPPd0S %0Ss 00   B R\ L` V, `Q' /0 M 0P0 P@`j 0P` J/R  S/R/  # C  R: ~ ` 3 3 0S S/R$ 0hSR& R0sX/ HL!R\0X\!R\ 0RX00: S  C C `Q0: S P1: S  : S!  Sp  Sh %` Sa S L0S !aPL,0SJ ! $TE0(尥 0Z Z80 S800 fQ xQPP1: S 00Z0S 80`!0CS!80 TT0 @f_PR X0nP 0S !a0S !aa岳aQ[ (0S0S 0 0 EQp! & &M&&8&L&6?O-P@e\;L&Cp@<6`aXP\`0O ( I(0, PU`00 XP\`> ;OST&t'&' '''\ `  '\O-MM/d\9WGw' Bp 0 Q 0  xH0(0h7G@-Pn0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S XPU R8nR oRP0<0,`P  ^6P8`P, PPP{ QNRN , 05 PwaPhp4 1SzH0S?80S<@0S9 P0SP vP4PD0S 0$S, + ⤳ P44X(D`尠pXV 0PU 0040D0S =cލЍS ,0SX s P㨠=`0@0S0H0S 0  F}eP P 3R㓵(F  UP3m W` L0Z ȤP t3  dI5P \T H0`F40P *NPP (ePPT0S.0: SePPP4 01!ǝP4L  0R p 020P T0SUH R 0 T0SP FpeP4T0S 0 45YX 8SU # WpVJ  h."  ."  $."  (,." 04   8<   @D   HL  3]P +  5bP40SP8`('X-Wl && 69G@-04e,UO(u@P00000Sr0C?o21  @p0 1000C00S9 000-S4 0R2)0pP EP SP l h&P&MsP xPqD584 4"4 "4 "3 !00000C0l)P&}L_@P |S!UwTXcQL jPN<32S L#L0O@\e3 0S 000S 0qP 0iPPH000!S 0 山0S XRd000S źPwDN@i#A1S bVqQ"v᧺P2S 1"tO:Ua`0:EoelQ100S S v!0`00~01l@Pq Po kPj @esPg 2S 0"r r r2S`AH"vSPG2Sl p0"PGP, H0"`(O0 0O'&&X-Txc''$L'P&-&@-P@M`/\P@L"@P3 DBDr00 >p= 2Q0=q E  -P W RZ R\ R3 0!BSQX KPS0: SO00 v| u>pd10 ER!~JpDb|wPePLP PP0 FP {f0@ S00000 0 0 0 0  Q |f{vK cK@P0: SpGP P{@H'=& O-`M@`D5eJqpP!>p 10a1S 00`F00PmP pP Q`P |{`v`P3[A PDpZ40Z 0KP0 0JP 00+0 * R 0Z /0 0 U:Ip @TJZJP U:Ip&X-O-JM M@_4 R`"s=p1 @DTԸ a.0S T  JiP fP hP vP00`000 00 0`QDvJpP0: S! z PP #{P 0Y/S J>00/ P$C@T 0p/SX/NP0 S:Pp` D ᐄpm'q&XvA-`@MP D^4 0 'JP  CI JP  9I JP  /I  JP  %Ilh30d3PPP P$P( <30P+( P3( P7( P;( P?P(  PP( P ڵP8$@Ѝ(P (PP"(0S (P(0S (vP(0S (lP(0S (bPq0S  HPm|!0S0S !p Tj`PLa @1R`PU 0E /R /P(@PU  B00,0/00*0 0CS0ἎP0$0v00S xy10s00徐Ր+(&P$(M&'v@'Cp@-@P]2`LP PP {`| ;ph00SVqPyoP $廴 0@H&P&&O-MP]2F`p&;p |6@X/d60S ЍfP WP! PP p `RP dP jvP iP00p `rPxP pp0p0p$pq [+1xES ᫶Vpe  0P0S$0P`S 0S@ שpP PP4W0S y @[*0/S /MP0.S0S .S0SZt P4  0  R @ 50$0C SR00$S P P2 k 00$ @2 0x0S $ ?RR00R0SV5 $ 2 0Sd3X  弴P  0!0 0C0| 0S- !GP 0S0 (0S 5S# 0S 0S#GP%0 0X 0 0Sx2X  PKX2X  wPCbF0S<ִP 60S 0S/ 0?S+ 0SީGS V2  00PU |G$0P S`0S<P@(0: S R,  S /o" R 0: SFP0S 0 P SF 0S.G mP )0S %0?S !0S(\ &  f   Y   G-P@[4 1`p$!9p 1 R1 0C@pP FpP vP0p`B2FP'p0S VP /ۿP 0S 0S FP4'p0S   &0( 0@-TM A 70 $ #EEPE@FU0aF0T0D00 0;ETP00ջC0⏵3P XP 30S S S" 30S!  R h#6 R P#!SRL3X F,3 ! ,3 003 3 3 r20S! (l2 20S e0S(002PU%B;l@ 0P@LpB00CS00  0 4 d 0S60016 R0S 10S<80PT< 001 10SQ 10SM(p1\1PNL10S H10S \1 P1 t0S 160S (  @1 E01y(  @0S0F0S 00p0S0S 00@tP@@zTo᧿ؗ(/x &(L((`(((m3!&!&/( &/ (//C-PM LZy/b2@@@0 S Up W"*8pC 0 L1 0姳Pl7h sEPT(&Px kEP< &88 cEP$&T7 0DS 00S8 0xL@Q0D0@0 0Q%@0SV L GPQu!a0@S0@qCP du@@L- P P P 0@0 00 M@L.L.0@0 00 0 PL ( UD0S lx DPX%D\&&\\\Bt @\ht@\t@\&]\X-\\\gt]@-yYCDO-MppY0.x@ dP@@@@0o0C?o203#4p3 X XT 0S9 ZP7 [PP3 -uRPGPP l3H@ PPhP dP fP00vP00 3@00P00Pk 1 0T0㠢 00B R; :cP" @ A0S #S(h 00 0 㐥PP4 04#pỦ@P/ 0Sx '. P  pp Cp t0S<0 0@00tt5h!0C S?00S ϧ$ p.p "0 R qX  Pp P    3/P00 S $$ p}. |p[p000S l~C](!&]&]&]X-!^G^(&^7^1]@^]O-M M`p?atI^^ $a50 0 5Ga5005a$900 dP  _P }PQ tA0@6S0Y S~(5pQl Q` 04(TȟS SS @s05505 00505057 6P  0P@ 7Y꘷ p0"S tsP p ׼0"S ( pȼ0"S P 06sp 0z05000001 00 00g0e0c ^D ^  ^ QS00 00055UU $ BY5S50`FV%R" 2) 0%0;=epPx%5S 0|BP80: S055@%0IS00YV05t!V$C܄$0P0 H1D؋p#P Ns`PP  Ad$iB~)%h*+t50000 00@3@P#2 @A@A,AFS0 E@PC  0SE   *rpP+0#S X@F"Aܟ T0D?o2? E@ PU D@P"f/o !PsU e$PPAgB D冭00CS0 sP Pp PNU0 P00CS0<s0 V#0S:00S:0'0V51#1S'1S (PdPh!iB(%l|*V`rDP 8e P #P0V0 #Pq0`FVzP@?rP  f/* ۹T  &+xP(BnJnl|^Wnnno6oX-%_"_hnynnn!&&ԡ(^HoUo0nd0(|o6no&P&mdloH(P@-ʛ*0 P `P@@pEC p-`00CS`0T aD@T ЍX0 X @-($&0P&O-dM@` $tn P 04 $0w30p+$p@DTlUU!Z %rUdU t0,?0p`$ y dUQ 'RU2 SU> QU040, ( >qtPcPSP PP-d @" nP tP0 aPP pU] [1lUT -  $ah$ p@pX dЍ $S8$ b@p3!q 8E8 T@p2/( 8 84Y  H.T@Dy&PPp` pv`TE`8 )@pPP<"X0B!v j0!C"X 0  1 P Q !p0P0pTK 0S@d&B`#Bo("p08_08 p0PU 8 ۸ " P P VP0ZS  -D(`V  x tB0P```QX-@&L~D`D{D|D(}D :$WY&yaratcidO-0-O堯堏aM`p22242222322$ `/2pjL?"42`FS 20000b2_S R2SVV10 dbV%L0 ``J)p Lv%pP L0 ``=)ppd2S P?PX0: S0d2232d2o``Sn}0 =aPpn0S f 8 zPRP3P/PJ.S@'Px=1@P A@PT=P00j000]0 ,2,00SP `o<P0d2M042J02G02D02A02>\@ @@Taߍ02.202*02(PX0: S:  PP &/$P ), ( 0Pn]s<PP U<==p X:{\10  [ *M<[ d !14\)ST V<̲03T8  803M88 P 0@B R[ 2SX 2S 0sT <pRd2SL =plV X!\1 H\1X! 0 \!,02T7,2P7x(&0aE*K,P ⋟팃`0`p0"*+,00!0`," +? 0,! 0 `0("-+(*E#,P s$ 0   012S3 bV02@t)@2S,P# K=넂 0 0 0d?*@H+P D2!` V!0Tp2<<23Sa X,2AS``b2S 48$)0 +PO ../I U0 g2 @T' @ET0 @@  t  RT 0 S`0 K10s r `Vm <T <"20"0r.P`l.PL@#&U8((ۣ$0֤O-M E M-0P 00P`00PPP@ 0$ ,؄p0040pV4$7 ލ ЍyPcP PP! TP' \4S T=:H$d0@S0000000  +0 000003C30S : pPj00X 4 P40SH8S )R Q$nQoQ 0)#0PPq "z4002"@xṮP' ᴮP" ᯮP  9jU.; PI\p@.D F8"89PB8$R#600  l4ZpWD ` jU/P QP1Z @;Zd@Pbd[?o20S@ Yd `@T jU`P8j/iP( >9p. 7(>04P`CQښ. . a0C2,S!R. !$RU>"0i(I&мִ&̳(X-(ƴ\#&(h(zd@X(ZeedA޵ G-pᬁQ@`!+p$Vㄑ 0S 0S l`d10pWA AP @<0S (6pW%ZЍyPmPPP fP 7 n0@ S000000000000000`EV 0 JFPPG)8P%8P 7XX-0(ۺ&<O-MD4D$` _8P! {7DP6p000PPP#+p4W00S 0S 0S Pp3 a X( 0S00P l㩱0S X㣱P㠱WPY430S ЍzPOPBP FPL +\"P0@*S002 P2  P20꜒"00 0b\ 3:00P2` P00 D P00 , 0 c[Px  s000o00l00i!0 m[1 P :1Wh100000P000L00I`!000D000@1p=0000070003P10SqOWPcqU 0 sP2 `IFzq[Z 5[ZT )|P)u&`(X )X-=#&)O-@Mp@@K,MP6WpG102vPlP+HP1 TPH 7 p0` 0& D AD0Z`   .Nqp` 0S  g 5m@ Pက$ )p R 0S00S!0  4 0040Q 00P0Sd  , X 0HwPH~K00-S 00@0`( 0P@`PЍ@}0 <0$P@ኰ000 R0Sk3<0 @ t#  lG B R. 0<0@ 0R T 0 00S00 gR R@uDK0T$0o R" 0:E%KU0<0 iR BR0<0 BR0<00ST  R\" :J%FZ R  :O%A_$U@*DP Q@:IP0.,@hp $0S$ @ 0 200S0Q@$0S0S (00(0@`4P@ `$`(`$0S (,$TUT[D$0 1ă00S00g?;;0 4;$#(Ć,40 3/p V p`T >&H&&??X-8$&@-44Ҹ,ظ$0$00θ ЍT$&0),O-@M -P`,@(`F8 0#T`p8^ @0p8 4+p ( f 6 R 0ᙌ,0P T4p80P\80pH X7tEUh5uuIH吅Bh@%'p0)L5O005SO 15. , 0(0,00(00 0  EiP PP$VBAezS `SNS7 AS( CSt 0噷0pRdaC QWS@4$  㫣$ 4RD +K L J sO 05N 3 W WpM H $0%s0!0 0  }$0S@ LUeI 3Wpph zS dkSLS` #m0C S[00rTrRXmPH0SI0SO005SO LPK ( pp (0S 0C !P @P4 L@ỻᑳp``p/<P 24ٷP!< 0S!0L BB@3/ 0Ӭx@ Pd `P 4D P414+ C HR #0 p0 PP 0"0C" B @ 00 p0 y$&@)X%&J@%&!K)%&9K$&&tK%&p%&BX-RK%&cKB(%&yKpKHK*K,ECECi0Liui m@-.P qd@.[)8@-HH@<<,0400 Ѝ*&)x)d@-HH̶@Ҷ<<˶,0400Ƕٶ Ѝ޶0+&) )@-t@t ⱶh0(,⭶ ⳶(ⱶ0H媶8@奶@040夶0ⶶ8⫶Ѝ@蹶)+&(G-`Mw2P:\P2P1 `p* P2`2@PP2H@R0 0K0P @O I3 Hp HQ 2P  a@1  p0b0 @ pX0| @Rl N080<0@0D00 0000P0 0 80$@0P  8F1 HL@P@T@X@\@HP奬 H㡬i1g1e1 0400,0( ,00@@0PpPPUPT0PP 0/`Ѝn oom on1oHoD-&d0.. . .d)O-\FMX6`pP(` 08& B%p$6U K V0S@@`@0VoP 0SЍuPfPFP RPZ O5g@PP]0P 0 hc0#S kP` $3$00S`  $'$00S`GP b0#S (uP $ $0(0S x $$0(0S|00y0P  PN4q I4q D4 4` @s0KSq00CP0 @Q 0cR pR bRJ bJK[g0Y`[J0^00I?o20P00 U.Ux U,P 8 8 0,3/8 RPSX F@00S_ a0P| R00C?o20SV\ _y0 $00h,0$00S 0U00S 0 a0S0P000010S'1 0S 0w0 P 0 0 Q0s  h1000T,0 0}08/1P0S& SR 0@0@0 #  R S 0P(0s  0p00S / 0E0X-4p&l)^opppppp q;qqqq&^qqO-@'M⸆V M`$@@@& #됦p/6p0PKlU00S0C 0 1U0 U!q6MPPy YDbP㬀H= :/p`*0S   eAP* a@P5P00@50S $@Y h8aXu@000@0000p ᐥP ዥP ᆥP4 P/ P*pvP dP( `}p qLPXq/`00 000#0 00$000 PP+[`P'ݍ Ѝ( EP(@TPY u1 PP(!hP( ]K[P`P p80 0PP(`p` qbLP 00 00$00 0VPP&[P ZP[P ZP PdP TP DܤP!@jP0ԤPZ P( ]Pp` P( +⚔ /⏨Pm``1V":r0 0.p` h!h/P.0SH0 0 000$00 00P0@(p t/p--0Pa0SJ(S'- 29S!S1X/0S (W`P@\p_gsx)vr&wlrX-\v]ssvuvvv)zd@8)edA p@-P@C6p@-P@Cp@-P@Cy@-p@-P@Cp@-P@C,pp@-P@CpO-NMM0XN@00`4PᰨdP 0,~0 P PG 0~S$0Gp000=(0썟0$0 0 y!p@4=10>0S=D$R$r R  $T}t $II<$9n0A2 @ x0<$80(0I-p0 A_`PEB@D4T@@0$0<@ᘣP< $ᏣP u }\< L< $$r $PL` xP< $0 00 , 0 <0K0(0 0,;0@r ^; x;$i00 0 0 @;[0T0!0 h 0 ; M00(0 4 0*v:$?00!0 0 h:(100!0 0 Z`:,#0t0(0 0 L(:0@:@:0S  P00 L: 0008  !00  0 ':00!0 0 l:0p0!0 0 $94080c 0 t 0 9 00!0 @ 0 888夘@0S C.0 lIP"^]IᆢP0@4 P@ 0 =^48團@pPD40 hPD40D4~  G +0P(0s $@00 1 1 7Cbt7@ P00Z7 000  jM 7F: P0P/ +P h]0SX 0T450 020<4 4"8 @/,PEU UYv ∥ ~℥0$V 0 `S 4S<4Y1 H4L$0 ,pk?HL4`@09S㬵 $E~G?'GHtLW09> $?pP5WLHt4SH$L4R0ȕ% +p`  ,p  4S@)`; CO`P\%\,p h19: S8 5 $R*@P <TP  t hP 00,0000XZ3$R  $~?0H0Gp!t$Ts = 040GP40, r04 KP ,FP $$03}pTs 40S0X44S9>@#$R !SR+ >C0 # !rP 0[T4P |3L# [T4ST31P <3 50 >C0p1"R 2H$L4P*x\p 0p L4H/0#! 04]p02 C  g\$0- S{pvLo z 0P 0(   >L$Hq? " $R 0-_W P0$$4RT SQ  W  )pp pWS  !S0$Q[ +S0$0 Q$ Qf*b)vΙޖ&7dX-ә֙&ٙ#/U]w&Țٚ%@.&6AGH)˛ۛ v˝)Ĝ%\s3Nb|Ş0.&hӞʙğҟHL$ P,} P+P *+0$PvS0\ 4S$iP 44pS04144 0S @4S 0 @ 50@4,4S $4R#1ѣ1,40000 (0Vv Z)t V)0S 0Ȉp@$ P& 0!d,m^`E}JCzP9/X Q :$45041$4+T4S. ^ *("d0l,))))T)\4$82 H4h<$42 x00@ 0)ptQr|P Z jPqPa  Dp  TD Q  /0, 5O-M4I44iM0p44) pP_8`4pGs04WZ pB⼢  ḢYa 4S<44S $$4R0|x((pl  p*pT  4 SP40S 0x$0V $tZ0 0U $0J P$ 1SL  $$4PE*`rZZU CU 7DPEUPPbPEUUPP7 0 ,'8#800 R'0C Rn ("(CZ044s04b00 0 0 I6T0`V0(0 0,;0@E d00 0 H 0)500*0 +0 )00*0 +000!0  000c 0 0 \500!0 h 0400 1 <1 40(40S Y00@;t$ K0P0X$Yp)p 4S, w'PP$,0Q`P#l ht  X4 CP00 0 0`V Z80 .p%#4,p = $00՝P$0 r004 םP ҝP$#0[Y3}p,p4S@04Sp 1S !10"L 0S qp֠0 S Ҡ D  0Z, W0S0SPT0 =/@PAP 0$ 0 0 @x(xF@P^W zGލ Ѝ肹&X- ,6COZj|»ѻLO-` -M@p L`K@`&TUP+W U&P$%p`3o%%pP `";@@4$ pI 0{0@{{SH{{S O%P{{ZG%P<;S@%Pݻ QP[ $<1[<  AG8 ({:S[d(;t X30Pe2pGS<+10X2#(30S" C@4P 09 0$3 PP 3P  Q R V 0;8;08; 00l2H2P0"2 P R  (x{ l+StV42 PP 2 R / < X 0< 0: 0 XV@0 010@;F 0@0 00 008;0t1 PP \1 R /@ 1P& 00z 00w 09t1 PXP 0 PR` x0 PTP 0 R @RD xh?{Gz?eA`RMb@At H*0L{&3PnH*I*X-@*@*&9I*jI*v I*I*9=*H*?*,9&@*K 0; 000  0 0 000 0P 0 P R  Xp<00 ,Dd }P 0: 0 l>t|1!.8@ Z12@TȌp Ťpp ňpp Pt  lU 0@ 1@  0@TdPf 0C Sc0400000,00(00$00 0000000000 000000 00zb 0pRA @@&̂WB &r8;  00L0 &$p.8; 00L0 $pP 8; 004L0 $p8; 00lL0 #p pC  |0 x; D0 y;z+0;0; ; '0cy;0z;(0x;+8@ppL0 #Pl;"0#10@00 0`K`QH D `   `0 #PnK0S ``K0 #P(a 0  00D5 #PTTd '0d h&``p5x%p}#P5%`u#5`!2(1kkkk,a0a4aU0 0P````s<;SVW#>˟@ XzL{ k A::۟SC#@ }XVz{ k A9I:`"2Rgd@' { `30S 0 ' L N@^IN2 X0引!pV00 @+L0@W0 00Dh%@X2 ppW S p,2 "PK,"0:CS0K"`LojL1堋CA{8ZA {'NjGޜ@8țINT{ X({*o!PU7 Ӝ0S3 <e0T0xpT00p0p+tN!P 0S 嗎"t;<000[ X0 0 |& $d2"SS$ 0 ! $@-C6?8~A@@?*TI*lP&tI*H* IH*&9&H@*< `H1 PS, 2R`2p0C(4"<8#8W`0`d0 0 0 d20 "  |  `N`0l0hd?ph{3{7@{{{{{ {  M 4'4#0à3@0h2 0h22d0@#Xp | &0H $#$<0(0"(0@02 0BS; (SC; = 0;[$p@0S:0#h2!(0H0C8C8S!* 0 0H 8(#8 "(=$ 0 @R1币  hϚh⁚;    0;$ 0W|%0H $#$<0(00"(@0_p0V 0 1 JxP<0[@W 0 0RZW|s%0H $#$<0(00"(@0+| 0 0D hH#p0WpD#<#pH@*9&5I*P&I*j$ 0CS00 P \0Q00p# x|0#!#0ꋟp@0|xt0 zPZ T0 qPQ 03Q0H# ;#0 SP3 0$#$0(#"(!'#0 ?P #0 5Pl 0 ,P Q Q 40r,p0 P  t0 P 0 P 0 P 0 P 0 Pl 0 P H0 P $" 05 10Sl ES` S W|7$0H $#$<0(00"(@0p"HDXp $6[iz.{G]#[5=lI*KPVSIZ0KWI7LY"DDJD0J0ZD0 I0) 0K J0KO  QJY0KWD01ʸ+Y QvP WD0 %"D0J C 4 ḛ庘WT"pDDD0I0YD0 0J #1 KJ! W!O-M`Pj0@-S@ᴔP-3 @ Уp#@p*30SP a`F0P[:PQ9 KJP9 2 H P8偔P@3 C d0@S L@p20S/K@HGG 0ڒ 0  X dOY'G`P+P`8b2 R    0 S    U+ 0  !D !000> WNpmjgd ajp40 `p0S|W#|` Np0Sz뢘P= 00p@@q  0RO Vh|`I+p&?%LbxO-PAM Mv@`s6VPm&0P000-S' @P 0P0Op0@I0\[00`F00S@DDA@D`u%p ,0S@bLP53 Q t őrP -00 `@[-00  D0B5S0 00S NPN0 0꼄z4P N0000x44 0S hN P4  00 8 P   300S Pm0$0h0(0e0,0b#t0Cp ?o2R0S0$0PtP X2x@Da0@ :T03@00`FrS= RS iS1 mtS xS [묢Բ +ll 0p 0@00@00S  0YTT0S /~ 8< Q (0 B b/S CD?(0S 4 0`b##v0S (0S |10 0K\S @^(0S ( 0`3ND% @pP+ 0 pPUUI+X- s+.:&Ktv&,$&J :&%FD)P&0~6b%PO-LM'8N8nP0.Sp>,# PER a0: @@0SC:MvPcPSP TP LP d0@S00D003030800H00 30$30(30,30<00",030)@0,0p  qW3S(2)P @ P< P/P LЍO23S +00p,}0x4 s8n<i@d 0RWS[0ZSPQtD! 100gS @L{ EY0`,  aR @L0Z S pL0-S0 @ 3R: "00: ` P00 |:00 h:43043{0830<3@30@3ppzzyyx||{U,0 U ,0 U ,0 U ,0 U ,0 o0 0U ,0 bL00L0U ,jU S SX0X0(0CS0 P0D#8 D#<#  P Q0P0083 00b0X0(X0 X 0X@0X0X00,0  ,0  =<PPdH0S7 0"09@PH0SX'B0-,0 SSX 43Spᦔ0P塔/TaUF cU2 gU0BP㓔03S_0Sa 00gS# H0S |&Z 0  `d0Sa T pWpUpWX 0S00a ,048< @ DULЍ0000H3P0P xH30娐PGD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0T ,0 R B    0z< Q $0Q P0 00 R B    0z< Q $0Q P0 40 R B    0y< Q $0Q P0 80 R B    0y< Q $0Qp P0 @0 R B    0y< Q $0Q^ P0  <0 R B    0y< Q $0QL P<0PESZ $3S0S .D0S]@ p9o07S k  00&c;sr<  R  d  v      UlP/0S 0S 0S  Q 0   /ypqPU  s8 30(#0<  p 0+_&rzC&++++++++  CЅ+&/<+H+ 8BG-PXM`-PHx  IDP b0@SS080 6(} p80U '0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R 4&R <&R 06S0AQQqPP@t7=CP P刍LWP0S 4g P 0000 P6T&0 ^T@PPP061 f(VUUvp00+Sㄦ`(x6 000{<0 0/01$6T& P 0`00 :XP00F00XR`ᚋ5 @P 00 B00C2#S0d0P0 00 B00C2#d Pv>C 0C0U U0@0 B "00 00A00C 1#C Q0P 00A00C 1# 00CSP000C0A 1#S0 00 B00C 2#;S0L4qpz 0P 0PQT+0FH 4JZ2V w`'o`F#P% 0SU030#:U %5P8 P 2 pBP&T6K/r06SP<3PvTS0 0(S9# G@EuSPEX!EK/r06S6P3u 0 0<6Sr46Sr 06rS 0GpRL2 01u6S 4P W0`W  0|P t,6S m/X`P b[Q0 Q`"f崨tD⬨<6S46S^E`f^E`@6D&SD1 0 00R4!P H&(QR$! $& R! 8& R0&PR  Q @  @ E뙐  @듐@kx+ FX-Y&gD ȑ+++F & &%P  Б+ A-PHM`pI!& p10PEU HP h0@ S SHHIIp1妮h1X1 T1 pa@ TP (1`$ )aPP F䀟 L`$@@`(` `C 6RP *P0S PxW JP XF0 0000 c`&X-C&j!+uxyt Ct G-0HMp`0*BR"p 2B1 pGS 1S 0$  !RS@# P+PT P<(oFxP`PAP MP !a0@S0 00 04044041P100101@30@3101101101101ДY 000 0HЍP {PP  F0S  0 `PXGPW a W pGW R $Sw ,0< sW pD+&C&X--H+P&C-Mp`?PPEUy%p5U@U`F V/@T |'P l"P  aP tP,5 R  0%  PV 0S A@D i P`VD  tP@PA@3PzP0S<0S000S00S00S00S00S 000#WpPU 3 `V= V30SU7 0S4000000S@0000000 0 3Ŭ 0Sr<0Sm00Sh2zP0$0:]0S 0SW`V UUQteP d`P h[PB UB U UR<2PEUNPPUH Q <PA D U2 @U U60000  !- U+?PJX 00000  !P  y $0S c! W pqp壥*b@&T ᙥ 0"600"$0$P @وP xԈPdZ%+!a%&#V$X-d%&%% "#&%%%%##2&C-Ma M@Pp!Dp10S Q༑PE R ލ ЍRP fP74p#/Pd DWOJXP1 JJP/0: S2  S)J #P0 JN@n` 034S00``)0S phJ #PJ #@PJ0b@@+(&(((((O-GM8MM 0'=/ <(, 8@(D P0{PLDl("-B HXLXPXTXXX\X`8d8h8p8t8x8x8x88888(8忁`P   wP:? 0dCc[K ⧁P3>0 <[⟁@P P; T(Xi[@ᵇ0Ph+TX8\ 凁P;P  0S4;8+,(Kh8S <PU hXJnP@ ⎇OoB:p *:8(p P Z`T`hTPdhcd:xJ 0pP0 `*p`W,J0 IP4* 0 0C 001W0܌ l>  \Ҋ8T0P`>0 XP0P- S) 0 ]P\9Tp P89 h(g P9 T(X(]AXP8 h(\40FDS008 (+8 X(T(8 ,8 8P 00S| h8l sB(8, ,, ,o8 ,k7 H(g7l 8bb^7 L(Zg+v PS:?@f 0|7 P(H7hgbp孆P78=l7 87<(8,7 T( X(2@7 j7P 00S% 7$ 6 t(6 U6P 00S 6 6p l`E Nv68`bF08`0 YP 0S46E `V 80p Q+5 ,5 L(5eb00Pt5 `(d(`5 e^H5P ? |5?Qt(qQGލЍP5TL +괖D04<<0P 0S .b {9P@PD8SQbd4 aPD Rnpu uSS> ` 9Q   3Q U +Q V#Q   QW Q q/rQ=  QY~ ZQ]tThT`|TTyTLvT 0S0SA   A@288S2X@Px |b<S P 0S a aD2 kN @+Bu P:B?l |081<Sa\\+t P*1T0:FzP 0i_P X@@P["T TQP"@P T T0@`zPP0@P`‰p@+t0(@0000pU@p,`40 U0(P<P8gb,(PR00S ,R `0 ,0S a,8S= m,8S J+M LM&P&IN& OMX-K&+NI+@NGN&IN\NNT-NNN#O(O0 8  2O*O+ < OA-P`Q$ E?hS墄P03blp2S l  P&@Uo}PO p 9P/P00@˜7' shvP303L$ p840pEWQU 4 000`݂P C,4tPE0S34# 3 P㨈㥈㢈㟈omP|?`ph `\~X3P04sHp4S 8SspP  $?fd P 4SsRapPn l } PpR},`p1<01 1> 11bG01/΅01$1ao31/,9# 2R CzClp`d Pa Q18C8S leq́`o  lQ00S ]p P +`P3?o20S R=?o20 P Pl #p18C8S 0 S 6S 0Rn  \]o=S` 0 0000l o18C8S Z`pd0X,&ff)f=fPf&&\fh,fxR ffP&fO&e O&ffd,,* f&e@-@`PAPt1  lql!pX10SAH81P@ w 1*$q#P P0 nPbP 9P0P  c0@ S0VP  00@0T0 D0  40   vw0S]n,jn&_non&nHQ&A-`4C00P@0$ 0#sP0 0vłP00{6`;{Ӄ뻪cBK借岂P00a0"SBP :U 0+0C0SPP \p8ᎂPEP P 0S帖ӖP10屖̖ P10Q AU 0S㳿빚P㮚0PEh10S \10LB-DQy0S(1(>P# P -uxAPSqp 000000S {j|뮎mPP`0S PPp00S8,nD,nnnnnno oo,,1o,x&[o]o,h,o,,O-pP!LDBD``<"xp(2 0 qQ DpPpGeLfuP`P GP IP EP m0  a0@S0000P @<,&&X-P&,O-Mpl_zP`(P,@4`V(P# 0 0S0 0 00 0  @p   W3@P /H $F00,1" 11S00u78xPl0Q tnGkD@0 8Ѝp0H-xM-N-e 9-M-=-,c H-O-?-M-XH-e &e X-e 1g I K j X- % P&ht@ Լ   O-0MPp00@|P? |P ?M / A%ߍ(@).;X?X1T?P0/1012 211R"T122ppp^&[0n0d10. 0>/Zp90|n0C 0 0R080 0h;0 l10 B1!1pqʲ0 bZPPg0Z m 0R- = 00+0 80 0YSVPMP 6P@ ?P7 4Pxp=N@PfP j@PD=P0=0X1hV=&hVP0V30 [0000z00u `Po꘼lꐼi0 pP 0PH G0$Qa8 @0 Rd0 ԯPP 0 pծڶ &84'000`1Zᔐp @ T1S5P C8n᭠8:0P @@ @0 Tp 0 "&pA@ڟ( P0Q819:d!*`1 xjpp ⾟PL 5  u<:< @岝p, D&`11`V ~y)PpYGB Y9 +0d1 ᐗmp<)p ?噝pP \X 0S` ( K5PQ 0S Zo F0080x8"/0    0  2s<8"/0   2sc!"# p B 0< P$* F 008 @宜p 138c72 @噜嚝P@ z@ wx7  @2p0S  0HX0S0S 0  Q 8 0 +zp~0S &BA⾞p~0S t&OBAⰞ\P qL S@⥞c8 ᬞ_,}㓑0 T 0 Swp) bp% P 0$A>0 0T1a5T @廚ptDAxp$0 T1Qp mbp\f$Pp 5p,k@T5 @叚pA X000- 0@00 P  {@ 꾿0 30 ဎpt@ Fd#\ L$# D43ᵞpI  y+p3 @?pTA!R`14`11GP0@!ğ0P!t00!R00SRd18^(`1Z  R! Q01Y<(p ᰟ`1 Ñ1Y4180; X >< 4900ᦑṬ1PU| 0S 1 P P 0S  k 0S ᱏ ] R080SX  R   P1p0 S   0՝`Va7 ( D& = &\ Կ ݿ X-  9 L | @| p * L  l   L + , W l  l  2 Y   P&؜0@0@ 6끝h8n0 D  Q/0@-0t h P ^0I8f@6 0 0$010+4P +1O-0bM!Mb  Z !1 b0  0 30_bݍЍn t( Pp  0 #G \ ,r{` ; (0$(00G +x(80G( G p x8_S  000 00 0Ԁ @G P 0 wP x8#`@#Z* wP 0l8 40G PU P0l8 40G P"(EtO DO DF D0ƒ S$*0@- R P@ 0\ R^ H00"@<0 0 0^ 00"@0/BBBp@-`hAh1M@0``T!0P1 0H 0 0!  0 FQPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp 0HL `` d P4 @-M   ЍXh  Q/X-M  0I p 0 S 0 0 ЍZĜZ /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/*/*/*/c*/2*/|*/y*/9v*/s*/p*/8m*/j*/g*/d*/a*/ ^*/[*/X*/0U*/QR*/O*/)L*/{I*/|F*/#C*/)@*/==*/:*/7*/"4*/1*/.*/+*/(*/////^*/*/*/<*/*/*/ */ */*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/ */*/*/ */*/*/*/K}*/Wz*/+/ju*/Or*/ho*/il*/vi*/f*/c*/ `*/]*/Z*/W*/T*/Q*/pP/< /G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/4T*/@-@y@*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: \y`~filoruLxP~lD@|Խt@XT 0P!p+8DNZ`j'w168R8RVV$^$mvy|dllܙܙ  0ز %s%s: %s not compiled in catchmodcpdddfedlnlsmkdirmvpaxtarpwdrmrmdirsh-shsttysyncchownchgrpdisklabeldkctldrvctlfdiskfsckfsck_msdosfsck_ffsgptifconfiginitmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_nfsmount_tmpfsnewfsmount_mfsnewfs_ext2fsnewfs_msdospingreboothaltrestorerrestorerouteshutdownslattachsysctlswapctlumountftptipcugzipgzcatgunziplessmoresedtsetchrootsysinstprogressdhcpcd// //////////"'+stdin-%s: not a regular file%sstdoutmalloc, using %zu bufferrfrUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s 16!**33Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_open%s: %s%sfts_readreference $(*,. HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLENpushdne/usr/src/bin/cp/cp.cdnesp >= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %sWlZ0^ ciT@@osv @@| |@@@|@@%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdin@Pfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of inputllll%,l2llllll8lllllllllll l"(/ll5ll;%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\TTT(IT@TTTI(1TITTT1vHY|#Gp(f#>|Tiinvalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.EG9 total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long3Rg-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s"5'5-5522Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing 999999999999999999999999999999999999999999999999999f9999np999999p999999999999$9'+-/91AOQSYQ[]_9c @@@@@@@@@@@@@@$'@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@"'+0@5:A@lnuz@ Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appending2 )  AUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory "33"}c}Tcc}c/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdout+PPP=PPusage: %s [-f|-i] [-dPRrvWx] file ... %s '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sexamine files inremovefts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found 5$+iEM=aO]Varithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expression:C5@FP%-V"SKarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %sffffikfXZfffffff\fff^f`fb-n-ewrite error%s: : %sI% U% k%}%%%%%%%%%%%%E&Z&1&K&a&#k& k&_}&^}&F}&<}&>&?&&error %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long@NI$2Vkks{%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss G   048%s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string %s is a shell keyword is an alias (multiline)... for: is : %s is a shell function is a shell builtin is a special shell builtin : not found usjQ?>TTTT7goujjW-EHOME :]./%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier%lldnull or %s %.*s: parameter %snot set%d%zunot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misused$4ad;AD:ZZP'/]}64/dev/ttysh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes%ld [%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d %ld[%d] %ld /dev/nullCan't open %slpZ%smore than one -p unsupportednp:invalid name: -p '%s'%s readonly%dYou have stopped jobs. ${#${"(()(...)$(...)">>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSread errorSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error 22t22f22d22s22c22m22l22r 23p 33n32v '3.3b HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%7:/\(8nYShjrltEEEEEEEEEEH66I8%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpectedn:z:::::::::::::::::::::::;;;;;%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: \1:4:9:>:C:F:L:R:V:Y:^:`:b:g:l:Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"7c/gkkPipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)C>J>@P>U>^>d>j>p>v>}>>@%d: +%s%s-%s, +%#x insufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error ->/>2>4>7>:>=>@>@>%d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATIONl(0AĞ(1A(1A(8AX(0 BD(08B0(0?B(0FBh~(0OBPS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1>>0>&*->>>7;W[_cccc $/:EN%% %s: out of range'%s': bad numberCCC CC DDDDD D D DDD DD D DDD D"D%D(D+D.D 1D!4D7D:D=D?DAD!=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unsetJJJJJ0JbJJJJ}JJ(JJ J|commandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexp\KdKjK>mK`pK`vKШ{K@K@KKK`SKSK$K|Kl(K|(K(@KIKMOQS    2.*0(, 4incomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failedZRbR hRlRpRuR{RRRRR RR RR R RRJRNRTRoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOPT(T*T(T(Tl(T'T( U0)Up)U*U +#U8(&U +*U@*1U\+8U+>U*BU)GUl(LUh*QU|*WU +illegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedttyYYYYY#Y3Z#Z3Z2Z3Z3 Z#'Z.Z4Z;Z BZ@HZ@LZSZ[ZbZrYzYYYYYYY Y@YYYYYYYY XC$XCXC$XCXXXXXXXXXYYYY@&Y@.Y 6Y ?YDYKYRY@YY`Y gYlXsX{XXXXXXX X@litout-litouttabs-tabsopostonlcrocrnloxtabsonocronlretcrt-crtnewcrt-newcrtkerninfo-kerninfoechoechoecrterasecrtbsechokechokecrtkillaltweraseiextenechonlechoctlctlechoechoprtprteraseisigicanonnoflshtostopflushopendinnokerninfodecctlq-decctlqignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonflowixofftandemixanyimaxbelcs5cs6cs7cs8parity-parityevenp-evenpoddp-oddppass8-pass8cstopbcreadparenbparoddhupclhupclocalcrtsctsmdmbufcdtrcts%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8s usage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZ====0==0=9owner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreferencexxx#xxxxxxx/"&),FBXi|~DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %sOrWr_r@+q@er@mr@tr@|r@r@r@r@r@r@q @r@r@r@r@ArGrrrrrrr rrrrrs sss!s-s@4s@9s>sHsNsYs`sfs.rlsrszssssssssssssoqtqs%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%sattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:orooo pp0p@pSpupppppppp%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=%jtttttttttt_tu uZtucttqtuuu"u%s:unknown%u:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:sssssstttt%j&t+t3t8t=tAtJtUtZt_tctgtqtwt{tttttttttt%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO#q+q1q5q:qAqHqOqVq_qfqoqtqyqqqqqqqqqqqqqqqqqr rrrr%r.r3r;rArGr/tmp//usr/bin/viMACHINEMACHINE_ARCH%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd %s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:}~~~~~~~~~~-~~~(~~1~[~?~~~~~Disk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>}}}}}}}}}}}}}~~ ~~~#~(~-~1~5~?~E~I~Q~U~[~_~j~y~~~Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdDYDYYTYDYYLYYYYD# %s: 37<DINTZ`gǂnr‚x˂ق{type: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u 3:?IS\cry‚ǂ˂ςق߂/%10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. 5>G%s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'147:'@*TMP-1  ,%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrNested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootablez (;Qrӥ - L w  Ŧܦ(bƧާ !&#&$/&&1&273&4&5S6&8^9d9k:;<=Ԩ@AB3C_DEFGHJǩLMNO PQ.RCS]TfUnVW\aŪcϪd e,f@gShSiSpZq&s&t&upv&wvx "1Cdج 'EWnϭ $$$DdlyϮ&&&&!:QVivͯ'FSkӰ DXx&&CH[p&&1DWc%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table ;]`rorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstype`ekov}·ɷѷַ޷ "&.28<GVbrvfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%s Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block go!@GJ]cjsv|usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) XX))_*w_ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORY3:ACG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entry   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%d DUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d a:i:s:b:l:t:(7#&@index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b: <#&No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]dXA#&AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]!C#&@@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x),9 B ] d w       $ Unrecognized attribute `%s'%s%10.10s %s , [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %ju (%s)primarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tablebiosbootLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to function5 `j#&Media SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector%d- Media GUID: %s - Number of GPT Entries: %u headerKKKEKKlabel changed-rCan't open `%s'Can't copy stringCan't label from `%s'ab:i:L:s:t:f:l: k#&@label-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored%)7J_qbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrGG,,,",>,,W,,Pgpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: P:TP  H*++,,<.22L39( Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameter*  "Unknown FreeBSD partition (%d)*%u* &,3;@HMRV_jotx|Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sp|#&@Afp:sNo MBR in disk to convert.Ob  ) T p ?dx !#$ &12345068;9A9H:a;{<=@ABC<DcEyFGHJLMNOPQ R S: TC UK Vc W} \ a c d e !f!g0!h0!i0!p7!qstuM!vwS!xg!!!!!!!" "A"a"}"""""#"#4#K#g#######$$$!$A$I$|V$]$$$$$$$$$ %$%)%<%I%[%u%%%%%%%%&&&>&S&p&&&&&&'+'K'f''''((.(C(](}(((())*)6)Y))MBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sx+#&@Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremoved+\#&@ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type],$#&@a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q].#&@s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] /p$& a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l+%')Hx %%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)%den_GB.UTF-8 (active)UnusedExtended MBR - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s ()start %*ssize index contents%5d unknown%*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: None %*s[ %*s ]Could not find index %dDetails for index %d: StartSizeType: %s (%s) Attributes: u2̟ $&gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed 2L$&@ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l j3$& a:b:i:lunset-a attribute -i index-a attribute -b startsec-lSFH0eC/757SFU0eC?7I7Hah!IdontNeedEFIS7X7(s*K>;b7f7|nQn- q+q7}7|nQn- q+77|nQn- q+77|nQn- q+77|nQn- q+77=rGy=iG}77;Mt?77mWC 3KOO 88yD<#*=( 8*8YbBRuoqr48C83Dh&R8Z8\ M}-m8~8@Mjy֬88-чH88-чH88ZIчH88IчH89IчH992IчH.939L6 %?a?9D9S'@ )ѸQ9X9*1@ )Ѹr9w91x )Ѹ99ST.qBHo6֯i99%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL9($&@UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]-<0$&o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdin6?84$&@Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeABB[%+-/EXXXXXXXXifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s HLPLUL linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroyMzi%&Myialiasdeletetrailers-linkstrdescription-descr-descriptionNNN%& D(&NNN%&E)&E)&C)&KCE()&ICX)&%N%&oD (&.N%&D(&7N(&CN%&JN%&broadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6QQQQQ QQR@RR(R0R 9R0BR@KRTRYRarpdebugunnumberedlink0link1link2VV"V -V3V 9V@PLULgetifnameinitmediaSIOCGIFMEDIAinit_current_media%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULLsetmediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediaoptsetmediaoptmediasetmediasubtypemediainstrcsetmediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA,%s mode %s%s%s instance %d\G\\\\\Z\, \\ \\`\\@\\\\\\media_status%s: getsock%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s (unknown supported %s media: media mediaopt media_constructormedia keywordsinstanceanymediainst-mediaoptO[X[ Y#Yh*&a[X[ Y#Yh*& YX[ YX[*&XX[XO[0*&f[X[X YL*&XX[X*&no carrierno networkbackupmasteractivedownno ringinserted1+ 0af,%u.%u%npaddr_match%s: prefixlen_to_mask(%d, %ld)%s: prop_data_create_copy%s: prop_dictionary_setunknown keyword type %d$ttunsrctundstsettunnel%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] ???0 tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnel^%&^*&bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanif<`x+&`x`\+&```VLAN tag(ELly{}NONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ specnfscan't get net id for host "%s": %s $thw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ʕѕە  $)5@=Cgetmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled. 2 0 #:NSao}A*LZo%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).<t?VlM`ТG|ã usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsbeleWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableappleufsApple UFS%s partition type is not `%s'ffs4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatime rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.%s: %s/+-$ ")7IKWco|%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: %s  #'+3;CKSW_goy%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @XBiCxFILNOSab ce+f=hikmnoʽrٽsu -%c %s offsetcreate sizevolume IDbytes/sectorsectors/FATblock sizesectors/clusterdirectory entriesdrive headsinfo sectorbackup sectormedia descriptornumber of FATshidden sectorsreserved sectorsfile system sizeCan't parse timestamp `%s'sectors/track@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:/dev/%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyOEM stringBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per trackunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: no default %s%s: illegal %ss%#x%uCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file size%sgetmntinfo/dev/%s is mounted on %swarning, %s is not a character devicecannot seek to %jdA@@E@h IpMp QpUp Y` ^c@ h $%s: unknown standard formatCan't get disk size for `%s'bytes/sectorsectors/trackdrive heads"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880%s: %sbj #'@PSVgmp>Gey  "$&(*, usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%x     pusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%s?<0&),080I0Z]0`usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure       &A]uC+P%command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue5/ f|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c ũ©)+S QJNChecksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s YYYYYYYYYCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxy %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"prefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood H[t 4Tt B b   %s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspec       " % ( +?[* Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in ~30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???PFPF0* XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip ~W  " "&%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/' 7CMY_twY3ddM[kskkk  9 = Y d w ~        ! -!E!J!p!!!!!!hh!!!!regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor !&ADGINPSV]bg9?KhKKK2usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260718NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260718NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverUnsupported redirection Location `%s'Too many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c IKImI421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection2?\x "*.;MQag|usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)@PBRFRJRNRRRVR ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBA]Token in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend break9>plEt9VxUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forka'1HBHHHPaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhf AT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x),:EMT]eit| malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory 0000000)<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0.invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bCH @j18RnMHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEkkk=kkkk>ddddddd+1YMX]G;btH'2;z?5 'ug PD]o!by9GJ]/6ePQWDbQPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEY~D ~D pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file2&*.)/35;!#%'+-1%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s 2"$&(*, " $ & log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %s1!4]WValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGSX%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty   vm A\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'$*-5?Br setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %s7}}}}}}>}}[g}}}}}L}h}}}}}}}}}}}}}}}}K}}Ubn}}s}0}X}}}r%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu  . 'malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknown &26:usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-i #&/)  #&- ),/ $     "2( &" msdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgzFTPSSLNOVERIFY1/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.7 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.7 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.7 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.7 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.7 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.7 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.7 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this? Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. g g g g U-g g ;-g g M-g g D-g g XH-g g WI- h h VJ-2h =h =-Zh ih <-vh h UK-h g sK-h g rL-h g N-h h 9-h H-h h G-h g 8H-h h N-h g :-h h h9- i i N-i i =--i 6i ?-Ei Si @-bi ji A-i i >-i h B-i g B-i g C-i 6i O-i Si P-i g Q-i i E-j h R-j g R-j g S-r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.7machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy%sFTPSSLNOVERIFY/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7FTPSSLNOVERIFY# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed/dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eulal 5u l au %s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5Xs *u /u ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptunFuT?????RE%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalid} z } } } } } } } } } } } } } } ~ ~ ~ ~ !~ %~ )~ 3~ 9~ =~ E~ I~ O~ S~ ^~ m~ y~ ~ a%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:863: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF x x x } x /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc /netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasedtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugxdebug#.I P U _ i r y Ȍ ӌ ، ݌     ) 5 E   %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s = pe l & & ' : ; R parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES "/bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/etc/resolv.confpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-30s %40s%-50s %-10s%a, %d %b %Y %X%Y%m%d%H%M%-30s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error     - 4 : A I N V [ ` d m x } Θ ژ /dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijzȍ x ԝ ` 0 H D ̫  p Ȍ t 0 T 8 h ȑ 0 disklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS 4 %7%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0rD%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default " %2RAHXblv%/9#AJPV\bhck;258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_new P8Ԍ {x}xď\w@z(w~v$w̫ 0hHTyxTsx\xxxout of memoryB *   ( ( , L 1 <   B G ү N ߯ ! -a X a h q |  ,gpt %s %s -b %llu %s# * / 2 5 : ? B F L P V [ b g l p y ʯ ү ׯ ߯ %s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1181: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullUnused Pri GPT tableSec GPT tableSec GPT headerGPT part - gpt resizedisk %sunusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredSFH0eC쬙 SFU0eC쬩 Hah!IdontNeedEFI ³ (s*K>;̳ г |nQn- q+۳ |nQn- q+ |nQn- q+  |nQn- q+' 2 |nQn- q+@ D =rGy=iG}H S ;Mt?^ i mWC 3KOOt  yD<#*=( YbBRuoqr 3Dh&Ǽ Ĵ \ M}-״ @Mjy֬ -чH  -чH4 8 ZIчHR V IчHi m IчHx } 2IчH L6 %?a S'@ )Ѹ µ *1@ )Ѹܵ 1x )Ѹ ST.qBHo6֯i  %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/ Ǻ ں   ! 1 A6 @ H R b r %u%s (%u)falsembr_get_generic_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_new   d4 $0l\0ԯP8̫ x| |dhHtpD%s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition!usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s N %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP %s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init SY^}22,^222.4jn22v282=Iy21G6~2Bt!',:?DI^ssplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument b c d$ e( f/ g; hS iD jL kT l^ me n ol pw q r} s  t u   v w x z y A B C D E F G H I J K L M& N, O5 PB QJ SQ TV U` Vj Wt X~ Z 1 4 6  | ~ }    ! & - 5 : @ F L [ _ e l u   }          >  ) 3 ? R _ m y option requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:strslen >= len + 1alloc_args/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULLH}H}(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_free&ctx->froutes != rtsrt_headclear0rt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deleted$~$~rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_delete(}(}sa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULLS ] f m q { - %s %s_%s*(bufp + 1) != '\0'script_buftoenv/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%s1 6 ; B E K protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)     % ifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %sE!P!\!k!t! %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s!!!!!! G !BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa tcrer/etc/group: : :r/etc/master.passwdOOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- PPPP: (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'mallocPPVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory .d !sj !sp !tv !(t| !Ht !ht !t !t !t !t !u !(ualnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646tolowertoupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ !& !!$! !!,! ! ! ! ! ! ! ! ! !  !@ ! !"d"`"ASCIIcs_path!!X"! bc_base_max"! bc_dim_max"! bc_scale_max"! bc_string_max"! coll_weights_max"! expr_nest_max "! line_max"!  re_dup_max"!  posix2_version "!  posix2_c_bind"!  posix2_c_dev"!  posix2_char_term"! posix2_fort_dev"! posix2_fort_run"! posix2_localedef"! posix2_sw_dev"! posix2_upe"! stream_max"! tzname_max"! atexit_max"!/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinUnknown error numberUnknown signal number%m (%s)aaaaae%JaaaaaaT["!"!,"!Ж"!t"!"!"!`"!"!#!L #!#![:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%ld oh  SL} 8" s$$ januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDϲ;15MS7) |;p%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nny:mWnC!n75VPLHD?;9/-11)15-1$1TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K6Dzg Tr_I" 6A.o\vI16Dzg Tr_I" 6A.o\vI1" acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C059N13xfr?tZunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`K #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @ inflate 1.3.2 Copyright 1995-2026 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.2 Copyright 1995-2026 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.2need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist