'V\!iii=\!iii<\!iii;\!iii:\!iii9\!iii8\!iii?\!iii>\!iii=\!iii<\!iii;\!iii:\!iii9\!iii8\!iii:\!iii7\!iii6\!iii5\!iii4\!iii3\!iii2\!iii1\!iii0\!iii7\!iii6\!iii5\!iii4\!iii3\!iii2\!iii1\!iii0\!iii2\!iii/\!iii.\!iii-\!iii,\!iii+\!iii*\!iii)\!iii(\!iii/\!iii.\!iii-\!iii,\!iii+\!iii*\!iii)\!iii(\!iii*\!iii'\!iii&\!iii%\!iii$\!iii#\!iii"\!iii!\!iii \!iii'\!iii&\!iii%\!iii$\!iii#\!iii"\!iii!\!iii \!iii"\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii \!iii \!iii \!iii \!iii \!iii\!iii\!iii\!iii \!iii \!iii \!iii \!iii \!iii\!iii \!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii\!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii !iii !iii !iii !iii !iii!iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii!iii !iii!iii !iii!iii!iii$!iii4!iii!iii!iii !iii !iii !iii !iii !iii!iii!iii!iii!iii!iii!iii!iii!iii!iiiaiiiaiii!iii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiaiii?\aiii>\aiii=\aiii<\aiii;\aiii:\aiii9\aiii8\aiii?\aiii>\aiii=\aiii<\aiii;\aiii:\aiii9\aiii8\aiii:\aiii7\aiii6\aiii5\aiii4\aiii3\aiii2\aiii1\aiii0\aiii7\aiii6\aiii5\aiii4\aiii3\aiii2\aiii1\aiii0\aiii2\aiii/\aiii.\aiii-\aiii,\aiii+\aiii*\aiii)\aiii(\aiii/\aiii.\aiii-\aiii,\aiii+\aiii*\aiii)\aiii(\aiii*\aiii'\aiii&\aiii%\aiii$\aiii#\aiii"\aiii!\aiii \aiii'\aiii&\aiii%\aiii$\aiii#\aiii"\aiii!\aiii \aiii"\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii \aiii \aiii \aiii \aiii \aiii\aiii\aiii\aiii \aiii \aiii \aiii \aiii \aiii\aiii \aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\aiii\ !iiii!iii!iii!iii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiiiaiiiaiii aiii aiii aiii aiii aiiiaiii aiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiiiaiii!iii!iii!iii B!iii B!iii!iiiaiiiaiiiaiiiaiiiaiiiaiiiaiiiaiii!iii!iiiaiii aiiiaiii aiiiaiiiaiiiiiibpf!iii $ iii$iii~$>iii$iii$siii$iiiAiiim iii$iii $iiiAiiiAiiiAiiiAiiiAiiiAiiiAiiiAiiiAiiiAiii€PlPUHI!" ;w/B4IiF/=6$QY}k#CMހRW. M8T0ݖ"dZs)a(ò ץyQ9DZq"x6N"%Z9 Ts-OaVu3>$~ . _ya 0! b.;yOE%}|T&Wc'Ru;L׆^IYyT< [X2?闧F9fVPbqF]ti;5ؿeUP&%0` zbg2Wk"yBmuvĈ. SqBc{ъ31!G#|q6 oL<:Pl`B!iֈGޞ,nπ{5=*12M>DfxwSѝd({T(s_@jo>LS}I/TP 5(ao7t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4HD"4 (o!o!Xp!X%X%(T& LLXp!X%X%NetBSDKwGPaX NetBSDearmv6hf4p@-D0D 0@`Qp(@P`F`F&a03/T@p$L$A-`0`` 0PpU(pGpG@Pq`P03/T@0US p$XH-x`Q MN h!h1 @`p0 0R0D1<  0S  /S 0S1Y Y9 T P0PUH2H0@3(1*03/T@ F0地0 [* PC PE%Q03/Zd 0 P0 0AW$x$``$L}%ܑp @-l P`@P H X`POU P  @Dx&P@-@ⷎO-`882@4RMt00t@0pWo ZP@tt@( R q@Pp0: S z9`0SЍU@P0`0x; 0xS0S P0S S0p WP   0S;00 0  pP ;0s s0T /T@L   PpWx&&֙Ȁ&ٙH0`  BR` pRp RX Xp/x&hx&@-#^0 56_x& 000/&pC-؀-`P p0M@ { A ( A{{z`P$0  ЍpY@&L%x&@-@ M00@  $P  ЍȝA-` l1V0zP 0 @P@TV PC  W@@7]0S@ @0;0P W 0Xp]V p]0-S XdcHp 4@0SV  W L%ߝ՝&O-5MpY x{p f`P` Ѝ  p` 0,`$5XP0S 5%0 0 5X0S40S* D$尠DI00CS0 @ Pp  @YT `0 @00CS0X0 X0 .p00p p@300 80: Sx h+p@ p Qt  X0 0, 03($0000x 00 Q00S> 0 0 `Cp2  p 0Z 1(#00 H ? 0P \\wP 4 `+X"J 0R 0p0ZZ3r0S P MHY' p00 R0S ``80S  0 >(d P <`V k`0 ?oR20S 0  0 0R0fP `P hh`0S H,` P0Rt00!'P &L%&&&&&x&x&&&&!&&&0@-MM@P  p  ;0U$C dP TTۍЍ08 P ,(0P X6L%CN&Q@-@ TP DD,P $ 0P@L%CZ&Q@-@ XP HHq0" P $ 0P@L%Ce&@-[0 ox&0$/'0$/8'@-@-@-%@-;V@-1   0 0 ЍP'@-1   0z 0 Ѝ`8'@-1   0k 0 Ѝl'@-1   0\ 0 Ѝx0'@-0   0M 0 Ѝ䄟('@-0   0>00 Ѝ䛟8''<00/@-0   0(0 Ѝx'8'<00/@-0   00 Ѝx'' 0@- 00 $0P@IЍɟP%,0A-`M!A!qX0 p! R0B=0B  P;0H 8 R8B 4!010,!0ЍPP =J0P   0S  0 pP0P      0 3/R ! 7000<040LD08''x',#=pTx8'ԟ0@0p@-|@PtP00 R 0p800 p0  B0Sqs <''8'0 0 0 /'8' @-S/@- @-K/@-@-80M@0(@3/P $ AH08 : S( 0h 3/P   00 0Ѝ00 0 1/qpY0S 00Lm8@@-@>PЍ@H sPЍp@-(`Vp80@  03/PP8003/(PpO@-@P`P A80 (0(3/@Y P 4YPЍp('O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A? 000+ xpt| 2>  ЍO0 P % pHp 81/qp4  ?P p 4 h?Y0S4 tp0 0 0 0 "=0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0g004 8pX  FЍ('ѢX8'|LR/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-lBM0 0  P 0 0  0 o $0 !(0Ÿ}?LB?@PN3c` D0S%H0}??@3c`_`RP0!!!! d 4 !`PE4R4 " BXX P!d424R4 " B   !d44Q4 # B  d4 4Q4 /0Q8p<@0! <` d @44Q4 yЍ'Mb'أU@-@R5C- A `00P4 2#&P8P (01/qp$ 㬀pU Ѝ0S0C080 $0(3/P 0 `V`PE@0  Y $ _ '<x'P%?@-PAM P04!2#!8 P0(5/qp$ P9 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080l0( p 3/p #U0* ,0P/`RP `8'<mSP @-<M4@  @  {Ѝ@'O-XM0PS M. 8S+ #=,(,0|0S( 000| [" ! !Tx00# #M|0 H& %Bݍ Ѝ'|*B 0 Y0 S 0F0dGS07  S  S $0S1 87000000S70 070 00 0@RzP R0r0C0C00Q0 0S, ,B< 6 ta@0 V  $ ( ,@T 00,0$0 000 0S $Z% 0 RT(0Se0'  - 00   0 0,0S 0H 2 8pYʀ0 @@X; ? X07* P 0 O`( P0 Op P0 O@,00 0 00,0 0@"<XP0( P@ p|g# PX6g&(0 p ? X : 0吣$0s'D(00S/ ,0S#$`V $;#40S :\ /\ * P0 jO 0' |P$;# s |0P0$(00Z`40I #(9#v0 "$#l0$K#d,00 0 00,0@0 <",0S 0p804< $`W @Pc  0>000#80]@bV, ?V0(*P 0 4N4 P0 NpP0 N@(0004 0(@ pTO40V3*40 ?V :O 0V㐓$0s' ?V :OD!0 0 k0@0 0<G_ @' SX%֥̥ۥ¥T'J7KȦ @-pPP`@@ PP Ѝ`3MU@p@-XP8@T`@D p OP<opQ<Pp@'A-AP 0P$ 0 0 SQ ( $0P T}h d`P, R2DaDqU`0``000_PT` v00CS000 O   0,`0CS0000 (00/U R WT18 4GD 0$00 0$ 蘖' x&$':'HT0 S 0SP/P/S/@- 蘖'^p@-XAXT0040S+@! PPP P`04 0PV R@40P 0PU4 ^*00" `0PEP P0P4  P U 4 P0CSR40PP 0 p蘘''`%''p@-@10`! S:`Fp00  1S p)Aa0S `10 BRpE` S`l   *P 0a0CS00   'Ƭx&ެЙ'( Q 0@30/@-K'`01S @-0@!S @VBP /d7P /'Ƭ7@-A0 R!RUUʐ0\00ҺP@Fӽ |xj00CS00+ 0 @ R,V R P Ѝ00!S KP 7a0 Sڰ 0R0CS0000 0 Q  vP   '&x& ?A-O 0 P0,p W !GpY\ϟYP PP0  nQ pQ lQ 0 S , PP1S P PPP0 nR pR lR 00 S1S P P0PP_PP0 nR pR lR 00 S1S jP!S00P0PP1S 2S 0Sڜ 000@ `PP 0 nR* pR# lR$ 00 S5Pm PPPೃ0S!S , 10S 1Sm cP0PPPeH 010,0,0]0S000@ PQ 0!SP@ =P00 nR pR lR 00 S-0S  0 _3PP1S PP%G@o%G`GooPbVWP 101@PP00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  .P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PP"PP0 nR pR lR 00 S{1SjP pP0PP PP` 0 nR pR lR 00 SX_aP0PP PV0nQ pQ lQ 00 S 9PPD B 0  P6p PP10S `Vp0VmVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  l P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S 602P0 PP R l Br R0" 0 S1S 2SqW P0000@ 0S0 0`PP 0 nR- pR& lR' 00 Sc1SR1S0!S .0S1S d  PXX 0S0T 1RP0PPP` gRF  R 0 B RC `8m@p>C0"S:b-pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 /P00PP2P02 aP P 0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& HPP0 nR' pR lR! 00 S1S"P20 2 2020P0PPP pPPP0SR `V0V pʈ0 nR pR lR 00 S]1SLcP0PP RPӰ nQ pQ lQ 0 S?:P0 PP&'.EXt%p%r 'x&`P-˭'Й''d%QP000P0P@w _`P 00 00 P 0 nR+ pR$ lR% 00 S1S0!S -0S1S| aWWv FP0S0P0PP1S 2SqXP R$ l Br R0"0 S0@PP0010CSB Pޫb@p A0"S0mPP00 nR pR lR 00 Sx2 00S =PPPP0  nQ pQ lQ 0 Sa0S  jPP0S6PP^0 nR pR lR 00 SBP \2SGP0PP P6 #-@- 00X ЍЍ/' '-0^S0]S0]S S]S[S .0Ls0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,0 P,0A ( $  00CS010 [S \S @@P`0 S @ #0(a0CS,0p00,a ? L0 0@S G 0(ꐘ' ''x&'Ʈ߮ 'p@-!0 P= P@01SE0p0 SS t`P@0P 00Sl P0P00 P0 h0T 0X0QP0@w0 ,(ꐘ' '"'''x&O-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00P? 0A0CS0l10G 0P \QH 0 SP 010S vP/ 000S S)00 S [ U 000ݳP @ݶ t00CS0L00 0`00Pp8 Pꐘ'@'6''''x&Ox&S0A-P0 0p@ W 0 `@P 0 R00R00 1BQ?@ @P咩@p?0"S,"@gR000ꐘ'@'aO-@SMpcȳ00 0GS TcsT`0``00UP|?V` \lX00C0+0&SK BR D R: Y J@p R)PO?) ?00C0S @Ѝh20  S  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WppB@ \ p вP >ϵD @<f00C0 AQ 0 T0 Tpppp  垲Pu p BR   @W0 `0CS0(00oq 0 b@'''Ox&SO-M 0@P0P0s 840S 0 0 000 (0pP ߍ0P0`#2C 00 S pSN(0Y01 Y  $ 1P$W>1P LGH  B R+030  # _  BR 200S 0 0m *= 0 0(PP.00Y0 Y H $ P$  BR 200S 0 7 < P0 (0 P'0 p1pG Y;ttZ 婱P<1=娴, ($?00C0SuX   R    QP> 00CS000^`W 004 00S xxL00S 0  <8 0%X   '@''Ox&S'u6O-pᬡA0M0CQ` 01 00C S00`NlЍ2  0P5 P!` 00000`P00CS000  N[  0S00CS0x00` P  P''''@''O-RB0M00bsp 0siЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S [0p0000000CS0C01;  \" \   " L\ B  @      0C LN 'p%'T'''''A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT @ 0T''p%'G-@p0 PR` 0 P (S%0  d ?P 0 ,(ȰT'x&@-;0 ϯx&O-eGM0PS@pM$Q403/P 妤0: S;00W +' P8:;?0P0: S 0SP0: S 0S 0S 0/S&P70p0o6P- P 0#v PvO+&0P ]D#Pl]vP 2/=P/=P 60P+I [(H Z% U8.0. 0OPT9.0. 0CP @DP ^ PT1RP o R00S$ 0SS 0: SO|PN 6  0#:G=00 04K :G=00J0SP. Tq,XG DX00CS0 p Pp  pYW dfX0 X p00CS00 Ͽ0S ើP0SGݍЍ0c ?o2500ᠾ0 8`'0hx&ްx&x&\\50\\5X X0p@-@P@@DDT ` U H H0Rp@\\5ppX 0Xp@-@P@@DDT ` U HH Qp@\\5ppX X0p@-0P0@44T ` U 8 80Rp@\\5ppX 0Xp@-0P0@44T ` U 88 Qp@\\s5ppX X0p@-PPP@TTT ` U X X0Rp@\\Y5ppX 0Xp@-PPP@TTT ` U XX Qp@\\>5ppX0X @-ppt t0\@ ^0@\\)5X 0X@-pptt \@ ^ @\\55S %R R S R SSh -^L^S R 0/0/0000ꈜ'O-QMTg @ `u @ 0 @0L0@@@ @@D@H@,@0@<@@@4@8@5 SS$c\ 0 !00`V0S9 0 0刐0L0St 40D0800$0S00( ,00B?2$pEp3,0S d4 @?C000@$0D0p0H0D0,p20$p$p2$0S00<00@0#0pp2,0S 3 @?CZ㸰张 0x#pp2 0\#pp20 \ 0C0CQ0B003/040 0S 夭YT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " &p P 4 04080080 0Sb Q> 0 !XX0$0Q: 0 t!d~d0(0$K2[(F2 0R  P 4P0@820S00P00P00ժPP\0.S0S 0!{0P$0 0P(0 $p (k R P0bP000Ѝ舜'frVUUUwm|pG-@a!80S "PP %spW G#<0SB|#@P 8@# 8@ 80S35!0CS0 \r$ Ѯ  j00L0S \0.S0S "%@0S40S t$9%$<0Y?o20S X (040ꈜ'fG-`㵭+P0DL0 P0S$00D0H0庻P0pP〔0t$γpZh4T H0 `F0P 0 HH/P RX$4X0 s0X00 00dt |  P PRPS W( ?R004(0'R S S S3 L0St3 T0Sh3 0S\3PT#QP30V < 00Ѝ10@GS  0$ 00H00P0L0 0T0X0s0X0 00P0L0T0H00 00P0L0T0H00X0v0P00L00T00P0L0 0fb0d0_PP\0<0Y080 PT0 D0h l0N0D0h0000000Bp=0p$0,p80$00,03000@0-0 0*0p0'0t0$0D00h00x00|000000000D0@P |6 㐾00D`0S0\0S00S S S0 30`0St0\0Sh0h0갱'ht@x%q&'|dP|%x&\Ȗp`480p@-@PT @@\p'80p@-@PT @@\p'-L0MSM\0 + ⿹p&60 ލЍ 00 >04@p[l0l 0 0  ~L00S   E%x&2''̜'$0\ 0S 30'0L0S/0 0 0/@-00 SM 4@@$;pЍX0T0P@ CH0@ B ?p 0Ѝ@ꔜ'''P'D'P `00CS`0p S00 P0S X0X /Xx&: S@-  S  S/ I* S  S%|@=A-x1`@TXPM !X嬿@P10S D10S- 0qp'pw *⑿@0 0 0) 0@0S00S 0: S@Ѝ0pp 0GRp0x |B?. 0aH00S ꐜ's''P''''''̜'s@- sP@@P `TU00S @KT GЍp0t  Q \0 \@1U ,P@(U''p@-P@Tp0 0C0  $E @C-@4Mm$3 30S`sV4Ѝ0 0C0{ 0XPS !$پ0S 20Sm  4 㠒;$;px *⽾0( P崾D20S 00嬾  娾20S  堾0 : SK0( r" 08"$4卾10S10S61!0 0H 10Sx10S : S0: S y`x41萟 0IR 1 B?- 0 Q'Q ㌐p| , *=LN\,4|00S 'Ȝ'''s'PQ''''''''''̜'1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ l0P 0 J`0SpQPPU% Ѝ  B 10`    0S[  L0  $R,   V ꐜ'''''x%%'410G-S$0@010S 10S,0000 0 0PI0`VGc95pP儠UG t0 0C0 W kp0S$,  `YpP [`ꐜ'''''x%0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG 40 0C0 W ,+p0 00 S "p0S$,  Mp` ꐜ''''x%@- M @ p ЍT P 0@  QQ  00#T OP S  hx&0p@-0PS``:,@P -P PAӤ@P4 /P屼p'ѲβC-CM@, ` 1 1PȐ`T *F 0ypPPCߍw ? P@0w0S ?@0P?oP@\}&@-1  x& 000/'@-10 *x&@- MዶP<1$ /%mqQõ00CS0 0 /G-\D`HMp "0008T8$8t0000 00 $0S0 V"4`0p Q 30Sa3PZ[PZ?/0#/000 0K|#βP+/0`#q/V 00D30p Q   #屲P0 0 /0"R/V0020"嚲P.0"=/2000HЍp(0: S P. S+@ P00S`0:0 03V-V)V q 1X  ?F( 3 0~\P F ;0L S0 00 0w$qp.0S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U ' XPV P 0%@''%%tI(`'I%c~%m8@''%}D00S/@-4@~M0S~, αP~܍@'%0@-p@$0l00S Ѝ00 0#0Q ., `.P%@'L0@- R8-P 0 0 -@'\J('3A-pP@` ၱP@DTP`VA-pP@` PP@DTP`Vp@-P@T0` QV@P 0 Q @;;S pF@P00T@ -(0( -( -%@''qs@-R@T` V0a@$00 ?00S 0CS3P3y-0 S9i-00@ЍpPڀ;;S" 00 03#0Q P?GP00@00" Q-0S @@K-0ES TT 0$0@-0S;-0S 7-0S 3-0S $0STڄ00Q Q`-T( H --(00 Z-$%@'ݷJ(5k`1 RS@-PQM R @!  BR0,ЍQ   RR  RQ     P000S, @ 00pT0pS 0L"Qo 0=&p T0~"Q/@'%%m̸G-P`0 P ,p@P"ڰAQ"\"Q 0P P 0K"Qv,@ ,ЍP P%@'0@-|A`MPh1P0S2 S VPLDE,00ЍV0App0 "0Q>, , P0S(0S 0!Q#(, ) Pڐ0V 0?% l0 ` 0*P , 0< Q,00%@'`'mO-M4M S0`RX0E@FP0 0S 0 Ģ00rS '0S    G⹵000 S%0  ᬵ0" #⦵T~4"#> D᩶܍4ЍT 2 R - ፵1[ 0`#↵#U%# 0S1夁0 %p 0  l 0 #fT>4!D #>,1$a0, 000p0 01尐(0C0J  D,00( ,0$ $$ 0 1 000 p #&#$# 㯮T%x&@'J(-'\J(''q'%C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S 1  0S pP (0: S0 0 p10S10S Pヮ哮P  0 0 0S q4BV 1 00 0S000p000 S(00(000 P@0S '000S x0%P 0+0t0"$P 0X况%'@',J(J((J(4J(\J(ֺ`'%J(J( ''C-M M\ Po*H#*G Pc*#*SC$0`SH 0`E0S2*p%Pu {%Pp 0 m S( 1**2r0t0CS G)|)p)5)])\)PLS%P0000$2) 2 `ލ Ѝ)&0S  R  sS SS YSP )yS)Dq儁)3)P)P@%P00000S()( )0S0 $P x#0P)@PP a P0000)P0Wi)0@@z=0 C᩟z% @8Jލ Ѝ  r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00H\J(hJ(xJ(lpJ(tJ(%%/O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 @0 X2@ @?Q*@0 0嘠P sP` hЍXX   ` `@( K(J(K(K(Rs@-Ѝp@ 0@`P?Qj08  ڝP\0 @0I((0@-@MPP00800S =J"Ѝ00J(G-`QM MJP㠔@ Y #p ÝP 0p 0PP=! SR J( ݍ Ѝ&PJ 8 O= $HL0Q\ J(L0 00QJ8 PTWl~A-QP v000p@T+`00CS0pT0 0S0T@ 0S@ 0 ddP 0S@ @T@ S P 4I(X%x& @I(0 0 S00@-@R00000S0@000S `ߋP Llp 40PJ(J(4I(J( 0J(p@-PP 0S|Np `ᶋ@P`  @P0/S000000f PR @@@p 4I(h0 RX R  H R/< R/ $R/Q/ [4I(J(J(J(`0@-0S L0@0T R S$ 0@0J(4I(4ax&G--b@ 0(MS 0SzB((Ѝ0 0p5"0C S60 |20S 0X0 00!P 0 ! " PPp  0!$$! 0!㓭 X (4 : S=  S7  S$  S03 0`!  0J 4!010P7 S  S/  S04=! 0400S -ЁЂ ;Ѓ"040+04 PK0h 00  0 0 Y 4I(0J(e \J(p@-8M@  ᪝D 0`P`U`$ $ @ 0P8ЍpC-x1lM0@S XlЍC `Z(凌="(<p@WpP00 0000p084 բ40CSH$0r"60"$Ǣ 0( ¢4 CR+p Ṣ lЍB>'"ⰢS+0  d,J(-3;@-@XM="r:((0 cXЍC7@-@Ppp P Q Ѝ0 0 B Ѝ0@B0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq*-0C\^* 0 \ 00W0!00N0 00N ^*N^*/ P@-*0S@L0 ? SR@C:@  ^:R \000Cs R00 S00 Cr@ T \A Cr@T2  0a0Cs R"  -0C\0S* ^ 02W"!0C0 0C S*CS*80P @-  //J(LA-@((PQ U?-QQpW :WP`0 M?`S AA舒0:S@0 R  0 `P-XI(q&x&/bs@- `> 0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&!PP@P0PA- 0S6`Pp 00P  T @R p00T0p0S ,@P0=0PPY`I(s@-@`P0l C300PЍp@00S S@@PP 0 @D 00`I(@-  @ox&0 Rr @-/%@-<@<@0b@ @@Qx&G-p p.@d \P+p`@0, Z/00 `O-lM/_Po\\@P= `P0p`ᐟ/00? PGP@  l?l/@p\?X?A0sR  S  R4?4/0, CR 0K?zP< N>P ,`>@>0 -R.Q0 000t> l>l. d>`>\>>0SHp/ 4>  ,> > 0S  > 0.0.0-0==P}===|=-=   H-  g= 0@T pDPP\`y,  0!-1 @ L< -=@=<P? <;<,<,<,t<,h<,\<,||_ Y P:4Co S Q  S  FP  ! C 0C0 0A0 B!"00@&A-Q@pW :0 01 5  d| (lu <tp @ |qp}  `=/ 0$  4 =C@2Q! 1Q) ($5Q/^)040)($84K ARKQ  $ q++  @ 04(4 :(40/S0004084(49)($ q++@k$J( K(C-Z4$#0C@EMS$0 30S`` EߍJ(]J(J(J(.0 0~P0<x P J8P0@ P J-1  =0 0 0P J<.@h1XPE tD1UPM t}00 0zPP J}zPߍ P$PP P dP 0$P Px s 00bR cyPJ(P08[ s@IRx|I(p@-PMM@ d R=\\  0P UM>@ ; 00$0$0<0 0 0ݍЍp$ J(p@-@5 PP hp@C@-0p-S0S( Pm@P#^8w 0M0` S0 \BPPP00T Ѝ@`᯺x&-@-0@P   _Ѝ@Ѝ/K(p@-@ATp@0 R PLP ` `WP`pK(-P@- 00|0 x0x 0 0 h@0S XL00L0L < ,$ L Ѝ@ Ѝ/LJ(J(,J((J(x&\J(p@-xv@Pl_hPP XXP p=z000S   pK(J( -P7@- 000@ 0 0 0 P0S xL00l0l h半 XɟTkvD 8偊0 L Ѝ0@Ѝ/LJ(J(,J((J(hx&\J(x&@-X klx&0@-MM2@P@Mߍ00/SFPtFP Qp TLp  0RP 0RP ,049 000/ K(@- ()Px&C-q`@$MT pphAPD00CS0>ڹ@ Pp< @Y@DOoB0S@$Ѝ0P: S ㈃P 0S s pW iK0圀 SH@  0A@ GT҉0 @00CS0,呹0 K(zx&xx&O-PQAMS 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 L(L(L(K(0@- K(^0s@-0P`0W0`0@S P 0R@P@/  AP@'0S00S 0ST P000 R  ЍpK(X(%~@-|AL ^ XP sr^( \qm1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP !NO-p`p됰P0@%S{0V0&S T6o! k0 00 @ P@P@K(@-0@!4Mp RT` 0 P@4Ѝ0@P S?WP@V P @0 FAP@$ P@) UK(p@-@P0)SpK(O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP  ! ,Ѝ'0DSYA `@V@@P'0ISV'Y00`0` H ⿃ 3U! z! 0  @@P! 0  @PVb'T@@`@P, @ ⋃  K(O-p`M8P젟찟v!@ r0 X@ 0DS'00^* PU @ 0 e 0DS00Y Ѝ` pUU K(^C-锐p`  0BS0p0@SP(! $0 00P@@@P@ ЍK(G-`dP0@S! p0 00PP@K(@-@MP1`PLF0P  IR NRpp 7PpEp@@0PS@ $1ЍK(=PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0@P 0,P@1Y%%S(X(Z@P/- 0/SSS00L(0@-@PMMMߍ00/S \e}p `}p  0RP 0RP`p@-`\0@;P 0D0p@00A0"SP Vp:ozL(bp@-T` RpH0@Q 8 PP Y0pp@L(4%vG-pWR 0S)P lB000000000CS020S @T  |SS pOS\.U$0k424b0000@/Sp=FpPJ0S0/p0CS0pppW001000pA0P00 hl00/ lS ` S00CS0<10S 00CS00W00 pR0S/S0@D000@P  R*0000t/S0S P 0/0CS0 pG0S 00CS0000@0@0@L(0L(,L(zv%S(%`A-`p0@00{P 00CS000S W0P0CS0d00S H%@ HW 406 R0S 0KO0L(,L(%L(G-2M6r0@TS@P 0.S00.S000/SS?X20PpTePZ( ,`V >PP `  /` E0Ejw&k@0-S0Sp1@T@d=SP/{Pw 0S O.pP  `P cm 0: S W 7.pPXP pW e0S a.pPЍ%$U(L(@-$0Q @ Q @L(vp@-L@60P000S LTPP 0Ses@@M 101)N00CS00 M 0 M0pl<=$U(@L(T%uG-@P@\R` V101 <P (P  `I\TQp @p0T \0DsQjSh0 @0 p0BP!0 BS@p@00CS00 `M 0@0 @T0S 00CS00 IM 0 0SZ00CS00 4M 0 M 1 0h1@ @ @ @ @ @pp\@@%A-@ ` PR 0R 0S SLp0S0 R aM0S  ZMU  DMTOMk xIM Td@00CS00 L 0 AL%L(pL(%% 0@-P]$ 0宐L(@-@(0Q ML(@-x0@T   @@@@ @Rx@00S 4060S UЍL(S(%-$0@- R    xL(-@-   0p@-xL(-@-0@0 H@-P@` =@-@-   3@-@--@-00t " ЍЍ/p@-P@h p@-@-   ЍЍ/ 0H P @-4 4L,P / 4L(0/@L(p@-@xPPPP wp` w`P wp` w`p7@-P30@T p06 N 1d0@T PMP0 0@ 0N@B Ѝ0$U(`%@L(pY(B @-p`P@U'E<0P%{Fkk&Zg{[`[x }06S 00S T Ѝ~ @0t0S0T.S N@@L(af 0    /@L(s@-@ P`TЍp0P0CS0  000 P 0 4@ 00 a;0@-PM @T @@ 0ip +P   P@@ 0ip 80 @ 0 0Ѝ0@ h @@L(\%`8%@-@P 0S0S k4P 00 0 ЍpY(G-`0S q0P00#@dT0SP&@D1$@00CS0$10S 0Ѝ00S p Uvi;  R )P00CS00S UA0SvAUvPv@ #0L(,L(@L(pG-0@P`^PM UG+릐 s)2Q0 U2$PP20S #I0S 2$PPPU I ^0S|2 0S@++T ^0S<"$0 0 @+^0S2 R$0S0S |F@ P0S nF0S fF^0Sd1 R$ R @T$@0S QF 0S IF 0S AF 0S 9F  0$ V $0?o2$0Mx0$ R  0S F 88J4I Ѝ%U(D@L(W(%O-@MPpu*0 `㠀堠堰?P@ *Vx0$`W T ^0S W P  0`SY*ЍX(%%@L(P8PG-P* `0@00 0R0Cp0W S `S0p 00 P**S p0@)PD0(00$* 0$ 0$/%%S(@L(A-Pp`@000^0S 0S S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R Ss 0$`S S@L(%G-P䑟 M^`AV $`)pWT0尡p0p00WZ 0S- |1|aj3%Il#I !I00CS00 H 0= J00CS00 H 0 H  BL^ $`R 0S S00CS0 p A 0S pS00CS0 0$`0C0 w) Ѝ%@L(X(HY(%C-@$M p䀟3) 0 0`@T+ 0S0 PU@ 000P 0t 0 SP0 0U$0 @ R^PU $05)$ЍP0X(@L(%G-P,Eo@p0媢S' 0S$ 1a12lHjHY.eHUaH00CS00 G 0 G|aU000 &PD U 0S @T H1P B@G8G1*G0S  1$ Iߍ0A 0 000 0@P00CS0 0@ 0 00x0 B>00CS0 0S mGlkGD0FX00S i@00S c$L(%HY(%X((L(@L(0L(,L(0 @-`o$M 0 00^0SP4P @'000p\s p%P 00S )r>9r0 p000CS0(00S  '$Ѝ%0L(,L(C-@?mM000@H0?_00?0,@0P@ `'@P0o0`p00dp@Td0hP@0po 0lP@T 00/P0l $00`0S$&`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0C7S 'x0R8 P>0S900SD 4.0000,0(00 0p(0&p  =&0S(7S%00S 0 0S= 8  x=, rp@ P 0 t= K8 `= <=, R , W,( $P000==0S @U0 0P@IK/P  @J$ 0 $ R 0T@ =lA70s0S^AP0 Q AqQ9 R 0 00 Q0 -PP -P R 0S0(0(00(00S  8 @  (00(00@0 800408<000L圈P7 7H 00R{0( 0>$0SP007GQhH 0'000 000 7 0'0'00$(0x7  10103/$0 7 ED7D' 7<' DL0S $J8 6 6 @ R[ 4 0  V $C&@00CS0 Zcl60S .P 60S&,0qS5d6$6T h0 J5,,0( 30000+,0( "0xE$0(0S,$ h5 p50S X45,0S potE; %0(50S F0 @0 V@P@ETv=0 0<0$0 0C0 000D0004 8\XO00CS0P40S ⨇P( p40S)T0SXOjI8 3 3 3 \ $4 03匇)ğ00:3 0 0S '|0R0#C,#0 0 3 Ch+J00S0prN0"0C0000MOI8 2  2  2 \ 2 @)Ÿ00 0t2 T0ST"00CS0 (2 R   02D0S&$mߍE:10S {0D!SS}1 08 L0H@IIs10@0@0S h1 @0S1 L1$ @0S  01@0s`1 R#0SH1   B  @0S @0S7S@<+ 0 00S *9p@,0S0  \<,0Sh@ D<0,0 0H 0E@TpY( X(@L(Y(X(%U(0L(Y($L(,L(HY(%(D%$U(0U(H-q&%%%(L(xL(! U( L( B 3(0Sp0 t0qn,0 0v,s)DPDFG0/@L(0 /@L(0 /LL(0/LL( 0  /@L(P@-@'P@<0 QP cR   5@L(0 S0/@L(0@-0M0/0@0P \oP 0: Sl  S` PЍ0GoP0 : S" PPpY(GUhp@-Px@x`M$P)00S "0`00``00!`"$Ѝp@L($U(@-h@P$0&0 RP   BQ   @L(//C-LM)88 p@<(P@0` D40 `G 0ALЍ`%A-@P`wmpWU VL'! 00|'p,U(pL(O-pWA R``%` P0S:S STE@ @0S(W@  @0T/S/00]0p0 R00P R:R:RPPP*@DO!@"%%tL(@-@MP/p P㨐K  0 N@ T9Anp0 @~0!0P 0pWZ0S 0 bT+0S '0S #0 Snp @! h`P T T T0 @@T >0DStL(A- 1@PM`Rk0 1000  ;pa!XZU pA@ Q X@T@Q@A 08AS 00CS00 ~@ 0* 00CS00 n@ 0 ЍQ @@U P000mK 00CS0T00S D@@80pY(%0L(,L(p@-P@@Pp 0S%SpP @pp@-P8@Pp 0RPp@<- @0@ R0S P P\ 0d%|L(G-`P@唀0吐00|Up00CS0h00SGC0S0 S 0S00\PPp0L(|L(d%,L(A-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @V$P`0W:SP0R@pY('d%&A-`P倀000|Vp00CS0T00SA0Sp00pK`\@T`0L(|L(,L(0A-pPS R+`a@T"W p000E0 @0 0 [00CS0H00S `P `@tL(0L(,L(p@-P$@Pp0P0@<@-L@000@00 [00CS000S@`0L(tL(,L(O-PM/`@ 0}P @@@k ($lP00š0 %0S !0S 000V#   P@ J.P @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @u 0|>00Ѝ H" R," R8pP B0000S R  pbQ  0X/R0XZp #P pP t"P} R y R u(ikP0 * R; R 60@@DW P R  P@0000S R    BR 9D R5 P3 PpY(.d%tL(%Q0L(&7%<,L(O-`Pp$M `x%@Pp2, 0S*[ 0 00P@0  p0Rp`#0`2|P& ZQ=01 >@$Ѝb@DT@ P  p R   U 01W VYXU' [1 00al 0aS v00@0S v P >W 00SY0 0 S0 P 0< S0 XY$U(|L(%cpY(d%p@-`P0000S S@I000 00 00000CS0p00Spp@i0L(,L(0@-x@M0 0000\0P>00H 00CS0$00S Ѝ0@HЍ00L(%,L(@-yP 0SHO-`pP@Md$P0cS @@ <FpPp vPP VP@ 9 RNcS @ :-0S2UA ̲P0[PF UB< P9 <@=T( 00S$ dB00CS00 u< 0 U< 0RPU E<0@ T  Ѝ<@W P` 1000  `@`P1V>0 /PW1  [ZUr<hPUf<U~K%[~<U Ut Uh UXK<$U(x*%:pY(@EKavO- M$B$Rp0@T0`V% VV:V  V /V   BR <` F R   Ѝx! R  \a[  0000S(Q@@PgOP@ @T ~p [ /R0/S0{OW 0 BR r R  BR    BR    %L(S(% A-(A0S 0PS0 0aqP0S00 P000X00CS00S P 0SRh`hp0P RP000W000CS00S ]L(0L(,L(M(s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `L@ 0S00S=STL00 <0 R0AD1U0 S 0S% U(,U(A-hp@R0@S`P  R R00PH @L(O-r@ᘲ0MR00$`00 004B0嘀C x4m0SX00`@ 000CS0D0S00CS010S H f`P)0V00)P3fP +W P #X10S 0DC}0@0CS0 10S ~ЍZ0S`F`H`Z' Z$ 0S@ @Q0 /PH  p @Pp P0C0~00@00C00C0L(%0L(S(,L(@L( 2O-0pS`Tp0 Ѝ@1Ա 100   Z :[X0S 4@ xqQQP  PQ XI&PD $! DoQP @800 @P  QE Q@PQ@  T* R RPP P Y <P@P@ PL(Y(M(%A-XPX@X`P0p003V0p0CS00S L(0L(,L(p@-P+@U0@ pL(@-QpP0` 0S*00E@P`PP `R@ Ѝ `0P@@0`SP0S0O-0R0@ l@ h  X)Ѐ 00Cs 00`Fj&tQ(p%5rO@- 0 S  .^\Q   p@ S0C $00P0R0S pO-PPp10 0%SX P 0@S!!Q@ C$0S 0S  R-S %S +S @D1@YZT$W@71 r9 002#00S 0S 0Ѐ?S  P T"@` G Pp P J \0@00SJ R Q !" R @p%tQ(G- a q0S Qq0l0@S @ (А0Sʬ00CS00 5( 0 )0 R  0 S0!(tQ($U(5rO:%A-pP`P00Stp10P 0S TjPp pPP gP`W@ P1 1@](`V Q U` 00S`AJ 0 A(P00CS0 '0S 0 0 00S0 S 0 0BF$U(ntQ(5rO%800S /@-P `tQ(8 P  /Q 0SZ//tQ(`060S/P00S/D0Q<0  40 A!0 S00'%S(%tQ(5rOG-Q`0SS@00SjZqP000M:@ 0@C  @ R0000CS0L10S 4q000$100S010000<>00V00CS000S n0S @pWZ00萠g@ ;0 ZCꙂ! P00 R @tQ(0L(,L(%A-`!@S1p@!P I8%Tp1@WV2 `1N0SN U 0S0P"TP=SV 1ApE 28#5#060S$ .#+#(#V+%(%U 0S SPPR\dRP L WT 0 VS($L(Q(tQ(%p%08 N R S  0S  P ð%O-`R0pMxB0 pP P Ѝ0S0S "0@0000 0#P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р 嚲"S :^ 0R Q0  r; R-z!   B/oZ" R" \    P 0 00CS000S .\  @Vz   B/oZ"  "0W(0L(tQ(S(%%,L( G-pPK@P EP1N0St `@@RT @R@pD `㜠@0S0S 0S0S/`@Y 0 X 000 9%p%jtQ(A-@_ PPT0P 0S klP@ pP@ ZP@kt06 R0S@@PX` p9 0 P m$U(%%O-`s$M PPY30oV &P *P xxnU pUV \p`H3 R ZP$Ѝ3P\ ZpP&0?oQ20S P VP  Q6ZP@@=Y pW  pP 02 QY QvVP  3(160SI\  \@ /o"/ S [ (\@ Q 0p0I#Pv@T R *  W R #0PS  R 0 S0C 0 ]V 0 R00YXcX `Z^ R[00V4U($U(tQ(%p@-P=P@\a000 R 0S 81?p ;C!z0S 0 00E1  S j00P0  Dt@ RQ Dt@@@Q00R00S 0S~00CS0000S p0L(p%tQ(5rO,L(<1p@-Q00@S#$P`0SP00CS00 # 0 $0>p B.!#PlP000V0@0CS0800S ptQ(%p%0L(,L(@-Y @ 00$U(@-@ N @p@-`@0 0 p 0Qp\ PU#00ptQ( 0G- br0AUqAЍ CR  )0!PU0 R 0S\S 0S0S S S=S) " C< 'S:  0!0 S0B 0.Q"0,0  }00 S$0,"0^ 0  :0 1 }SQ0 0 \0$0L "0D  U 0"  @PEtQ({$)!x%+1A-@`s布MTL 0SIPU0  S0S p#"TR 0 BRSD@0#":P=;@`3@P)'@PUV0S 0S |Pp `ЍP@DP$ 0S P wPlPcP`Q f `Q0 E`PV8 ? :0 S`A >v P6 P3 P0 P- P* P'xustQ(9LNPUZa]d)fjqx|>ADFI;p@-@PTpU0RU 0S H@Np@-Px`x0PP6 R@N0S@2@@0S. @D0    p 0 ptQ(%A-0P@`Tp R@ 0N@T P 0S@@MW\0HU 000000V0@ S(%p%A-P`pᮭp P@ 0 A=@}0 G-PP- 0M00S _ow1q R100 0000 S a@PЍ0SF  0 Q S/R cCM P" Q 000S+  RA ``0S:SV@"00S"@>= @00CS00  0 ( p0ST0 @00 Q(X(Q(X(tL(%S(%%C-@M$Tpp``P A0S 60SP 0N# 0^0w P1U00S^0SP60S .0S } PP PЍP ^Y8 0 P0C?o20W(%%%%Q(0S/p@-P000K@Pk00CS000S ITpP@T` `@V0`0T0@0v0S V00T00p@0L(,L(%p@-l@0P00KP 000CS0 Sp@000S 0L(j,L(p@-P@_PU\$p@-5:Px@-;P xp@-P@;pA-@P0PS`~Up~0000 p 000CS0h00S 0p000000C000CS000S %0L(,L(P @-(J 00C00/%00  0 00   /%S(p@-@tPt`0000S0 000D0 00CS0p,00Spp@f00;0L(%S(,L(@-D@ 00040 00CS000S@J0L(S(,L(G-q0A000@0V 0Y0SPkPP) 00?0 000E000PS V 00CS0l00SG E  P0)` 0`000L(S(%,L(T 000@0A00CS0/00S/0L(%,L(p@-$@P0 0C0C0p%S(A-`0P0p@0@D00CS0%S(( A00C 00 0C0/%S(-A-@P(MHp@`DpPVP u ;T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@y:0 P p O-D4\Pp; P 00008  P8 ( -p@&l%%vA-$R0@T @ : R 0 @ q8 0 00CS0!0`)V#V V v vZ A b`p! 0F S0 V@0000 @\V. |V ;V&P @0 ;P @0 @0 Pp&P@0 @0w|P@0 @0@0@0p P  00P000S 0 %l%(M(,M( tG-pj0@0 T T+P,0S)㰀" PP @& snG@`P  0RP `FFa@@T 0 %xp@-`0$P P l 0R$, (@R   RPDPw    Q  00000S@p 0 BRp@ b080@ p%@-y0 000%@-@oP"p@- @fP P @0 000p` P #@`@`% O-鸑`P0 b P@BPp0 CR00 S 0@@0XX U @P@W W. V. 0@PpGW PV oVP 000 0V wT001Sy 000h001S@ %G-PJM05@0 0 05 P00k400D$0 W`P c 0S / # 40  4 V$0000 `SYT4 ` ,84$ 4$00CS0! 0S$@PUY3 0RPPS p.0SP Px +30S x3|@|3|0pT00 0S  0 `PPB P6 \P p(300p" PP0000 0 0 20 B#200#"U0S"P R \00\0@0 $P00CS0 P@0000 @("00CS0 0010DPt Qo@@k1000S c 10 A0 SFp!倁V@0  o0 0C08000/0 000CS010S)0@0 0 0 0 02 P B1 0R zz0u`@0PEPUZJߍ2L00CS0`bR \{00%$L(%0L(l%,L(%S( 0O-܏ܯM0ϟ  Q"/_@/0 0202280 `00|/20S@0S1@D" 2 pW `R00S  /00CS0.0R00S 0@0C0D0000Pl210SxPTP"PF 2P%p~@k<.U0@#S00 p6 p00@ S0p@ A0@S7p@a0@SaWp@ [\ P0000P,'P 0@Yp00@S gyp[g'P9`ppp= 0 0CS00C0~000p@S00@S0p@Iwp W00C0t00jA`0@?o? @2;R0Sp z\P3\Ppt ?Pp YW6;G S8 5:0 S ^@0 W0C *0?0'3?pp00s0 S0 0C0~00@00C0p$W!*00'60'3?00q Q~  B  ?pAp00s0 S0@0C0~0@0•3W5*00'90'6?00q Q~  B  A0'3?00q Q~A• ?p Bp 00s0 S0@0C0~0@000C0w300'<0'9?00q Q~  B  A0'6?00q Q~A•  B 0'3?00 r R~   B  W?p00'?0'Y/UP1>P0 |P!000P$@A 0Ѝ@PW0 ,  r0P) 0&P00 0<P_ >P &P 00p0pq0((0 @ -P 0(0  p #00@0F%l% %S(% ~(M(,M(Jay'Q(Q(8U(%   0{P B@ 80 } pL0 {[0D 00 B #PA}P@ 0000@ P5 }P' @ 0 {AQ'=0AQ@=0@Y0%[y :[4 #[5pt|0@ 0 p0K P{AQMY 0@ Qp 0Ap96Dr ᴥPp@<YA+ Q:p%pp02Q1S 0GS2@0  W z 10W2 ` !n!y@Q{q@p[p, Io}[Q 0#p0CS0p pS@'P023Qw0  00"0 `!6$0  0G-`Ȁ0@T@@0PU @ 0S 0 0  B/o"Z`0p 0S 0  0 0 0% @-0P0@-2aM0$ 0 10< 010@0[1|0000VPPI@1| 1Q @@00O dv 0S $Q. 4QG Q ,4  8000<  ,000 0 0 y0 0 0 S00aߍ0  p0 `0 `H0 D0 H00SOS,0: 0$L(%L(% %(L(] G-Up0 00 P0    x5P $00pN@,'tP 0 R 02`      0@0S 0 00> P0, RP 000@ 00 00 R, RݮP3 00300 0000    BR   0` P0  0  CR S 0 P P`  ``t 0 0008 @0C 0 `00_`0 Sl凮P X0 R   L000`0S0 R Ӻ000P 0 R000> 0  P 0@S P 000| E`@`#0P00`g P0.    00PU# T 0S "0@P0@00S0P0S0S 000@Ѝ$00pr%%%A-Q@`pQ` @ 0p P0 0W@ 0q R$@@`HR ( X% R"p0 `4 P ^/忢`P 0 08 00C0@04`Ѝ Q  0Sppp0 00 00 @p 0%l%: A-P@0 P. 000 `P spm@`h`@@P 0`0 U000 UPPe``0SU RP%%Lp@-@|PP 0 @iP P 00000Sp &pp%_ !P/0S/80 P/0S Q/0U(A-@Pp`00p` P@-` :6P0@ pT@^ PP ! P5 Ѝ C@PE5   6% 0P/U(RQA-pP`%5VU``P``V@ 5`0 R@5P PO)( 0卼40 %A-`P@xpT@Q00C0U U %@P0 P4U(p@-X@X`0P0000%00CS0p00Spp@"0L(U(,L(p@-`H0@TpV@PU P4PU(|0p@- PR QP@ 40 bP Ѱ`4' p%p@-@pP0 S00C T  Dd4P 0Sg4,03O@dA T @0@p@%gfffU(p@-`P0 Sڜ S  @4@P t0 R@U ?4p腰0S 0 S (4@w0S U(Q(%p@-P @0Pp @  0pU(@0@-@ P  R %@ 40U( 0 P/ R/U(C-(P0 U0M0000p#0C@S0 ` 3@P @2@$̻  bV 3 32 R@Ud2T /o"Rm 3h`0"03@P2V0S' `3p@! 5pP3P 1 ݯ养 0: S3ϯ00``!l`P!` `V'oPP & 0 V U0S00! 0 "1P @埯y& 0N300CS000S Ѝ@rT  0P}W& 8X0L(|xL(%% H ,L(Rp@-@`PP Vp 2& x嗺2pPV I2pV ?& 0P0 p]}pG-` PppW@䀟  OPA p0S T Y  <G8  t20@ ,V  H&T 0S @V@ P%,1?E49p@-P  @2p R  2p d0 Rp  y2p r2p l2pU(%Gp@-@PpD0 0RPPp03/Z2PpU(O-@$M0@000`p@A p2@ 尲娒V 0S"2 0S2" $Ѝ@0Sp2 R@00CS 0SP P =% 墹2PsWPP jT 20SX iPS1P0000 Sl\1 0R  1pP$0C S $  P 1PP 0S( 1PP0 RPU 10 500CS0p00S T0 00`Y0SU(Q(%%%Q(o0L(y%,L(O-P0@l#lcMhsP P00P#)p,`U4@D\T(Sh 0Ta000pW` ,@p00S0SXP0SV0SSp0sS vS ϸUPp0+S -S T 4 <Q, R: 周P  1  !PT 0 @0SA0MЍUF p p0      "TR '00$# cr   %5S 0p# 00p0Y0 M I 0H H-q&P-=Q(Q(<%(GA-PQT 00CSPDq12SK R@ 0r`0CS00 `0120<S R 0q0S 0CS>S RSxh R 00CS0N0 - p@-@~0TP R R R& 1S# 0 iPpR!Q QT " "D0600S0T0S 00S0iU(0L(,L(%@-@P @S"PIP@-@P JP0  6 W(Qp@-@ 00CS00 P `d 5?U UH?Up!P0P0CS00 `A-@|P|p0`00 T 0000CS0H00SA0S 00S  @0L(U(,L(L P0  /Q Q0 S//U(@-b@0pSM10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: Wp3 0S$ UEop' W`RUYI0@D>T000 0 Q00 .TPx0N R T  DR 60SЍQ Q2 1 @$ U(S(% U(PO-@`PPP pJP EP0@DpSppTPA T8P@DP:P5@<.P, (4   @P@sSa0S 000T $00CS030S @@T00PpӪTW00 T\W! @P@s 0E0`P 10STw@ T@@VPT @Pb1 R 00STV@ Tx@P@UT X@Q0S 00S 447@@TppYW `СȱPEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 @`1 R T` F00CS0400S   %U(0L(,L((1%6G-PPE o@0p` TUG0S 00S 0@0@000CS0 00S ϴ@U(U(0L(,L(p@-H@P02`S@20CSp+V02pU(40T0P?o20S 0S//U(C-p@`1010r!Q0@S10C1 ЍqXPU X2弾Pl믾P 0S ᲾU(dL(?0!!R/P/U(p@-8P\2Sp@\BpU(0-MM01`"R !R X"R   1 1d"1!d2S ,DPl1, ,DP L!0,00D@P$1, ~@T0d.`0P, U @T 0S 3P00CS0 ! -f00 0$0(00D>S ɨ00 G,-e,"!031U(dL($L(0L( 0@-`"dyU(p@-L@+'P0PPp0C/U00pp@-T@TP0 0P0 =0 0000CS0p00Spp@蝳0L(%,L(A-@R`P`p +0PPEUp WD^0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000U0 000CS0h00S =sDP`000B0 0C0W(0L(,L(p@-@P@0SH00Spp@00CS00  %0%0%@-@%PЍ'-@-   Ѝ Ѝ/-@- 0  ЍЍ/% -0@-l0M, @P(0 00SZ0c10 @0DЍ0@Ѝ/G-@'`ޗP$ 0S! l)0S00CS0?0 "  v00CS000 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' R%0Q%@-@0%@-0rS!Xx0p@-\P@-  Q%  0 `Q R @P@DR 000S=SA00@0p@p%%S(0@- 4@ 00C00 0 0z0ЍX(0P P PR00/0@-LP@^ ^  R0L00A-鸀(  R (p`@pW p0S 0QPU  0S 0S   3/P@P00$X(0Shp@-@țPUh 0Sp'SPVP@'aPP(p@J EFA-P0`Sp@    3/@PP@X 'W "p0@=S0U0 0 00CS00  0 00CS00 | 0 T %O-@00Sp 00P㼀✠`V  X 0 @PU* ЍY   [ QʁaP`0pX($X(@0 S =SR/=S/A-`P0S=SPERPU@'㍠\0\p!0qV@pT 0S PVpp@X($X(@-1`0@S @  PPT 0 ` X `^  `P Ѝ@S,8*<(@&GPD[`"U\`, 8`V0,0p@-@4'8 0,0@-@48 0,0& @-8 @ ( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8 @0<<@00,0@-$ -P ;P Ѝt@- P.Pnt @-P#Pot p@-0MP`0@-S00(00P0 0  P#P 0( RT  0 0 S40(A03/ЍpT%A-@`PpQP-U@QP00  PҐP0 -U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<PpTXp@-$@P0S m00PpZ(Q+  0 BR@- < M| 0- BSs^0@Q ^ 40 ? 0 C  / /Z(Z(p@-hP@`V Plp؎`HV4d,a\0Z(O-M`pAPU d CTP L <XP 8 6PW $ 0PU  P p T,0p vR S [ Z YXW0S@0S 0S T00?5S[ZYXP 5T <@†{ RS [ZY XW :S 0S0S Px T0pPS X WUP8:TU P bR@ 0*T 0S Tz[TuZTpY  TkX TfW Ta0Sl hT\@0ST PTW 0S< 8TR ( $Nv 0T 0QS TL[ TGZ TBY T=X 9R@ 0T 0AS |ppT9[` \T4ZL HT/Y84T*X$ T%W T :SxT0S pT0ShT aT  ZT SSpKTX`\DTWL H=TU P0U(2TUP T;S < SA SUS S  T:v`XS&[& Z+Y0X5W:U?P,s0SSUA ‭t~<ST[ TZ TY TX TW TUx tThh BPUbЍ0i0d," @T   Q ! 0P녡t0 ! P U P pGvg   !)*23=FMNUV]^ijs{z%&-.67>?@- &'x&@-000 SA 0Z( x&s@-@`000 #S@ P 0S  03L00S 0 #LЍp+!.!0S/#Sp@-@,P$p!0P 00pZ( @-PRP@ p`p 0R" Ѝɑ0"S0SO 00SS  00@O&@-TsPL0 p@0"SKЍ$" Z(4"@-TXPL0 p@0"SKЍS" Z(c"p@-d@P0S 0S 0SS 88@ U   SPp Z("p@-Px@Q dzKᆌP L0   P    pp@ @"% Z(0@-@PPM 0SLD00Ѝ000 0AP0 0 % 09/PV/` 0 Z(U%&"&E&@-寐0S S S8 4 Ѝ[S$ Ѝ&n'&e&''0/7@-lP$ R\J;@ H$0S p (J J Ѝ0 Z(q'`(''p@-@P 0Sp@0PS 0P0ݩ00Sp'@-/P@@ D`DHp0S?00 5 (x&C-P`PM 0S00(p/p0 FP" /Q0`@ p0@6P T0p ,PH$0@@ 00Ѝ %>!?>L?z??2?_(hx&(? - BR0 R p@-P@aN R! hrF 0A0 <庰X0 x崰X0 d宰X0 P娰 9( < , 0,a0 $8 4 <  $#$,$<$KP ]T }q0p 2Q0S*X`?\PQ PV@]p@vdBBBBC CCC+ChC>CSCDDO-pᔀ 2MSR R@`aJ 8QG ,[D 00   Z0@d"  8 ,   E`@0 "   0 !R!!' 0S 0Cs R`!S]0     0A20c8QK X Z<0P+8Q* 8 0A0~ @B2<0P+8Q *ЍO误0 0 020 020l `8 7 ЍO$Ѝ D)DdBDTB7DD3E@EFEDEEA-@T`Pp(v`8SAu 0`HE0/p/p@-0  R( R((,,004488<<DDPPT@TXPl XRl@PUl @ 0T0p  Q CQCQ}C8Z(@-@t40Pt08f/[WEV0H @-P \PY Q@WEV8Z(80@-0@S K08f/3[( 0\ P0//@-D0 <44匮0@ R  0Fx&'G%?GP7@-@ PT2~P0 08P8 0 p0 = Ѝ0GG (vdMG0@?o2P0S@- p`P ~@P ~P ~P }P@V@l}PH@T@T p0 4<@@ ЍTGYG[G]G`G (udMG0@-PM zdP@` p D< 0 4 00+ + Ѝ0 (zd@eGvGGs@-Q p <0  0  @0`D   _ 0    0   0   0    Ѝp (td@GGGGG( p@-@PM`P ?p  ( ԀV V d_ PЍp (ImH( $p ,0< 0J  (}d(@HH~d(HI0@-PM @ (mP 8 <4P 0p0 <Ѝ0I ({dЀMGA-`0@Pp!匁0M00x!p0SP@XBT p  8;eP qP p`(,0Q 0$0S* r@P ;QV W  V 0 p0( e_PR0c t00(0S0Ѝ00* *  `@H-q&>I (|dAIPIIdsG@-P$M 9@P op p|;JbJxd hJ}JJJx&JJ K&K;KMKTKhx&A-PM  @ZkP X RkP 87:  j0`0PS 0"S U1r0%*V  z0p0S wx00 "R00S p:PdPd `尀pp0 890 ЍWKKKKKKL (ydMG/LC-p`@P Q |9zPd@ R; -p 0903/ ЍCD%IL (]L 0@- 9 (MGP7@- \P@XzP H0zP400 p Ѝ0`L (wdP7@- :4P@, pp  Ѝ0 (d@gL@-%(0   2 3sMx&O-` ,M@PpP}0T 0$0X,Ѝ ]j 8pF9$ wP  )p $0 S T@0,0 0$0S xtC YV  ;  ]W 0  @D8NCNHNlNp@-@P0P& 0P+ 8>0P  80P 0P7P0@p@$p@ 0t@`p@TU@< PptcidyaraNrbmngntsxN~NNN0D S/ 3C5C$1 4! 8<0/((0@-0A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@(( 213/P/P(A-PT0p(,`Ny@Jy,0T@@DA?@?@@((?0@-0@0 (20,20w0P!P30((> 0R//G-`0(,Bp  Pew Ey@PPW ,20CS(20CS G 0((`PdPp@-@`42SM%^  E 82<"@ 0(2,"Ѝp@ <"82Ep`@h,"(20X"\mЍp@((%mPvPPPPPhQPs@-P`m}  G0SЍp00S@\}0"S1Ds@-$M/}@ w80́k $0 067`Px&A-`P 0p @TʬU7 /, s0d  ? rqp  RЍAL`0S`@D@,| Ѝ%TT((A-@0@ @`pPpd1ČL0\ D0d^\^ 0WTTU((Up@-4@P0S( {0B1p((O-PTM0x 00$03p  @8 到A ⌠e00,< (0,0S7 3,(23`B 0$4 0%v40 ?v 0v  0p v$0d"P 260<p "( ` RL` $R0 S 200#1-R0% TLL`P@Hq,0P00S $2 vrP! 2 orP 1  hrP' (宕0L00 SD au0g2(08 gkE%KU\1+B?C$<1\"00uP@1\"R@ x @XRx  X20P@x0 0X20UP@x0 0X20UP@`L` 0U$0000[ 00S  0(0$0 00 /P @TЍ P @7U((%FU(x&U&U-7@-@00CS0 h6P Pp pp50 P00CS08R60 Y@o Ѝ0@Ѝ/x&UUO-a0 p5Pp/B$@0eO 09qqp Ѝ  R ЍOt`0S 0 qqp `BPE,Hz 0S %U((p@-|@P2S 0h`n/(20z!1!1U &"U 80U p@@PC @y@Tp(((N(G-b@p,("PP 35 P UsW剔LI J$ 5a,yU0U 1U01 ;I0s@s \ X"pG' '"q!'|"",q!#34#sO8#@<#$(,0#$1!#(#wt02S 0S " `P D!SR ⌵0PTWWX((X0@-Xa0 0LAP d2S8 qP( !p! 2SP0U0 $pt" Rp\EU$p0 00P d2SP 7P@ Ѝ0P0!!1 %((mdKXP(VXX(xXO-MH`LPrQPʌߍO]QP Aʁ{0@0PT5 0H0 08P2,! 0 0@.I0# 4= 0?Dq84"RKX2PGT-X )02Q Q6L  42S !1?  !< $0 !1?  !< #0 1SQ" R@ʉߍ@ xQS.82SbV<# Ipp  000" 0p `1V0 002Rڐ"p p"h2R Ci0.I^w 0V0b1 RS  0Q1R 0.J? 6<2S0[ 0"P- x1R Ci0.J"?X02S2S0  Q20S*F0)S  b0)S  0#R00S ꠠ0 \0--C B  I 0S;'!P@0((XhX^X%^T^b`XXU_RWC-|M4RUP@P@lЍ(0PPB1P@P0a0aTS ЍC q  G 11 0 1(1!1<0;  1L1 ?0^z1!1<0o q 1l 1?0ЍCd((j`Tl``O--bP(CbbbbgbbbbbcA-@T2 @PqmP lmP gmP@ `p@T 00S p`V@RmPD00S @@Em@PDwGwJw(%A-Pp`@000 0@@@A-@pT` kkPP0@ @d@MwC-M M!|4((P@ ThT lP'PLD(l000,4P@(@P A0UL4 4[sH` PF4 4@P4S@@04@4T@0F0!p|ѻ`P;$P$ $0 1 <30 P<(00S#|0 `C60p0U9 sp@9 PB 4 R 4\ <(00PS<(0 0@܍ Ѝ0HSʈ)P0S -Sq@`a=aP00@@4yP4 R 4$A0!JP Hl@800  W0 R00S& *@10HQ4A<00C04!4 C$ *p0S0Sp0S 0S C  0S C C C  ,RPly4#pi P PSd   8)꠭(QwDwhw~ww%wwwww0/ᔮ(0/ᔮ(0/ᔮ(-@-   喽x&G-P`pp@0S  0S X| pU DTY0S i0S9p@ L딮({{{{-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!rp@P=0D@rOP0: S0RP00 0PP P81: S P% S  R  rPPl$PPPU rPP$0@Pꔮ(|!|0|(@|Z|x||@-%50P  0 00$Ѝ  |(|0@-4S 3/ 딮(@-o0 @( 0$o~o@|(@-xo@Voono@@-p PL`@@0 7/P0 S Ѝ V00,(O- MM0t6@  @  @ 0p$000 (08$P;$@ ⯻ ܍Ѝ 03/0P0.   P @$0PS e(0S W0SU S U hh000,0;-p` $0 p h40@0Y0C @4 `V*` _0  0 0!0d4  ` `  Y!mHE B 00 0 ,0iP,0 0S `iP pW `Vxp@P ZD Wp` Y00S5 #z @ 0 %00Q00R00S  000 x? 0 S   Z0% 000 0@@0 00R0C0r V B G SE SB `V` 0S 0S_)#@U 000  0 P<0T 0BX(O-M@L0Sp<`@DH S  uP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:؇0^X( A-@/pp0%B?[`0S _0ES PC dp@@0T?  C0X(0 PK %/X(O-` 1aMV( 0/ SP0 S@0P`,0@@D0$0 0<@D0& R# X0p1#r380#8 (00T[800 QP aߍ0P@<`,0@`D0$0 00 Cp`02# t (PW00q240pGHH04 SD00S    408 2400(000[800 QP (100  RR R0(10P PPL0sPPt!E0It1@tQUP0U*0" 00 0p  x1S TVP@ 0I 0000@x1`^PP 1t!R h6XPP 1c t10t1#40L0s]?000w10I@P30 s0Qs ,0RG U 0`$00`P?x51 SzR`^P0S 0S TrlLR P0S02S 0S0Sz 0T2SXTSt!,pQP PP00@ s @ t1P 6D{P PPPPPPL0Is0PP@x1;@9`1^P2PU- `t1VS RP@ ta``L0Is``@P !RP ScE7PP0 1>@`PPTE K/TabPP05P6 5P0h00h00U U0@IP0U*0RPd0x1ST0x!4P %4xQP0%8%\0 P0PEd0U03:T8Rr%P Pt!dx1Zb" :0 0t12P0P0$00`P*P(14 (40PI!2S0P0 S0 $ U 00 ` 0U00 000 (@ D00S8 0(00W800 QP40(R(0 PI ꥇX(eΈX(׈5 MPd^̉AmʊG- p@r W pPA\aPP 8Pp $ PwuK/u`D08QP0Q:" 0PS00  Q pxPh`P 80"8 R 00 05 !$wX(0TxɋM p@-@5%SQ%5 %SPQ %UUQQp  0 0Q0 Q 0X(A-lP`5p@ @ 0% Ņ@ŕ\X(O-POMpP b5S5圢@TEOߍt C\P@ ET PT 5d 50 ! S$5"R$%P0S4dQP  RR @`0d B2" 0V JQP d ed0P Eh0K/0h0 y_0 000310 00 000T0 CVV(%,5QP Dd d0PaQX(U[(u@-@ P 0 5X(0/ሸ(0/ሸ(0/ሸ(-@-   VBx&G-P`pC`@0S  0S X|} 0U TrY0S )0S_@ b 눸(͌Ҍ-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!rcp@P=0D@rOP0: S0RP00 0PP P81: S P% S  R  rPPlTPPPU rXPP$0@Pꈸ('(7Qo@-$0P  0 00N$Ѝ  Eꏍ(0@-4S 3/ v눸(@-J_0 @( 0$^>_@褍(@-8_@zF^^._@O-`M$MpP`&P"NX1 b: S/`0P  rR _00pPP W UP 0C P"VR V  V#ZPN P P W\1` 0`PIX1: S<V2"n/rPpUPV9 sPW002`` 0!$ $JPPt P5^0SU3]`P S R S/pP`-'pP ``!\1 S R Ui7Pk`x%|!0#]PaY $PppU`( FzPP XND% ܍$ЍJՍݍF F F@0/p/p@-P@? $( $(0XRX0X00\00`0ddhhllppttpp@-@ P G?D?A?DD;?@@5?HH/?LLPPTTXX\~`\`0p Qp` \P0@ S p@-0@"!Rc0p@-@P>>>>pA-0@PJ04S->C>->C?X>9>:>C>?n:>CF> 0? AC>>}C>G>mF>EnF>E~G>X J.X V  $$((,S>,>}S>G>mF>HHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqx>1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,B2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P"9<Q08u@5ppL0p 0SXsL V0 0S V r000 Sr:0 02P0 @S$00; ` 9: \08%@5  L0 0S^ \=P#H20SN <q0 0 0 0(@00$? 'g60 P 0 ;U 01S0 A 00(!( (h h(~ S  <= 0 }/P000 R0T 1A~ P{xPu8 1 t0 1( @( f Pch=@;h꘽(Կ((t(%h((O-M`@ ) P0G: 0 0@40P$? 0 52ܒ2Q{ p q Br /s+Q0< ,42匢# 0JR fLpQ 04  0R  @PЍ( 0<1 r0 4 Y: |10S<000D0`1 `0 0f<1 010S 10S 0F` `$1{100v10S pm1pi1000 ppOt((%(ؿ(%Կ(O-P`FM M X T@l: 0 l5 RC@\`"0pSh <50S00  000S Fލ Ѝp00 1000D0y4 H0T00X0404QpQ\t`  5P"0S, 4 L000 0 HP" #0000S o0  0 3Y(.P 3  .P0!0K 0 * @pp  0 0S )  P1 쒟!!-P Рᬒ L000U0 H t k 0_0X0l2  0Gj0  c000B\00S2jp0!0G 0Gh [ Y0# 00C 4 S 0040\pPAT!)-ol1p 0px9 0t90  k#000C0 0 S (q   0xs00 p ) .p+p00/000 0 !0xs  p000S sgh(Կ( (% Hʎ((I(iC-@PE`pXpaY x10S l10S 00 0Z P4 ЍC!`@DT< 1 RP0H  0A P P> HY0S"00S T  0S mn0S Gpp ЍC^T,P D0 ЍTp(h(|( (%gǏՏ(0/p@-LP@08100@ 00 .0@0 yRpt(00S/p/( 00S/( 00S/5(P000R0SO-p42@ RPMhD R0R0aď080S  C/ S ! R 0C00 0@ἰ? 0L\5p!`S 0 000 ?@U (  R8 R  0\0 P3 `0/0/0 0 {Ѝ  [ T R  P0i0 0<00b/ᠽ(t(l( TH`P0O-@`:1 R0* 0I됑吱0 pSxP P* 0 T C:\500 7P/<# P 1R 0 0/."<0 P 07`0 C c00P0S   0 -0xP 0k7 T0  0c7400,00S Ѝ蘽(((t(T(Կ(O-0#M PQ P* HPX 0k:0 `\5 00  ,7@/<#| @2R 0 0/."<0p @x 07`0 C c00d0@Lr CC cA30B$ 0Q,040(0PßP0 8+10S 1 PBU809 ̱P XEʼ0 8/,80<01t!0<S0<0<0Ѝ U: p P\EJ3EEG3`fC3U  <3 R T` R< ܰ(/? 0XTFV p P Q RF 0Y:P`0 FR Q((ސt(Tȿ((Կ(Ŀ((ܿ(G-1P 0p` W6   00@ 0S 0 0 80PS `P` 8UH0ZP000PS L`4LQ$,$ (,`(PP8t(((Կ(&@-@8P 080((G-Pܡ0S1p00 B?J PAP` 0@`8@Pp1 ?5X10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ&d0SBP 1@0  XPP00Ϡ^P0d000 AԿ(t((((((MP0p@- P?@5800P 0 !SRp((lp@-X`0SpL0LP0@1CA0SOM000pG((( 00 /(O-H0MSP` M 003/ ލ Ѝ40 pP裟00 X+0H00@0 t0 /  S 0V 050X0x3!0S& h30S3S k0  " 0  0励010Z0 02* 2R2 t R<ʨW;000 Q o ! ZH"$$++P(" 2 " Ry{! {   t R1* Q5 1000S1H  B/oQ" RK h!B0`  W+BLSD(P: 1P0S, P j 0 10S0Q 10S 03/ 000 0P  0p`V0Z t((Կ(Ŀ(P$ 0S 1000S 40S 0S  % 10S0ꊡ  0000 04 $0 S0 0  00 0!kp$000$0 #600S40S 04 PP @ p td3 0R00 0pRLtRPXd00H00XSS/ 0S D30S= \P !/P p2 A0 \00&&`2 0@S0:000S08P40d/<0Q5#fP8`

hd=\ `P 0H0Z0`0A>Pp`1PU 0\I85 @5D0LT 0 b32 RPlhԿ(((P((((((((t(l(h(И(ߘY(_ܿ(ȿ(( (X2((п( (ʙDQO-@5pş|M,0S%40A `HDLT T0AX  'B5 $00Pxd p 0@, R< T5@|Ѝ0/1b&\% R  P  0`P_Q0`  0oS /  !.0`?00 1> (@ P004ğ %1#\ Q  0  D ?0 B#3 0R< S< `3ē0S0x0@S 3d0, = 0 ll`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S  J0 S\000 T @T`VT0? @`1 0p20兑A0Y 1XS  0<! 0P0 w 4A000Y 0;* 0 0VT0Q@`@ T ^@@`R0@3T5P`1:@P`$ 0@0 00  P ~00VT 1PS P   0R`* A @ (t(T( +w 410S& 5AY#R0 š!ȡ0S  0R ؀P0 000p0P``0P00C0Z?#IP8a Կ(ܿ((ؿ(̛(Л(Sa5l(ixGh(|(˜ O-WM M'0ASy0 G GP h7 +YTG 9P 07 00@  6$$P 60S 60ԆF6 ,X <0p`06夶0qY0:6 R W8`PaVtPVzDWލ Ѝ!  R1Z 10SI0T!  0 S<1`0 ? t400 20!谟00S0H0S 0 04040c/0 $ 80QT $0 0$0404 L3 2   ^[0{ {<0 VPpAt( (TH(((U (((x((00S/0/(O-plMX >9x2xx00,0SlЍ0S @d0,P50 $$P_000P㸀@1 0 0D RpT04:J`1 ARpR\tR`Xd00X0\0@SH0 `V `%P $10S  0m@P1P 00S  0 0S  Q\ {{00尮 0R  000 T  L 0<6렑t((#x&(Կ(l(Ku(O-MԏM@PE0!n0 }80t0?0SX0S $5St0SVhPWX0S $Yk S Y R,d$?pW\ 0P%T਀X僀 H\H800!` 1B`01$dQd0ڠP0C00h01`l0R!B1d0d.0CW P0=SLq QT00H ($0S 0 |$5> *d>X>0S "0 0ꬭS0 $5B111`R B- 100 S L $~0S% , 0帐- 00$%BR0ө`S<B11@%L0 ѬPP  H PP 0S  <PԌ *堐'<<0S B0 02d0pA?P0;3A?`0 =<0T0.L0~7 ;0WHQ RX0>F@ @0h78 84<ϠQ bh{ S X(,0 Sa?^ @VPC l;0S @ A>+@B@  C P;"  @0尠 \ 0 000 :J*::0S 40 0؍ߍ0<00

! "$5S81(0W8,(2W42,2<0002SV0@ x S0!!~ 4x050 $ST0< T5$2!S\0P 5V=SL5s35 `!~ ?X00S-Z"!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0 3!΍0h0H0DlE ,#0AS0 000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX ুX姁0 8PPK,2!~00<0S. d00! ST0T00! !0P SX00ԀYdY1pU10 0 O10000$5S `0|63! 03080H ` H D /D VQ 42!.0$00` S`0?00S00\04 ^t( ((h(۟Կ((U t1YEܿ(((x&T(( (Ŀ(p(ߠ (8 п(՟-l(J(t(((((|(H($5S|2! `0h ppWS $%S0! !42 D0D ,x  x |0  ("|H Hp L3t !n r! T0(P3 L!T0 R H  2 00000 D0堿FP1  q1*110S 0 020S QL P 0< ST0T STTP hFHPt2 L O0< ST0T STTC_0" 020Sy0 S\0P S\P BFP 0P S\0 S\0T70`# 02 ppS $S00S0`" S\0?00 S\0?000p` 0Rpd 0W S`0?00 S`0?000p?!D0Y8 0 S\0D000S8*!H &H Xp?!D0Y8 0 S\0D000S8*!H H XA-P`@P000T:Ѝ4堾pp嚾X @ScfA-A0 5 P0#R%(r`! 10" q0SR 1x0a0  a*at1h10S |0 00SP03Q0S4 uN@ 5*< 5<000S W0 0p@mTPUA t0UC P`0 0S H P80 0S t(h( %((((բ0/(0/(0/(-@-   寀㛻x&G-P`p3@0S ߽ 0S X|ֽ ቱU ]T˽Y0S ソ0SR3@ 廽e(-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  6@-@M Mq` @,PxPݍ Ѝ\!r⼶p@P=0D@rOP0: S0RP00 0PP P81: S P% S  R  rPPlPPPU rPP$0@P(EGV(f@->0P  0 00⧼$Ѝ  垼꾣(ͣ0@-4S 3/ Ϸ(@-20 @( 0$,22@ӣ(@-2@222@0/P/00@-0@S ļ@ h( 1Q0@?o2P  R7 P0 P0S 0 0SS00 0000/ PP  P R ` -X XQ PPP0  000  /TTT8 (((((T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/п((T8 T 8 (p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0H3H3L3u/L3P3P3T3T3  h p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3 EEP  4K44K44h 4 5- 5d0Bd00000P5P5H5H5=CS>S>h p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//Կ(O-t4MP U `D``t``@qvH:4D40ŏ 0 P\dp LЍ ?U*0 Py P\IP0S 30S|30S ph3h#0S` \#ST{ P H0S <80bS s*0S @"\5S 2 2\5" 0C?o"20Rh [ŚT24 ᕁ(Ud z$2 ?):010S?, A!(Ÿ0#\ P  0B ? 0Sg0S 0Qh n0S |!\5St1\5P l10S(` XA" L!0 0@! 0 *E 0S b0 0 00 Q^J0Ph PE @X* 0R A&((((ȿ(cP(h(y((Ф(t(8 п(TԿ(p((l(6(( (̿(s O-8MM 0*08Pp垴P/| 80S 39P/i l0: S XH]PލЍ,8H0$hSO 0)00S 嵹00 7̈ 7 8   峦` 㮦8 㨦t8 㢦[V``Z`P`D7V< g*P 6Q ȲP ޗῲ7P0 0b76 R>0 0p 0<&0|&0P47p0p 60pw>p0 P0p 2S # **P **P *.mVXZ hY 4[ 0SV?관X V. 0-  W) <0\;P$V$ Q4C ?#(rPPe 2S|3%8 S20#"20$#20PB 2SAt000000' 0@a⺸`02P$V20A\2@02 (2C`) `Fb( 0| 'H  ?`0P,Tt#0`P\`Q=S/0P 5` ( 2RV0 SSc 5*< 5Jh3 \30S e0 0`20S 0=d3 0 S` V 10S0DS@ 0(y2= C ,0"00 00t 2oAp'06# r00S10Sʸ10S0=S0S PB܁q0008 ` 0L%000P%X30,B,da * D10S V0 0̿((¥(ԥ((( ((7\0((jϦElTTʨl(+Lة8֪Ȫ(h(FoҪ((q\)ؿ(ܿ(Կ(((((Ŀ(٫p(t(C((((((((((Ϭ(ȿ((=S$0S,  0`<<00P%X30*@0 00S [0 00S? 0 >0S a{&PDa 5*N> 0:#: 5h1q t10S 10 000S$b V1P0a0*1P 10S 0 00<cQ6dzP 0\b<0*l20 x20S g0 0r0S0L%r0L%r0H00q" T 000cH00STFP$c*43@30S 50X# 0 00L40q#  c400cL00S Pc*z330S  0# 0 0x4 R.0E q\ `PVR d0SPt4d*G440S b0$ 0 0$d0Q,%R0%45 S R! t0040SPTu*d5rp50S 20% 0 00u(0S xQ$ ]0S< x 0(%0Sv8Pv*6E$60S |0<& 0 08%<5HSR$ / H00850<SN_Pv*660S N0& 0 0v@%D5LSR$  L00@50DS%0P|w*770S 0' 0 0 7 70Sx,w0S0Sp0L5sl0Sd dh(000(80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!@H0 000L 00*5880S P0) 0 0h P^x P8YQڨ0QTڠ r 0 0S Pi*9]90S 0) 0 00S/ 2( E0S0QQ&d @0 0S sPpj*:+:0S b0* 0 0 D0S D0S EFD0S-(Q\KQK RP+00S  E~0 ppV aF!` . R  ` D0S72 D0Sb]<Q| D0S D0S D0SH  8%L < @%DX<0,5S0SO | ,x000p<0,5<0(5H000/85L0<%0/@5D%4*:<<0S U0, 0 0(=0S 4=0S(@M*P=w\=0S 70lmh  = PA P<= 0S= @PL Y p `(@TW.  @?00@1>0A@O@@X.Pd7  ?(,@>P* ^ P;0.00 0 S 1 >5> > ߜ>`ٜVP?``Y (? 00@DT@8 H4L0d Lc B b"30@`P Y) ?0S  r8 H4L0d @ B b"30860S  Wx6p00^d`PT6@ W86P, P0& 5000 60S 1S $P 5 5 @LQ U @ 0~pP @@  04 8 1`5P D50S HFDP 0 0  pp30  0 0 4 8 P Ĕ ,0S_bP`0 4?s0 S |0SctQPd0 4?s0S 8H 0Sf@Pg 04?s0W:PP/PQ ̓0Sd%Pe000 4000 Py hs0ScX Pd0 0 0iHB0S 00 0 0 00  B0S 0 0 000  0nB0S 0  0000 0  0DUB0S ppw0p#40  j0  0pq=B0S 0@00W0  0 `1 X1Q1Q,+ 0S |tA 5<00.\!00T!0P!0#00#p RV !0Bs00P ֱP0S0@PT0 `SV0Ŀ((t(k( (|(((( (ȿ(LBALҪh(;p֭xl((9((((Z00S q: S *C   S D00S @-4| * R  S//(l(x1p@-0`S d`L"@ T D10S810S(S 1p10ST00S Bp@<00CS0pP U 00CS0 PPYU NU ްYU0 P0  0 0 Sh(Į(Ŀ(p((x&hx&p@-PD0@0`S 㶰 0>Pp㙮h( O-01 (1$100 P 1 P 0P  PPPpp(Ԙ @ ΝPT`00 XT V p WP @@ 00p((t(H( ((O-@1$M`Hp /2#$`D  店P 0 <w  $(tP U , 0 AP$Ѝ? 00  ?  咗 P 0 0 0?QR0 0#Ϡ?|0  850P -(9>(lzO-M0P8 0`ĐpP/2#V J[ 0 Ѝ 0|x@[ ЍO软 ?  /P  ? 0@p((zC-P`U@ (1 U P0 PP0 0T2`p؀*0 L@D0T@S   8 H4Lđ0Ϭd @ B p b"31 ~0S   0P00`0@T Ѝ((t((Ŀ( 0S/A-@p dQ A0\ a2Pa00 SR P00@00 0` PЍt(t(Ŀ(ȿ(@-0P@T@TTd pL `l0p `̠V W @ 0 0 0P0@0@00 Ѝ(t(p@-`P@XMX  # `P @/XЍp 0@-Q0 H0@S +\00S P*?008S0P00뭮h( p@-<`10S/ L5as0倀S%p "0S     X0?00S   "0S  ?># $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍTYl(((0 \P/Q/ 0   Lq,PŒPŃ ,y TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> "S*D 3`30S ^0P 0U`dSTS嚗Ps唗PUU00Q A&P 0S ??@UusP`"hR0"00S8 lr003Pb0S* xM0S* 0R0E>0*X4 2p610S m0 00S<]P10S < 1TQ `1*X1` H10S @0 0H10S << (1P 0*0`00S 0t 000S d0P`F 0u> 0ۥGإܿ((Ŀ(ȿ((̿((h(t((Կ((( (H((ذ(( <%(bп( ({l(t(O-PPMLp8 R8B@0S 0(3 ?P00@TaVa` 0 SQɑY\ 2 \P 0 `2 0T ? w0  ,",2 0Ri Si r0S 3S 50? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*0`00S `* ` `Ѝ 0_S   $  B$ $ R$  B  t(((T (H(((U (((A-Pph0``ATR q@P<[0S @ 1p0A(ر<0 0 1S01/ 0S00/(`0 5 /H0P 3S P 3S P///t(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 耽(t((Q/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐpX|0` R P/! 0p P  C1p  1p @- 0` xR o/ 10#/C!000P/ @-A,0` |R  /  /C! C!/! !/ @-,A<0` |R  /  /C! C!/! !/ @-9ApIG-@$Q uql'`h$RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr PP d]P`T `gP P9  ,Ap "0S  ևߍ<0H(00,0 00004008004004 04$0D0(0P BW[  pU lp* `\嗁` 8  8g ,h  h h h 0,0h0 h `| ṣp 0`?`a8SPb 0  0**0P0O   0* Ĵd@edA۴zd@v +?RgA-@Mp`;@@ p@ݍ P@00@*T 0 2 "0 O-`M$MpP`bP"NX1 b: S/0P  rR L00pPP W 6UP 0C P"VR V  V_PN P P W\1` 0 `PIX1: S<V2"rPpUPV9 ᯡPW002`` 0!$֧ $↡PPt P50Sᑡ3]`P S R SkpP`-cpP ``!\1 S R UPk`x%|!0#PaY $Pp弢pU`( FⶢPP GXND% ܍$ЍAJ귵͵F F F@00S/p/(00S/0/(G-pP1P0@0ʟ 0 * X 3#15`05 à121 R0` Ppp0a0!R00S 7% 0%# 0! RXh000R T00!ǁ8P,0t(((ߵh((!( 00S/f(O-,Mp0`P@အ0V000,Ѝ00 ?U0$p$0 0000 P$0S ?c00 0 P0 T0SpP8Ppt(^Fh(~R/nG-P `$ 0p@V` 0@`` V`@&!D( `G-@P 4`S Y00000pquP0Y T0T! ##P @?Ѝ_uP :^FF^: p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@40P/ Q\/O-@Pp02#U 1A Q" `R ` J U c9# S!V Q V3  P! I` P0 c9# S V!Q V3  P 0  P$ ` U 0 ЍθJ 0A-1àQ`P x0xo Q0Sp@@ P$` pFQL @ @PQ0࠱@θ} p@-@P40S:a80Sh0h 1C0C800S   0偌00PP80Sp0 C[CP, z2 ,0S/`0@-0@  L$2,b0,0080S 0 0 [Cs0@R(z ,0@-S ,0, Cc@TP @@=꽹 O--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D50  0 00P审 U0#03?`[[U\㹉@D `0P$0H5Q @咡O0$0 D 0XR @"!L0<p(08p$0 0H(0 0 `,0`4  0 4 KB@$HP $0 P\40  (00 0LPP,05S00SUSP3S` $ 0 B@`UQQ 0 00`F<0408p@004`<`3 00HpL`<0@ RS80 0 ,H0PpT`k@P ,P`3Ql 0Q 0CQ < O@ $@$\Ѝp0,03(0?D00T P %HpL`VW  1`0, S24040S@p( D0 0 P  X Z (2( mBV (H ]`̈400 0Q 80080p0?(00T` 0RZ@p (0 0 P 80S$1$f/1C:0C800S   0ڊ` 0SP THpPL`P@ ˊT@Pl P0rT`@V ! ṊP` T@!00P0T0$0B(LBAW"D_ NBAWĺ P G-0,0S 0 BP@9`40S*ႊЍ00qW!  0^@P   i@Pp:F A-`0@c,0Sp0+ CtPpQ H0H CB@ 0$P@DT@;|a C-`0(Pc,0S0W CIp@Q |0| 'B@@PEU  0P !  0 P P Ѝ;q |s X0sC-Ђ0@ P@` 0 00 0ዟP 0^Ѝp(Ŀ(X0sC-Ђ0@ P@` 0 00 0pP 0Ѝp(ȿ(ջp@-0PQ @`0P Rp   T0`! M@P 84P3(((c:Z@-,@P,0S "A00(@-,P ,\  E Ѝ(p@-P@h0h 0 SX0d0R 3?p@006.4 Q#3SRppԿ((t(27@-0S S+,Ô2 R0 ELh `Q t)pmPCㄜaQ* Q( H<`P 4!,B 5*< 50d30a3210S ϶F0 00@ @7.Bp#x3 Ŝ & 0P xXPA 5*< 50d301$10S ᚶ0 0@ d3S+ CQ+aQ# 0AS"P 0@a3d3*R|0p00S m0 0@S Ѝ04l((t(ZƼ(((( @- oO-0p M"##0@` 0$0L4@ 0S $pP t0S@P8# 00" qp$4$]BtUhUaU bU lP5#i0E S0 0p$ @ P80 ( 0 @0S ,00(# `! P P0V &ЍVp FpqP` h pbP `P0V:P0V$ SP p0[0b$$0 ! P  @P 0 S 0 00$ 0S Z(0,  $ 8Kp  @0 S 0 00$ 0S Z(0,  $ 8'|ps  @0 O  p 0 Pc 0 ! P4Dq&T8hԽ7:G-p@P` 0P V  ^00 000G R00`000O-0 mM$0P@@`004080 0bW, AW- LW% G8*4(cW iW0 p X$夎ppH40S ,*mߍ8 4h0H4: S@ @0(008`,0000400P dP 0 0! Tp Cp 0Q= 0! $∡匱@P4 0V$0 0/S f<<Y:`ᮆ`"0 <U,P0<0$Q`P ㇕P< hy ᕕw <卆V<Hp n/B  n?< n/ \0Pp < !$g$0 @#0P!S 0`pSpVxp 0S `0S  R  R 0S( m0$H 8H P`pF0$pM 0$ pF =p>  T 0S ,( PQ S RPQv괾q&Ⱦzd@ .O_ǿݿO-P-@p`,M$P "pp($0S0$020S'$3pM P V 00C 0P0Ne 0M fP AP PP `pP$p,Ѝ`P 0`P , ?o  0y0 00 ` p 0Pqp Mp URp` pq&v\UG-@pPT!׌p`:D10S:  p o09 6X $$ 2Ap+ P%W00S $$ "1p YPPU `fV rV GT!P$$  p$q&4Qm @- oA-@P`pP 4 \ XT  @@ 0RU  A  A]x& ,P/00#s01 0"$#O-P@U \  p耟蠟 U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G- 0 @,a,q@P^ \ ^0᳀ 0S@ 0S@ 0S0@@0\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PG-(`$p@ἁPP 0㘤I$0 0!Q P PЍ ےP-@-0  Ѝ Ѝ/4A-0 `$P 啁R%p0@ 0QP Ѝ 叒P404 R0/C-M`@ _[P0Pp 0S 0SS 0S$$U7#P0BS0S $ l   TЍP؀$T0  V   P--@-00@嗅 0 Ѝ@ Ѝ/-@-P 4( 婌 㮘Ѝ Ѝ/O-MPp`3@PЍ JP uP 4S  0P+T0P$ Q$P 0S 4S $KX 4P S $ SGڔ!0  p`000 0 0  @ 0.P 000 00 0 0 P 2 T`喘&P%(0,p 0p$S4pS 0  p" |0 J0 `0p"P` 00P0S(LoO-$M@pPTsPP ? 2R 4S  0s$Ѝ0 mQ Q0   RSRQ"  "S 0^000 00 P 0PA4S 0S(  0=0 000 P0 m0P0 <00SS P   0 0`S4S 0$R V P0 RS 0  000/P` H0H 0000 0   H>pJU/KO-P$M`ppHL净@PLu@P0C$4d%t(, 0840; !pd` 0 S; `p 4044s p +pp ztבp@ H4* R9 : S$$4SB. Ǒp $4Sb(d,T0 B. ⴑp (d,T0 $$0 P0p % 0l>$tW|(d,T04$t0dT 0 (d,T  0p!4S   0  0p4 $  | J}p J\pk 0P PIp  0Pp P IP' 0" RpP5:$Ѝ0 S0jp 000$0. 0S*+5i/`哏 "{d@ d@"8N" @-@P 4B BRP p 84  Ѝ@uЍd@7V@-@Pp P Ph4PS 4 A- PpP0T@ `z0X0 t4 Ep( ?p$$@-"6$ QEAS 0Ŷ r0"(Ѹ0 / 0T 02 /$4 0T1 / $4 0T1 /G-`P@Pp 1 PYP` A0 `A00 00 PU:Ѝ 1 00L0@0`P1 00 PUa`x&C$$0A@-wP@- x`R@dЍpP P 4 R 0 P-O-Pp_o!R0`@tMR(0S00S "R0l U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 60[ 2P#  7/p ) 7/p 40 P m0 $8P  P P  P A-@pP`P 5/p 4 5/p 4 pC-(00pS4P Ѝ$d@ 0   0d` 00  0 `WP <O- 0 0pPh~@ጐT`  P `V H<  0 E~@P-pxp@-P@`0 @Tpx$O-P`,M p@FE0     R  0  0 pl PU0 (P pe0 SE |,Ѝx`O-PQ@04p 00` ЍP P0S*  E `P0       04 p p#p p04pp  g<Kj0s@-S`@ PT0 KRP: pЍp%   iQ000 BR00P0S P-s@-`V@P`l` S0 ?o2R0S 0S00 ЍpP-@- iR sR aR p` p@-P@^P (`tPp OpP-p@-@T 40`PPppP-iR@-- 0 aR bR LR( sR% tR@#P 09P0S`00ap`(a0 /!P-p@-@ M\P`P0 0͵0,q0S k 'Ѝp`:BG-Q@`M QP  ЍAP $~{pP h6B0 00 ` 0P !|PHuO-$M@`HP 0`$ЍPP 0 0 0 $0Y!<#P0*Q P0 0?Y S0SXP pY0 P pE04 PU 0pqp $ {P 000 00 pqP $|4 k$ o$\ $  0V,S( 0 `$4 80p{ $Ĕ{%!#,[PP { T P R*L0Sg 0p^ L004 0 000 0PL 4$$   $ 0$$?p6 2Ww00S 0@-@C^M E$:E$$0u 0V! PO!Ѝ0 @tq ! "`#XT 80 B @P8q&<Pcfx0$ 8O-`LMPp4 ]1D0J00 قp  0S& ! R"|!LЍLRR a0BSS0 D1 0S  0P 們@P   9 {@ xPట  { T 0 Đ0@  T @ 0  @ P@ pq&LeP-x&A-p`(P@yP0 p!`P @00 0$0@-@P$0S z@zO-P/0S//P/0P/C-@ P Pp ` R Q @Y R0Up@-(M@`PjP<(Ѝp ( `PlP0  4dz@-VT@L0P 6S<c44.@,P(@2TY(,x&R R R @-@R R///// Rp@-0@P S  \ ppB \"S@p p h0 `pppppp, !$0pp(dO- 0`@P1P Ѝ0!S R w0Pp0(P\4S 0D0$$Y 0PJK8 S uw R RP304S ڠ0"S1$0@ 喌0   403/p 8 H0 0($<P  P 0$ 0 0S (0, PpWEV(O-0P`p,M$0 "~p@20S$`rP 0 0!  pT AT fT h@,ЍsT00$^p0 0 00@!Rqp 4 `0 0p04S 0Q1!1 d R- R02T1 0S.\ R@D!D<1R R8 H0` 0 pppW$00(p,0` 0S0 00` 0`Yfp np 0oo`@ ~!dp@o@kq&4X8(rsA-@ĔQP MP 匀 An`` p pHP LHЍNp ( 0  -IG-@PWp% U4 d$! ᴀA~ p $$ b0 P ! `" $`Bp  D 4`B~0 H0 h Q pO-M@8PpRPDLH D@$R 4SЍ4 R $ RQ  S P $ 4RS  0I  U08pP  0S5 P; 0   0]`P ,s ?o  0T0 00 `pp X 0&p,8kUp@-@M@P`4 8t0<000 |p L00S 08 p0@Ѝpq&~0 S/O-0p TM#$$0@`40"|pP>20SK@0SD00j@ DP 0SD0SA \^<40$ 400#qpp, 804<0YP$ 0I,0  P bU@qU PH04 87pPTЍ0$$ n`Vh0Y`0X0 0000 WX0 0 0S "J [ Pu$0 0(000qpp 0 QP Р 0Z,p , M/p p  $ dq&nPO-C~LM` G@$P0 0H%{p<50S ,3LЍqP sP @0p0$  0+qp PP`0$0G$$pP0P 00 0XpV0P$0  0 ($0 040FP ?P 4 0 ( $ "2 . $00PR00( ,VU 0Sd% 0哒#80 08 Y :0 U P  0 <0P<0 0(, P00 0 W P (0( S,0,0U000U,  ( 00W  00SWX0W 4ST 4SQ 0S 4 X4 `4\ P 4 "$`0 0S 004 mC $ 0$ R40H Lp 401SD<0S0`01pw0'x4 $r/040s?pp^' 0SU0P` 0 p  U  0  %Ph` 4$$  !Lq&8PgBsC-P0 @p`$M!!t Ph!6zp*0S00$ P 0SF0SC \^> 0T 00S!Q` b$NP$ a@ P P TpT T  0$ЍP`Lnq&XlO-P$4TM⓲(0@xp  8"`B @q0P|`TЍ X 0 ‡`ꀠ @000 0 01R0 0|#P @P0| 0C`l1  00B0 @P0@0$ 00S+0"+ /0YQ Y 0  0$ 0P|  V# `F0,0( ;q,0 Z 0( 00S$EK%U /0@P0@YT Y C-\M`0P  Rxp| %i& @P@0⤠P00͵@ @    0 09@P 0 ,0S  І\Ѝ P `00CS`0p S00 P0S X0X /X x&3S @-xMm0 $8@r@ T rxЍ/C-t2M`PqP0 LЍCɆ0 4Ć,p YW 000 010 0!pp⮆G媆B 800 0 嘆商P 0   @XWF QX9T傆 3S   PPp8m0 $! Pj 0p UU Ѝ00  ppPR1S1SItЍCC2XQ$ @ l:(/9=@FUdrp@-@`MMP  4S x0S h   - 00CS 0,!80( ܍Ѝp A!00 0 D߅P ׅ0 P tʅ# BP@P 8庅p=&5EC-MMPp@T hݍЍ0S@ `  f剅 Pp  0$$9 Pp 0$$10o HO/H0 B SP T@,_.D0 B DVm0 $8KDNL#  OjPh|O-YMp MP! @  1 B-Q=H0Cr?H@0 00 0剐0 `0T     Q 裟  ( 0 J'f/J0 BF!FP NJl#0y0TStk/JD3 BF.JF? BՄ.JF? B΄ Ʉ0$ 0 0 # 0P" ⵄ $ĕ n?P0,p >#nπ j⣄[ 0000p P (啄$ m0$( 8@#.J(0 B⇄#.J B₄#~J f@Z L d@TYލ Ѝl!F?gl!0FH!F?Y x[ 000080 ^P P30 0 RC2A0 A0A003#0#. 0S 0CS 080` M@ 00 11111f?(',=O-`0 p@lM "``  $upPZgfPH46( ssP~POJxU`U HU& WU( AU |TlЍaPEUP @@p @@@@ @`@L}P( V`Ҩ000#  0 `q0SP Vx0 V0 VP0=0 @ @@30 S\P4 0 0S$00O $P 0S0S \^0PU  { 40>S1># s  SP P %`@(VM?X?#P?U`1?`#X3V`3QA #  CZPWU (00 ' P p 00  P D Q: $   P  P OX1  P EUP1`P00 ɂ   PUL@廂(xx&ht@d$( q&p@-PM@P`4  <1 0S1L0$00 tp T  P 00S  0jiR TR LR a0BST plRs0BHhPЍpTepq&$ 0 Q /0@-$M` 0 0@P!!0 0=00<00;0\ 0:00(0DЍ lppW0`VpC-`Prp 00S! 0 1P P  0 UR LR  jpaBQT031,\Ѝ40pp p$8q&T P-R@-@0$908 S((R@-@ 0S @ S(0 S8(O-@P5Me0%qp50S ЍOL0oS00mWpPW $$Rh5 >\>PA `VWYPP8 aP. b@P* j%0$0CS0 :WP @4 R@P oO@0Sa )WPP >Pka hfa PC?P  <=?P  (7?P  1?P  +?P  %?P  ?P  ?P  ?P   ?P  ?P  t?P Xn_P DP [@X $A@P `] 9@P PV @>PT `"80x%2x o?P P R0* @,xq>P  h'_Ph VP  P $ 02#U: $?P  qV@P` [1 KC t=P 0!xdx )?P x!0xx ?P "l>P "X>P #D>P m0$ 8<0S _P P >P@0T ᙮h00ЍP-q&SU &3BGP[hvAK'-1<hx&O--@`pZM* pp :0S ЍO0FS iS:PC>`C$P X P~ЍPP X00 PW0P 0S tHVP0$$KPQ _ 6VPP 2VP (0KP=_0 <P $0  Q4 >P 4P?0P 4 P h 0`P00V00000S 00 0(0UP dU0P,0 E^PP `pP `$fPP0e4 =P 4`P `P @ <Pv H <Pp @0 SD00H0 RL0( 0xp 0qpT  R$4 "#qp 0p Uv$4P p$$Jv$4PpW qUpP( mUP$ X&cUP ]0P$0 $`pP$`P&? p 0vqpy$p ;Pp5 o  ;P 5  ;P 5 ;P 5  #;P t5  C;P T5  2;P 45q ;;P 5  F;P q/  ;P r {;P 01S [r/s?`&(Ѳ Ѱ  f;P s/l _;Pu$$u$4P~,*]P ,480C$0 i_pP  i_$$p0 qp\& p0t< <P`3C<pP 83< 5C$< <P <P2 ;P 2 ;P   ;P 2< S<P $ < 8 :P# 8 Z* 0uZ$ Bp $ "uP$4 "p#nqp0$  uY$ D0`!\R8008(0 000(0 40P0 `$,p 0$00 P00 T0ZXVp0$$1qp@y$$t$4P0H00`L0p9$4&pk#qp[$$t$4Pp |q&P-~di(,1U;/Vu0@-@M P  X 0 0S(p@  0vp 0Ѝ0'i@-SM@P, 0 % %$ &&4 '@p H0P0|00t0`*h 6XB00DL`|`p` \D Sߍi@i!i@-@  L 0Ѝ10S/p@-!MPM@P% PA. (01;P A!AxzP 0`0?oS c` 06P ``(z0 0A. 00P0P A Azvz0 0A. 00Pl0P AX XaA\mz0P 000ɝ4bzލЍp((  .[s@-1PP  . P ' `@T1ЍpP  00SUV  y@e}0 R !O-M@ Ptpp" `P"    ZRP? USRPLNRpP UplGRP U PA8P 0"h 0R00 p!P ! R% R/ RZ  '0P)W, # 8P_ 0S\hQY @ ztpNl lYUZ LxX (t0oW 0k0S, @ hWtP@ `Qtpd HQ L 40R !-'01Sp0S 3/p\ |] 8 X2tp \ [ 6@ `%tp Ѝ( >A-pQ@P@fQPP%Q;\`P RQ P QP[@,\T @- 9P ЍEA-MP p8@P00p`ЍpP h 0 sp !0  B9Hi@-@p @A-P`8QpP00{TP@?0~T } F.A-P`QpPl00]TP@:c?0`T _ F@-( V7PM00 ЍPp@-8M@ PE7P1  PP 4T0 Q0s0S00SPP  Q@VZDh A  S4 PQ`?ZV8ЍpXai@-@BMM  p 0S 7  /  0(⋙(@0S700$0/ 0d (}(@0S BލЍ<x}@ xu@i0@-MPXP@P SP p0V" CtS 0 0S $p弧Ѝ0iI@-@M  8 pЍi@-M @u6P0C :p p  1Q0r R0s0, 1p`ЍPWiis@-`Pp@ @@A6P0\ +@P`\R PL ! @'PP, CLaЍpW7@- P@BpX 6HO P<0<( CC,0 O@ Ѝ00:7@- P@pl #B0PHO P808 30C) BB@O@ Ѝ0DSm@-`MpkOP0P0ЍRP@U _@Pڦ0 H2p7ɦ0 P@ PPNIatwi@-$Mp8OP00$ЍzR`^@Px0 0 `pP0⚦P< P`@ p06㓦ai@-,B v Ѝ@-000 0  P_qp `^@Pg| ` @Nqpl P0 R00bS /v`tU 'vfvPxi !:`ys@-@`:PP  =p 1y0s|p@-` MP@NP Q Ѝp P    zQ  PN@XDvi 0@-,M@ P4P0 -  p,Ѝ0 0R0s0S 0 $0BQPP   N@WDWfp@-P:p@d@@4NPL0L. CRQQt P奥(`p:7@-X@ Pn4Pf00 Ѝ0  p ;DT@-@-M X@N4PH0H+. 00 0m pSЍ Wi @-M X@.4PH0H-. 00 0M pSЍ$ Wi1 0-M $009 P  1Ѝi@-@4M P(0(, CM@0:00@ P/a CRWC/A CR=C/@-00@- M@ 0( 0 p Ѝi0@-PM @P@\P@@sg {G 4  tЍ0@B?I X @-x@LPP ⿤m`PR?0L`0P.C B00 0put0@`Vm`l0PR/C B0\ L@ @@@@[uVZr03/`h %c  x&] 2 ////0 L0L0/%0 T0T0/%0 \0\0/%0 D0D0/%0 d00d0/%p@-@pbP 00p00D S 0A0CS 0$P>P 0@p%@-p0X( 0`P/ R/%0 O-4M@@!2T0(  Dnpď P(0$`!pSp D@T PoS@ڐAP`@ ptpP`[T000 [  q R  P Q R. 0S $P\(P  1/P m@0S  Lnp "SR(0 SL咣\ 2/P W0X( ɚ;6eĸ  O-M Mp@p U pP< n( I`P  0Y000 rܖr/ts  ;n[>Jp0Q p ,np Q hVs s@ p 0 Q (Es%_X[ H`00@0 0nP,s9 0I 00 48I0S;X`PU 0 3/P:㸢 "r<0r00S:0 0r.r0S Xr 1 r )03/q ⼑I0.vmpNI0SQP E"%J` 1 `E PIEP @0 l1 LAp 1 LJA@!1 ,tr `` #%J`!1 IA @@ |1 A!1 MA@ rPPU_ 03/P 03/ݍ Ѝ  i~i  %ip i   X(    c i    (O-@PpP  p T I@IPT! I`P XPLU @1O0S qSSoW P.Z  P' T2P! K0S 0 L0S 0M0S 0 N0SO0`S PPV lq|2 X([hx&@-,MP@~pP IP`(  tp?0S hh H/P00@ \0  N,Ѝ`j(8i(t@-P@ی0 P;G-@IPP0 `@ Y㌀LpL0PP  Qpp @ H@@@[@2(@s@-@~~I@P00ЍpLPL@P <` SPl[u E(Ps@-@TTI@P0{ sLPLՎ@P L` *PC[u kЍpW(PA-@''IPP0 F|`@sLeLᦎPPp p4 BFJN@l({@-@ \P/PP0P CD 0 S8800 >00Ѝ(x&0@-M@HPHP HPpHP d0P P P P 4P5p -Ѝ0lWE(7i7@-@΋d;p P H3pDP P! ()p Ѝ0$p @EA-M`@PK qpp"P  (  t   jp' (f( pt"ҟ<@T d8Po\2PLo RU TЍ0 P1X@P㪟 $@jp 3Qo t 0R o k)jo hoPp L`o X`Q$R@o VomLP:ЍAYP\ 0P R   1 |o 0 RSlojo $ #o0` R P U 0pD` PH`8i(i&:t@T\\`dzxPp@-P`@FP V  G`P $Q`!Q 00pFTpQA-@T 00`PpL0 p `@@-MPP00Ѝ`0 00p0@ 0 P ;J0P 0 p 0 `P0G-@(P00`(  P1r0Pp*0X!U0"R0 g"0d0"SЍ!90PX 0 , [p 0 @0@-@P P@ O-`@pP,(0V0S 8VP$P$P 40S 04S 0S(0p(`8P0S$0(PXO-M00q W$000Ѝ`QB QE 00 ,PP0P XU =0=P x,,.,h4@[T /q@P00 D~0800X5T (fM( R R[}"00+XP 000 ϪPs0"CQn BQj Qf?5^ XppUPPZ Ჰ  S$P HpWWH 0  FpA 0STt -PPX!0 [8!100#R0S #0o8^@  0YPpG@T 0CS0 0r xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@Dt@S 0q@0@Dt@ T030ZvH@WTl +  EP OU< E0 0 0`0n q l s { A-X Pp@`fP0040P 0 p 0 `P0O-P`$M@ Hp<X) P W0  Pp` 0p0  0p- 9pDP08pN/Snp `|0 h %P,00P0P,00U0,`(0DN/)j%ݍЍ(Ki!!! @-p Ii!p@-d`dP0S s@ Ppnc dp@@pP@@x%(O-(pPW` 00S`1 000xSP p<14! @T Z  P 1! P `IR  B3`W    +P Y:WWP P0@DBt@UWAq0@D@W@Dt@@t@@&&x"""Qp@-@P&00S#0 000xSyi`Vppsi`   ,?QQ0S p@$$^i 00&""""&p@-P M@ U U( 0P0 Ѝp 0TPTT@ !!0P!!` @TSލЍpP 0S0 S m9(00 1,0|cp>G@)0#30 Sd0 00#00pH0pM/ P41S (0Y CM/Zh"i("p@-`M@ip -0+SЍpSP    w R # <-cp 01S 0/S FM# iT# 00S/@-@Ch(d#A-P@`TpP @ 0SP N x&x#A-P@p `PW\ TPH0 000  (p`##&:i@- M @ph ̗ T&P00 Ѝ0( 1p 崗##9i#@-(M @p  ⤗ ((Pn00(Ѝ 00S D b&P02 ( p~#$#9i#@- pp 0QSЍS   g $$/0` S $S HH @S/8 S $, @$/ //P`%PPPR%@%W%0t S $S $S PP @S/@ S ,4 @,/(/$/ /`%b%E%R%W%G-X`@p1!0R  P A^QT TPD@YZX40PE200Gw DJPj%@%m%@- M @plՖd O%PT0T l0@ 0p@@$IE Ѝiv%%%i%@-@(M! 7 0P p@  ⛖0 p嘖(Ѝ%%i&@- M t@a%Pd0q &T pD 08 0zp$r Ѝ'&%iv%i%A-M< Pp! U0@P "` # 0(0pp0@`@$`<08RPL100 0(00080, Ap&8 >!P@0 @ p  :R@00C00 BP00ݍ@ T0S h@0 @+P0  S 0J&P&n&i8&v&&&&00@-@4M PCp  f0P %ӕ 0(1p9͕4Ѝ0&i x&&@-@CM`( E TpP 0 P P PP  08 ,! l(l pz l R動elm U#0P 6p 6S30S xe0\P 6vp 6SL<30S 8e 0P 6dp 3Q?weI0P 6Vp 2Q8ie8  Fp 0S0 e8 ;pt 5p l /p 0@ P嵷Po@2Q 8;eCߍ10S 3e10S ,e)e0  `0000pePU0``0` Rڬt1000 0:S R DP4d`pPQ dV pW ,PdUdH0S Ld dded`0Q d d8i(i''i'(''') ((i8iiiQ(W( ((('(&n&-(1(=(M(a(k(0@-@Pp@c-c(m%p@-P M@` QP0 aPp@@B Ѝpi(@-< @r"P(0/ Ѝ(%@-@ @^"P,03. z Ѝ(%0@-MP "M^@PۍЍ0@LB P P+ ]P@=BۍЍ0@5]0S0S1iS((@-X @f"PD0D/ 6I zp勓Ѝ(%A)@-X @I"PD0M/   ]pnЍ!)%.)O-`MM@ 40P4 lPgE7EYPJ7U'S$0`0@ 0 0 @`F( 0Rt*P} 0S0'V 0).0030070 0;00@00E000 Dc(@!!0 P c0 /C BRX      -Bp8$ B2"!0``F ^v E040800IcCP S@BA`p7 0P0a b!0@"0(0(0SF b0$ P0B'S$0؍Ѝ 0 0<'S   BS>C'0C'S Q:Ɵ"!! CR   ##9C0C<"!% &S&2"!2.B&>C2"" x&2"!/B Q 0dv*Sz S P&S   2S% S`r 0S R )SS &0C'Sq00 0S 0 tF t0ub0( 0 B( @ R `uSGcb X>b 0RX 0Tb`D0S4 Kb0S pe0  =b4I3&⩐`YP0  @+bp %b0S V60x$S0pH@b0S  bbp HcHAHZ 1wq೐p `Fv`Z hav`V aV'0Sl  g ,Z, aJT#P`# $PT# P#Pß P 0a<3J,#S0S cF @a0S9  a4Sba0S* a뭏 p`0WW   "|0a W'h/A@a0S LH|aHwap  H≏HAHY1ೀ  `FZ0pg&Vp ,, xTaI!PX! $PL! H!l P (@a41JD  VS0 ,Sx0 i*0*4({* $($$*P)(*&***P*{)++ +d)q)@%Pb)P+()X++)*)))))))))))))) *0@-M TPp@@9?Ѝ01 垐8@i++ 0 /%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@00-@-  7M3M ЍЍ/@-@ My[[00 0S/@-|(-@-  MMc ЍЍ/-@-  MM ЍЍ/@-\00S 0  0000 0 .LpЍ|(A0@-@YHYYp0 [{ph0x00p@-pMPP2 P0S 0@P 0 0 00 0XKp DlP@@ ((@,P0P4P8PS00!031 0@-Mt 0%K@P \ OGLPP @ (@@ 0KP 020Ѝ0%2(2@-@4P ,_$PAA _\2x&P@-d0 !X|!T@0 6p0\ (0000/45&5Ph0h@-` |!TD0 6p0\ ,00 00/45&5P-4s00#q^0<\ 0000/45&5P 4qs00#\,s0Q00/0045&5P-H 0:# ^4 0Q$0000/45&5P-H 09# ^4 0Q$0000/45&5P 4 <# \,4Q00/0045&5P@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$0045A5U5&5@- 0 00[P Ѝ-%A-Ppp`@WЍ P 3MP@ p7@-P@U0  (}:H Ѝ0}5A-0@nS0oSp@ p}P`\GPH0nS0oS{IPPvIPP'5@-40 E^F[5x&O-M M0 0D@00 h0*Sp0S SD E0 $ 0VBBBBBp@-@PὝP (؈0/Spp@CCC@-y YVCx&O-p0000@P`ᜐ (,唰00 Jp0@DTq oP0 PuP<噈u8 O3q&H-P-EDE@-M@A>0 0D@00 h0RpG0S SD @E0 $` 0*VLFEPFFFp@-@P6P (Q0/Spp@(G=GVG@-  Vx&lGG-`0@P $p堐0 >Jp00@DT oP0 dLuPP=u  UA+GP-Hq&GH@@-M0A~H` 0P0 @Rp UHp@-@PǜP (0/Sp&p@">ISIlI@- XUIx&O-P@M P0H`TrP"Ip)@20 R. +x   &  x `!p0 *00)0 &0_ ZRpM 劇uPfPMP- 9P GP p1g@P UP|0 0|00|0|00|00|00pt`x0 xtPGitPZ,0p0Y00t0V 0;;0x0U5OR$00|00|000ЍP-CKq&UKII8K-MMJNP0 @PG00 |06Qp0 `0 0N/0 4 {z000 0@(WT]KcKlKK7@-@P 60Lo SϜ 0 φ Ѝ0L@-@60P@L@-@W80P@L@-@ f60S 00S0?  壆ЍLp@-@PႛP (坆0/Spp@LLL@-兆M@-98 l0 0}0000000RBWCTMx&7@-P @!6P00S\ 0 \ Ѝ0Np@-@ PX0 0(ptPP(LPTp@@x(NO-@H `p0H PLLD%:Hp850`FVQ8 52@FP 50S  4 40S 4 0<0074a08:$0000000d4Dt0@90;84giP04P 04I_0(80@008 0rPP…0       +  @   ' B D# R4#  $# R # , @ ( "  )            Rr20  Jr0$000 p@r0 000 L6r0$800 (,r0<:00 "r08:00 r0@900 pr0,000 r000000Ir0909 1R@11r0$0000 00t0,00w0 00x~00007000+ 4 ~ Ѝ,%Qx%Qq&M((P-(N\QgQ(lQrQxQQQQ|%A-RMMIN@XPpD`p`00EL y눁H00p$xL0Np0KS 04  R< pL04@0 囄p? 04n/`  0xHP 0 ,PEP.0D P! D4T 4$04 0404040 40$4 0(40,4`044<$@TRݍЍ$!R(QQQRRRp@-@P*P (E0/Spp@JT_TxT R R @-(/T0@-@MP`p 0M000 NPPЍ0P0 0 0N0 M0P ^rs@-`/P0@00 ]MP0 JЍp0/s@-`P@00!  P0d RPPP @@ 0 S0Ѝp(T(002P0/@-@BMP' 41010 0000000 0P b<@< S[H00BߍBߍ@o꠆TG-0@`p8Pp3 pϿ| D0Dx4<40 8r0o,l<0(000pE040p<0< Dp PH00ЍpRPN PG  MS($XDYTO-$M@0 1`Pp0 @T .V0<00$Ѝ 03/ Z0p 1P P @0 ` [q0P":@ 0 `  p00P LH0@3/pPp1 0P 0T@Pp 0 0 R꠆T0/A-PMM`p/CD P@1L# 4ND0@@ 0@00 0@!pmߍPڀ@T ߍA8Hꥆ(C-P[ 4M@关@Ꮈ0P` :0P`PT  00T 0 P  40( 0``00S0 V0S`0000 pp  jPP0QqqD0D00V 0 000OPP4Ѝ 000<0@(#UPUTU(--0M 00H0 @-P ( zg pЍUU@- ROUx&O-P@M$  0\0p 0@"@0"@0 "Cp20a0CS t2g@pbP 0p00@0Hp 㚁! 0 nP十n P ⊵0S R n  tgOz g!!H1 _]P f0S R  d  .z ' p0 r+BKp h 0[4S08pS @p @Ѝ?BH-q&^XxUP-V4VtWWWXkX0@-M MCN@80P0 0E@%(00 0&Kp  0 @ Q  Q Q(20P( 0Q,10P , HP0@Pލ Ѝ0@PP|XXXXXX7@-@P p00Lo SϜ 0 嫀 Ѝ0Y@-@00P@Y@-@320P@Y@-@ B00S 00S0?  ЍYp@-@P^P (y0/Spp@YYY0/p/p@-P@ၧ $( $(0XRX0X00\00`0ddhhllppttpp@-@ P =:7DD1@@+HH%LLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@PpA-0@PJ04S->Cۦ->C?Xʦ9>:>CŦ?n:>CF 0? AC>ᷦ}C>GᲦmFᮦEnF᪦E~GদX J.X V  $$((,S>,ᆦ}S>GၦmF}HHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TT`XX\\``ddh~hplzlpwptttxqx1[ h`ebp0 p$Q*\5 S `0S&P%@ PSزK 0CA0Q R,⳪2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 PJЍp((( ((hA-Pot10MSP8MRTaO0@OS@ 0 402#0  p7!?P09 ??. U00S.UN@E@D 0ݍ8ЍA0*Jt0 R `\ = V 0010*nݍ8Ѝ((((HhO-C ` dϠ 0@ `ÌpS0 10S  0#‚ 0Px 0`0 C cà00d0 PS CQ c ( ((U hh%ix&2igp@-Pl`0@S     V@00Sp0?00Sp0?0p%(t0p@-0`S[\@ L00S000000B0E0p(%O-MMO⾟D`, ʽ%5_Q0uPSi`50$DCp%?D0Sdd/nD? 0?D4'Pp؍ߍ 2@ŒD 0L 04;20d04 0]0 00@4T@:T @:T @9T @ 9T @8T @8T@@04s00C0`p 0 40S7{ 3 0 000p0  `  ≽Z X  Z0 ``ao,F Ϡ ß\ ^/F222902?"""0Pb 2@őD L 00 /4;2_CB 0d0"0 0 o 0S,2 0r 0` 0W9 Bp`xSi`107CB/0`22220&OD0? 0 0430hl 0@DE0 L04;d00 0@ `4 0<22229$,4( 0 02?  0 0@Dő L0 0/4;$0 BrB 0ldh 0@ `Ì0 1m%((A%%o((TO--)MM,0=0?0(8$0pBD0D`0S> 80pW:,0 0  0 kE(((( ( P@P`P @4垣 P@  4唣pKB 3E⇣p@ d3T@  4SP@ * 4P (d0S0,5 Sx0<0(5002 0,%S0022Q04[GW 0QSGOxrx" 0 04 0A XEGA 040A 8C0P4p3x00084%$0<0D0t@70|00匐XL5P5G   ?ᘵ8`F  ?  ? psd pG8#PE0 0" 0 p p4%p8$``05<4Rp`(F$11 84<00x 0 08PSPK @j`@0 ? @`0~PP* ?;@P`(6#R0:K`@0$- 00[00 1p&"0 ?001>0[`0 c2# S,Z Q Z3?001> !00   BBpQ0&Pp0/2#$ 0  ?Wp1Wp#T0p10G 0̴E  ?ƴPPB@TP` 0P됈  00B1  B[1 ` U"B !!0 R0CQE0E ?P围0 pΟ됈 0 1 B[0`0US  B 110S >E:e @P`x1፵ G084<ĔCPp0S84<Ą-0$5BPS,pQɑRB@L0 0 0000\60S|0p ?HL404P@0 @6p9'(?S@00 Qt(7\5?>C0P奁%4tx0eL70(1#T a2!, A3 31 0  @`0 04 p  0H$4  E$ ( B, @%LV.  R*h (r < ( X ( \ $( ?.@Xt@+@B@A.@B,-8 Hu p3 @40K p>0 ,p B8d A YZQ !$0 XZ R ŷ{A/  <pW $?.t{ 4Ąß Rï80\@$D04 0H4( 0ĀpP2 R 5#< 5423倂r0S.2x됺 z'z'|z {' 00쑟0d0 CSQ c6Rc(+S`PC @<0 z犸 z'(Ȋ00 (08+S,C 00 SP0\h!P !0@ 1@徟p0 Q0&)0S`@ RC PP0 뀠@t7 j0JF 0aK0`0S >(^Fk6l(Qlll(x&ht@hx&l(mllTU \iTm(((,m(%Dm((8 ( `00S: 0 #$B )$0+V.  |00S  s 0=S,ⱷ0S/0$0 1H@ pp4>PP04SP0 0R0 S00C0> S< 0,0z0P0hA 0,0S9弪 p开8嘥ȿ+" < Q \%`R 0  ᐡ! #0@(0 0 @DU@4A~420 @R40 `0```0T0(lb 0 Bp2 I `0 P$5"S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%RX# R0C00h0$l`0 R#00B1d0 R*%눃U` p 0 0 0 (0 0C 0(0(0 S 3`R` F $%R0 l ! `(4 p  R2dṲ 4RT T  4P%QXԐ R0 d0 03 0  *0   8 @ T``Q }+H0'H ({P+H⃶ }H060S , 0 B2\,^   00/d A! a,3 1 L&0A$01=S,00CU `010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0 80 C  0C1448000C ST00C@ pd`h48 0 RT*0C14  4  0T: $5Sl0 @0h pp^:S $%S0! !H`$p$p(0W,x0S ,4 j d,04  0,4 $張 00`  Vj0S   0帀0 X#` x0,y 0X\%Ϡ H R     dp 0G g!<X 9\%R 90SP Q``ƌ` $$T0*`S` 0$5S l01` p0000S2d20*ST0T00! ! P5RXԐ S(0d0 0嬱 婱   ࣱ(000080@ 0hS`0?0`@$00$0ppS $S00S0@R7l倐HG1P00@>|8p`0x1İ4pYU0IX!@@l00@0T: @5A$\Q 0@08(0 困 (0d0O@ 0NN nC 01sp0S<=0S0 000S.?08C0S|= 0Ϡ5,"\Ő\   0 d0/ @ `.M3,00 $ ?0000P0>0S0> 0,00C0S0 X>0S ?0S ?>0S 0{ ?00@P|:x*,EWP>0S`EN C>`>0S303040404 0#pCVW*D|oV.UP\oV.GV0S  ?0 PS?\5=S,??^ E?Ὦ0 0S 04 } dLĒH 0@ `Ì014 ,$0S0S 04 e d ,04 09 049)ݍЍSmfG-`RM@Xr doPP d oP`T `UP P9  ,9p Ҵ0S  ߍ<0H(00,0 00004008004004 04$0D0(0P W[  9pU l9p* `n\G` 8 P 8 ,     0,00  `, i9p 0`?`a8SڿcPb 0  0**0P0^ ␟ 0* \md@edAsmzd@nmmmmmmmmA-@Mp`;@@ gbp@ݍ P@00@7T 0 2 "0 p@-@P"P (=n0/Spp@}Ondn}nR/XG-P `$ 0pᶘ@V` 0㯘@`` V`@&!D( `G-@P 4`Sᆲ Y00000pquP0Y T0T! ##P @?Ѝ_uP :^FF^: p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@O-4MX0p0\00``PK0 0,, 0S P 0 `mmS2aSMS ASB0C0`b0CX S0 SSU0@0 0DT dS$ 09R "P T 0U8$UQUDT P 0 sS@ @ @U00 @@@ X 00 p Pm0S00 0 004 00P4Ѝnon:o[oo@-鬲,@ $=<A9:nx&0@- @   ḱ G-@0Pv t^``PE0 00000BoH0UB?E ᴀx((P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@px(0P  C @-rl co`/us@-PL@` 008#V  @^lЍpP(x(us@-PX00S@H0`ă5#040<#V @@lЍpL(P(x(u\10 PS/C-HQ@@MPM`6`@fa ᘬ1p P06 0 T:@6S-O@  DD6ۍЍC+ 0 Q 0ˍ14 ^ 3?\ P;0T_ 0+ۍЍL(x(P(h(T(uG-hB` p$PPH"k 0F040( [06# R 0 !)k0 <0 0 !Rk0006&0C06 0  B 00C0( 6V0: R`$dij g2 WSQ( 0t0C@0תӪ> 0(b S 03S0! ,0ƪpᐩ ª U0B 40P40  0AS (00 0娪  ,太pF0L(-000 6 0 6卪< 0g,(2200U( ,0 00 (p|Pc`$H% $0$匌0@d0<`LP44 0T0<<0<X5-!<0S<d8 X 0<PU dPX  ޚ0L VR0400& \p#  @ \ 110B0Jf0F&0&aPeeC 0CP!Pp\p : !P00 ` 0Z0C `$00SE 0j 00S0 :#*&(:C1\:0 0t:Ѐ709,* 0 ( "*9 6 !0H 0 0H:jPp<D 4ZH&ۭ0S\9 R0H0=iL  X&' d  P &X p \ ,p0&s0&$0#0  0vSs0Cp0 0 V0( " Br  0& 0 `ve BRp(0 x0Sv 0Su008@ pp3PPXP 0R SHq SoJP@p0S (叠7L R d0  P# 0`Dd&oobe+@Eር&0#H6 C 0 ᓔ)6 70 BԖ 6g0CT 00C0CS : B 47! S>0S0  C02#&0$8yP0 0Y 0:YG:e3006`  0(01 0Ƭ 0 JT2  060 5&尬ȥ(6YB:P0TSL0S d0 \P U7 50SpW,@61 210!!!0 Sl$ ᓢ""ǂ $0d0$&S: 060& 00.7xG`W0A 0L4#00 07pX0SNVPEPUJ 30SB 7W 73PU,CL0S \09`0 s PP1 P# j%x3626l0H0p0t0x0%208630JPp`, 7rg`sP O7pg j26_2H0p0t0x01f&! 02/!"6 QP*dX P 0 l0ϫPPP  rr0vg`P f_P  6 \!PU:< &U":0U:  !0 !0 h℀(L0SUWU: <p0SB:W\: 0 6Px(T(vX(wP(Hwuwww%%xh(Bx`(%QSNnx(p(x(xH(xx4yL(Oyhyx&ht@hx&xyyvyyA{yy%A%{ %(x(P(d  0P0  W:h  吣  p001p1Ps 0 !GP <`U&`06!0U00 h hL0S `0  l1#'$/%x16K1sH0lp0t0x00080&2l0P f E 2`p,2& 0hC0Df?o2U+du&0#6` c2H} H0 HD0CߍW?G-`RM@Xr 8fPP deP`T `)P P9  ,0p 0S  Zߍ<0H(00,0 00004008004004 04$0D0(0P W[  0pU l0p* `e\` 8 $ 8l ,     0,00  ` =0p 0`?`a8SړZPb 0  0**0P0U d 0* {d@edA{zd@g|{{{ ||0|C|X|A-@Mp`;@@ ;Yp@ݍ P@00@.T 0 2 "0 @-`p  D@P00S0?0\ 0S 0 dS\F\GL0 \ gL|0 SDKT ЍE%KUJ%FZO%A_0 $}|/}@-邪H D5<<P4@0 ,P5U@2H}x&s}}D~A-p`P@リP V0 d$}G-`RM@Xr dPP ddP`T `P P9  ,o/p P0S  ߍ<0H(00,0 00004008004004 04$0D0(0P pW[  E/pU l?/p* `Ld\ ` 8 Ψ 8 ,H  D @ < 0,060 2 `⪨ .p 0`?`a8S=YPb 0  0**0P0}T  0* Ad@edAXzd@pyρA-@Mp`;@@ Wp@ݍ P@00@X-T 0 2 "0 0-<\   RS  0 S& 0 /)Q@-$ Q:4FO--@MMh Vg0d00h00\00|00p000 0L0$0l0(0t02000040<080H030<00404p 040F00G00H0040P0050<00S00|0000000S00?00H R00S t0S ΢Pth|0p 0l0- SHd0h 04?i/0,pD @|0@ Sp00 Df,P o 0D@峞/aZ@P#t,pD -P |Sl0S 1 : S  R 5 @ 8PPP0j VPrPE_oRb pͣPU p  ѣP ̣P@D 3m`Tbd0h 0 0D0&Qd0h QP  < h0@ F)0S@040x0 0T0X0@0`0,000$0 X0R0 X0R@00@00S@0S100p S0T00RS00 R0 R0S0T0y /٩0P00Q,QP `R  V 000QV 0`S`SU [ T @0S X0S2|0p 0/>0 D0p{ 耝p`ST(+qpv @@0S ?W01?0#*@0cph X0S*Zp_ X`[ 0[ZK Y  Y* >05ZR[:L0Sd P!0SV@ PXP UU L0 0P U PDIJҢP04!,A$ 8!00 ]f?/5XV$^dw)Ċx&gfffU[RRaArrAaQ!AltQ0L Ry 0  /`0ST0S00`0 Yx00x0T0 0S03%05# Y Y0<0 0S<00<0 0 <00 0LQ.00 0$0.,0S 2.[ .Q`. 0S  .T0X @.0S . 0SQx <..q4nEQ `F..Q. r.l0S ݍЍ0/^ &>l02)`PP {^l4)&>C) 0< S0|0| 0$02#l0ʣ Y0000 0l 0H0 30R08 0R000L0L0S0 Y@ $ p0003Q t R t L0 p 0H0( S ԃ0S d(0HH00 (0.00\0S" Y0( R030"S R&宙.80S  l'p% P  P:( ~(0S Y0( R00S $4 0$0 Y000 @0,0 0#40+40`00 01@01X01T000 0 <0$00(0x0,040303)00000 0$2?@1c4 04v 08#$0 #(#< 0 0  S- =Q p0Q\0S000t0o0 00 R  PT pK&?  D&po P^ ( 64 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |COQ`000S  0! YQ0R0( lR00S LY(0 00 25 010 0P B24 01(00(0S    k B*{@- S-Ea A 8 / eA@00@- 44@4P\P 0B"" )-@=B')0/p/@-w -*0x&G-`@ P p>!>0gP U0 0  P@ G認0P\0" 0L\ R 0\ U   )T-Ռs@-pP@ 0  /X 0TT+,LЍp P `/0 ,)) @-03S   i, ЍA-@p M0 0S P `v1 00` 0! 0E,))?,1 (:,Y/:5,T/A0,a@FPVX`F: Ѝ",\0@-4M@ 0P0S 4Q 0   R 0  9   0 "0!4Ѝ0@+R  )   0 "0!R 0S 0S 0  ( 4Ѝ0@+4Ѝ0)ȍ @-$p[)H@- 0 R* 0s# p@0)P `00CS`0p S00 P0S X0X /X,x&p@-`3@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hd`0 Pp <10C <1$0 810S81)0%hx&x&)0@--@4MT 8+AQ`3+d0+hQ 1++`"R d2RK#+ *d2SA t= hk0:{PPS['ΞkHk>[E{701 < = * + (+S  PPP* 0 @@@ zj{ k{[+S[*4Ѝ00B:k{{'*k{\+S*?@@-C6?Y@()))D0%P)p)q@-k0d2SU()@0@-0S0@d2S`2"R20%)x@-@ 081 P 0['t@ t0 t 0#-S88<8xS`S)?S DS .  <(8(Hy*@0C "&K+ C 0BK+ g00CS00H@*a0CS00  ҕ  ;PK 0@P< 0@0 9 90S9 00K +K  ⬕dI  PK 0  PK.  K   ⑕  PK P 0K. &80  u  ޖ@Pjjd 80S D8  ] ` ƖPR _?0<0>080m?040>000>0,0?0(0?0$0?0 0?0?0?0?0?0 0?00?0?0-I?V_& ! t ⊖`PK PP D70S@'0 0C!0R3 70S0Sy K  @PPOh Vpt0@Pp f pt@@hP0X#T0 0T\  TpW pDS  0QSL0Q㭕0P@a0X\0D`X0D S@0S) @DU2 PP H PP<WK { 0P@0 K. %K>< 0/ $@@dpP @p XI m0S$0 0C!0R3 40S0S 0P`0ԕP `0zΕP c=0,C0 0 S;.000 |%+ ⍅0  d0d0@ 3GS p 1 01 Q 1 \R \??p@1cE0D H`R(D# R  DA%  Z   Y   \0T0S l8D00D0, L0 SH00H0H P0S  ғA  9P0S>$ > ⻓  $PcݍЍ ⮓  ⨓Ta ? PP|A80S  0 PP  ␓ ` P ⃓ 0 Pxo w` B  ޔPPj@t0SC 000+ ۄL: :*x** *x&bڝ*T%H!*)**gfffơ '0@-<00iS03S !G5*P]!*x*@-l@hy 0\ 0 L  @4  0   譢*¢ˢ*@-`0@Px0 B0PU1 S2P T0p0S 0@ SB8 0( p$ ЍP%**٢hx&ޢC-PD1`0B8! Y!R!tM@p  10S # tЍ000iS00S 00S d `P "W @ 0 b P P000 p 0p, W@000P%**hx&**T%`0@-@X0 B0@T1 S2@ 0P   0S  P%*G-lQ0S `` @P 0S 484a4qP0 0@0C!R! 1S1 R TP`pȀА U0(@P 0E!0R30S n | XE#0S+ @TP` 00 @$ *hx& ****2*O-0B$p 0Q0US`PP PP" @P0 D  0S= 0S: 0P5"  UE  (; V S 0S000C?oV20SP@YO P`P30S  "x#0ES0 000D30S ЍY& 0 X@00020S ?P0 "_X0000 { 000S 0@@n" 0 0@0010S P0 YQ: 00 0X@60000S X0000000S~ @0 0 n RT 0@s0S w@ 0 @$ 0 k@WH00S 0 T,} D(!4*>;*Vhx&zx&ܣ*`1A-0S PPP@`D1 T0 :414a PU @T*$PQP@`0S 0D !0R3 Pp U 0S 0S  |!P0S0S \0S < !l@*hx&V****p0A-0S |P `p @T V @TL$@ 0S$p$00>`@*hx&*ǤG-!1 RR0堑S @Pxqx! 0P0:ЍS @L`P 0< !000W PP@:SR  0 c Q Vf`P0pQ0 _000V000***hx& **(x&?`v2O-0S E0b0 -Y1PpP@ 0pP00Z: P0-:p R02:10 R S U+:SR00W 030"S P} 0000 S' @@  W0:0 SPh[ {\ XR 000P@ Ѝ*hx& ***>(x&C-MM@P Q0S @p T0:ۍЍ0S 0 <9000@T`PP@p0 & % Y   000PU *hx&*0p@-0S ^P`t0 U0p(i@TP` 0Q0F00S )@*hx&*ڥA-p`P@P p?pDorP 0L0 0C?oR20S  P x& p@-/0@PTy 0Pp SRp*@-8:0S$$ B0A Ajk3*x&A-`0p0O0000 SPڤ/0>+b P0 P<ɄP@O 0 z0O0?*+^%0@-@0 0 0@0Ѝs@-@P`P @TZ TT?0 00?+"+R  + ЍpȦx&$0L<S/ @-~P+^%@-<p @,_P0@0^% O-1@`pVCMv Pap@0DWCߍ貀TX B/ᑒ0S x q∍V@0PS 0 ?2/ 00S 0S 0S0000崐(h X:0000Y&*Đ0S 0 0S 0 000R*Q l\x0S D`W0S  `*+*hx& +O-h3p0]MS TTӾPcPC H0@#@=00RS $#05 B1cp2"!ClMLRPP "2<W 0"00RSZ 0|"tlcp`"d HLPH"L  Hp)<P $B0!00hN/0>+b  P<&P P [0?0H @P MPPD w  L P MP7Pt]ߍ*hx&B***a^%+ç^%ѧ  **O/X0\+'x&^%8@-$@0 00: S *G-@ q `0S+ P 00S P0 S00P R HRڄ00S t)  Y``P 0 Y00:$00S $**x&WpG-AM`P@spP00 040AލG/0 008/P1 00C 0  R+h X 0 | 0 D n궨+x&A-MMp00 0/R @`㜀GPP 0S P@ۍЍ D >.`D @P 0S ␌P`+p@-0@ @P QP @p@-@@O-3tM0 S 嶼눣00RSx3 l3l#0hdC4#SXC#PtЍO蜼@c -4PL   +)F0@`00(AoԲ`L<` rL\0@ mXK= hpWW#XI@P %L<0@(d0PxSiSeP 0)0@& 000 5L<0@ Qu/,f A`h`"TDL KtЍ0 0C0D10S 0pS%0` S\Xh0SS   ,8,0d0S X00%<0P!xaap 08Xm*hx&-***ç^%^%Sx&+*թ**IjA-MpM`@PP 0pp1d!d@P TT$L+< 0ۍЍ aD D< pPU U`k p0P  x0S ip T0TP 8 8 [EꜪƪx&˪+* *@-9P@-L@4#S 0 C 0#S 0 :@^%0A-@P` 0 P0: 0lhp ?dt0@$a@00S$`V SR*#l +*= 0S 0 0/ R  /0SL0 `0p@- P0@P*D` ?*t0Pp UTp$/p*l +0p@-P@ 0 P0: 0|@x` ?t01S 0p@D0 $ P\@P@ p$0*ml +@-MPM@T 0``p/VVP   BP @T@ۍЍVP @p@-/Pថ@P@p00/00@P 0S ꤫A-P/p\0@oC 0T@@DuZU pDP@Dp+G-pP{`04PSp@P`0PP0C0 T`4 $D@ҫl +*ܫG-頡FPTp A`Pt&0@(0C0V$Q@$0( 6100v`PPEPP ` @$@@(`/  0`0 @ `P`:0P p0@0 P $* l +*2M@-@00$D l +0@-S@ s0S 0S j 0S d0 P[X T` R 8dD0&F$ ЀP 0S00^ql +p@-@`PP|)0S ? 0P0 @/dPs^0P 0 00pʬO-2p0SlM |20SHlPP pT PH0`000@,Q 0*` R 0@*@a0Sg@01 $10 %1 08`008<}0@ _9A pN NGlЍ 0`0V@ 0 0/} 0` @T`$ os000 0 0($00S0,00S0(0 0S000$0S0400}@0 1S0 00w}@*hx&۬*x&*l +***/C-20MS aYr 0q]P0 00;000Ѝ jPP Ȍd ` X8P 4 $ $@0@D)`P <P z  L1RQ rQS $0!SP P0hy0 P X1 D1H1D10S0|"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t2 R" *hx&j*l +x&ͭ׭!+**Mg ***/Z' jP0@-P  *x&0@-Q 0@T0 R ||m0AS@ ЍH0 DP( X%*x+x&`%m p/0/@-x 0 RS T0R H0P88Ѝ S x+I *x&A-D@p 0 0SP( ` `q `x+DL0@-  Q0 0P ,0z{ Ѝx+ *^x&@-0xP 00S@%*S` P@` 40P , 0 PЍpx+ *x&0@-0@S 0$P B5/x00SP`P qpH0P@`5 0((@"# Ѝ*x+* *ԯx&p@-hPh@4S 0SPP *bD0D P0000$R0p4&x+ *B*+0s@-0@SP  40B3/p00S\0 cpH0P`@ 0((`Ѝp*x+* *Qx&p@-P,@P@pP @ꈰp@-X0XP0SpH`@P eP  !@p*`%x+x&ȰA-P1a051q0S :pz@P 00P7P)}巅P!PxR 0B@ exPhB 0 W000@A u*x+**x& +G-pa! O` \; 0 00D! O 4q4$-83(S$1$A?@" 0 Q I!Z/ , O,  0 00`2 D O 83Sx00"@0Ap !-p00@ J!DЍ*/hx& *?*%Lx&*X**O-Tp0EMSP8a  ,, @$3po0C 0T*0 ?o2W03S 20S " T  0S Eߍ0S3 000 |"0S 0t"! 0dDV V V-   B B B 0 0 "p+ 10S o0@  B B B 0 0    B B B 0 0 X![ H℄P 8P# 0S 帴 V    V p0S    V     V l p T D *hx&c*z`% *Ųٲ;FV 0P/00S C `%x+P O-6M M)$ PR P  50S@ލ Ѝ90嬕e@T 500RSQ 50SM\5pE9S)0D0e0000EH0D# 8"0@$zB #00 (4 S Bg@P%DB9S; B. 0 s4B [T }U@ 40T 949 dj T#ҳ3NY0 0IDz3B 300 00zBwwPp`g(4 S BR0305 3 R g 0#p   "00K b(@ 2B0 050Ƞ30s33P03Ƞs0 20S )Txi0040 S X(L#R Q0cÝ\V I $ LMB EM  1 )a#0)90S 0)(PU @10S1$10Sh 0 X `y 0W090C/W pC0S 1W 0 pWJB:B6`FVU 4S 04L#0 ZBJx+* * *x&*,`%**hx&ڴ**,Rw *+O-dCd5)SW0pW_`R00yu0SW  0PS9 S00P0S 0S 呲09 R ?oV20SJUMU5D R4 pGW`pVp``t\2 RD R: R; 4<i820S>,P: %+ $m909909 Ѝ0 l +"+R ! R  xEUY0+5p`PlP d<X (`e b0S F Pz 00 ?d|qp V00S |0S 906;#;S T%lO+Xlx+*`%*hx&x& * *c*е#<Jl* +0O-t'BM @R MT'T7PP uP P Bލ Ѝ$W0S70S  媱00`P 60Sf VSP M JGDA;h]eghbg0304048-8<*<H'HL$LMgJgGg x x||/g9^E+gE(g:^E$gE@%0A(US0 (12222( , 0 4 8 @ D P T | Z40(01@ 0D0(02,020028 0T0Pp00|`P$ 0PD \4$ R> P<(4 R $ R 3   p}z`wP t +0/ဳ䀣 0/00#00 20 0 0/0?,00#H0?\0?d0 0,0刓吃(pX``P20R000%60"`20=S" " \" R0x30=00 2R 00# |# #X0/80\ /`0d 0 %0L0<040h0 aR!S  xx#3 d\ P!0!! ,AQ   9-0CS   R0 R R 0N\ \0\x0=0- 9!s*lTx+*hx&k*`%x&3J_C-2BMMP0000 00 Qa0S q䑟=0=P  RP!0AS[0 =0p㈁0W`1lqTP  RP 8!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڔ0=ۍЍ|0 p0P0h0d0S Pp 0)NB * *Tx+***.x&*ϷO-MEMM 0$P0@B@@<hSD 4 4R 4S{ #404P |DQyD$` B D 吃夠PEN␓{D0S[h 04<`#4 "SQ A 0P3/04$!0P+s00@ @"͡3( 0A E6/0@0 GR00 G0Q0'G2P004SQ 0P3/04@EP0 C 6/0@0 4S; 4$`0?0;DC0 4P'x P~ ׍EލЍ `4SQ 0P3/G+p0 G#͡0 0A6/04G+p0+ G4 $  BRPEN0SP @0S1P@0S( 0$00S  B 0SP D$R00S5 00S \0l 9P tl x3  PPnP0SZ *Tgx+*`%R *Ҹ*hx& 0  *O@-@0SS *0O-M< 00 0 80 4 @b  P b 0 @0 0H0@0LP0DpPP:P S  S  S;  S 0 ``S p SK  S"  S<60S  ,,C (60S =6f0S -P: 050S  " Ѝ50S P 0 L50S  <<  0, 000%`,,;0S40S   40S  P 0 0 8 Z0 0 0`40S 0 H30S   30S30S  j?P~ 0> Z 0 0 8P30S` P V0A 0 ,#0 0 020S  ] 20S620S S8PW1 0 UUZ 0 0 8`]20S 0  m "`f0 0 0D010S 403/  !PDZ00 0 T10S00S 0 0 800S 0 4\  03/Z 4   00  *x&*=hx&**x+T%#OxQQN+*w|Oʹ*+RTA-1( 0  S !@ 1 1R 4S8 !4q04@0n`P1 PP0S  R-* SR/ AP/ $!0 010000 QP 0PU 0$N P Ѝ0PB0P;C0d0P70S050 000 @ 0@0 0 * *Tgx+*GR@-cM0S tt卫pCpS0S YLP8#044  R0 3s 0500L Pr5"0C590C990C9000{Ppp D0S d2l"h2Q090 9hx&p@-@PP` T0:p=P 0S 0@P*p@-@PT0*p%P 0S 0@TP@-@0 00 0  xl0 dT0 P<0 <$0@ (  R0+W`irw}1+p@-P@P @0 4 0D !0R3 9 p*x&p@-P` , 'p00CS08p@ T 00CS08 P yTnTyDop0 @00  p0 0 S*x&-@- T 5L00S @P@0P\Ѝ@Ѝ/x&*Rs@-`P@00S#P }0 ЍpR00SP }0 `TL00S8T A0 `| *żx&#*hx&p@-@Q   P * | P  tP  pl$P d Pd0T S0BP ,[ W%p@T\x&X0@-@MPPPP8 ,0P *Ѝ0P0#+@-0@ M \0 00D CZv7 ۍ(p@-0@S m(t0P0SdP 0@00} p@044000Sp p@H*\x&*mhx&A-/`,m@Pp/@DЍ/SpPP 80 004P0000S@-0@S  0S 0 000h0@0S P| @044000S @{*\x&*hx&@-0@S 0 000d0@0S qPx|R @000f,00S @]¾*\x&*پhx&@-0@S 0 000nd0@0S PJ|$ @0008,00S @/*x&*)hx&C-0M.SPp4`8A0/SS  嗧0  0P V ! ,↧  4‧          l  X 00@ 0 6Ѝ*@C<w~@-5ÿA-@P`App` XP L50 S000ЍU000'+ÿ p@-BMP` 0 @E CR V  u{P\0FS \0 BލpAS 9uP0P S00@ Z5@!0'+(ÿA-P@`u<0 puW ~5A0'+ÿ@-#APv5 z 0S'P  X&PZ50#PP `@rkPL 00p1 F0S6 0 00@1@00`V105 S:; S0*PP 00P  0 0 P 0 Ѝp_S-S pU`0T 0D0P0;C0'+]dn&8'+*0@-CM@P0,  0  DCߍ00'+@- @ R8000'+@-$M0h `  P'@PPDp$ЍPU D0P 40'+ÿ@-d`$MC/0P@  Z )t8p  $Ѝÿ0'+@-0@XM0F/P> XЍÿQ@-8@BM0 ,  Bߍ/0/A-pP0`V  @  0!S l dH4 x 0T`0  0 d0 DoH'+p@-P@U U h 0<Ge $@p@ko H,hx&:P 7P P / //cpV-M M? 'Bۍ Ѝhx&4`00CS`0 X4X0 X /x&C-pQDMDЍCk@p`dP !W200 u00@020PS00C00@ Rp@T3 W+X( U U    1x  xx0. X   !x  hx.0T HHp8(p Whx&H'+P'+0@-P83TM<0S @Q TЍ0@0!Qy~{0"0CS0 "PnFTЍ0@a b!0S SL03  `RX"d0AS!0 @H 0S(TЍ0@e7 1 - )00P1P2P3P4P5Pw0hP1 20345PfP# TЍ0@j@P=P(<P$; :9876 ,1jS$ $PPQ Q P!(  x\TЍ0H'+K\t3O-@`pR Ѝ@-0  6 ЍO-@p P4 aT00SP Ѝ -QP  P P ADPP@D`FRPP@-@0 0 0 Ѝ@?@-s x&@-w>@-QAMp M0W@`0lq`Q`\0j p0P 0s\0 rAލ Ѝq0R S 0P01 ?t0A9 !R  0G/d@PIs*1 &1@s<T0 <9<@D@ D Z0R0`G  -+2+@-g2+0@-6S xy-+>p@-Pp sssxsm/l @Pp" P8 2 ,m$ p@ <.+.+@-*s =>[x&0@-h@  0@ 0\Q0CS @C&p@-@Pp00Sp8PU``p840#U :PX0Pp4P8P P XPp`P -7@- 0@P0 0P0S0! B Ѝ0@Ѝ/G-P`M`P q@䠟 T0D 0 S J!`Ѝp | J ]  ^p!0 l 0`# $C0  .0`  W0BP `q&6,1@-@`Pp@"!0# U 0 xph , X6P@TP(P  ЍCNJa-,MKr <0"0!0!0 0 ;0[RS,x&-7@-4r`P @XT@D R 0@=  x000 Ѝ0@Ѝ/H% \4+p@-PP@ 2r0S 0CS 23 0 0p#rp@ TT 0 0 r, ,Up0Sp\4+p4+=A- `(p 0,pЍ P ,O@P  PP 0pЍAp01Sd0 \ 0T2 0`p 0S ` F$P `H\4+H%fakC-q@1MS0`o1SP1SeV1 묁XV ЍCVS 1S  D1ЍCaV0p0S) S S  }pX t@ V(ЍC   apX   Wp X t` TT ЍCMVЍ\4+H%fhx& x4 0Q 000/ \4+H%G-AJM1MSp =Ya`0 Po c4F0 0 F[pp 0 S JލЍ;X P0oA7J.H0 0G1$HL  $`000P Ppp Ls0S8l1!0  \4+ =A-XQp1`S1S@1SFV1 1SV AV1S A 0`VS D@d0S VA0  p1S XQ 1S< AkV\4+H%fhx& ,1$A-a0 MSP@ r.0 014@:@#TRT 1S-  IR:1t| Y00 ! \ Xz@0(3p0wG, AU,U|pG y, U, U뀀pG  y, U , UpG  y, U,t UpG  \y,P wU ,@ sUpG  ,y, jU, fUpG  x,]U,YUpG  x,PU,LUpG  x,CU,p?UpG  dx,L6U,<2UpG 0x,)U,%UpGX 0 ',U,U 'PHwQ J( G YX'0Q00S? 0YS; XQ;X PD0h4EH01HpL001`00pD0 pMpL0X10@s{Xp&4 0#Q0X00Cs 1SL`X0@s#YG4 0BrYPE pW.-x ,?/4 pS u,T,갠Z 0 R(0 R pP th 0 0 0P3A7/%00D0 Jލ ЍY@ 䄟 RH 1 H0pH0S# 0 0 @3SH  P8p$W"RZ 0 00@0P0@3A4/`4IpY 0 0 @3S 1R 0) 403001dP  0*p 0040 [*Y h0 S P40Sr0 00   $ $  0`p`08哫*0S P   B ( P R0X0,( 0P$0 ,( g$0H0pp p0p@  !H0pp p0p/;㨀H0 H0ppmh0 Sp HpP  H0p"W 0 0H0pH0pp Hup0pH@P0P +p ppH0^p 0H ep4+%a%\4+ ,$8+ ,<JM\q7+H%O-`qMܿ=P`CX@P U#*0T?SD00SP.0p0x809p R  `1`SH~P`  f00 14Pf0 ,&@P+C-RP`tM  4ş4@ !Q RP ğE R`S qV0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ LH[ 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+EG`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 800,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =&&,,, ,h+OPA-@@P@T - @P`p0Sdۆ \0 T@ FP ,04 0J 0@Ak%h+v, ,zA-@P@p0S0P0`x0 R `Z R0T @ 0S 4 P@` ,xm+i+%8 , P@-, 0 G,P@-, 0 ;,P@-, 0 /,P@- , 0 0 ,h+\ ,P@- , 0 0 ,h+ ,P@- q, 0 0 ,h+ ,p@-PAM C0@ 000 0S0! 9P7 0S40l=PP0 0T00aS` 0`0S 0`T0 0 0@0S0@T@ @0 Q000S0&'AލpP, H0 P @0  9PO:$,5,,,DO-1M MP+ p4 1ݍ ЍPX$9P @@4@@/ ,P_ 40S d_P 4pPV / 3Ps垏0S30S 3Y30S7 0a@P0 |30 0l3 0# T30S0%Q03@OoB0B&Q 30S  2` 0dP0002`P0 0R " R `2 T" R E@P L2\"00<2 0H (20S%W 2@OoB0A% Qo10Sk 1pP0001p^, CX 0PA0S0,`V 咟Q 10S 00S2 0@P- 0! 0 000| 00S% Q0@OoB0`@b%Qx00S  `0 0P00080`,[+ h=+h+h+i+,,$,i+h+,G-JMMPp 70@ 000 0S! M8P+ 0S(0;PP# T0  1 1 R0 0S0QW`5 p1 0Sd1dYP* H1 @JލЍP @ ! 8PJW#P0ʡ X0S t@$00 R000S00 'l0P0<4qp P0ST00@DD,,, ,h+,O8, 0 0 0 0Y8, 0 0 0 0O8,C-KM MP* 2 Kލ ЍP"7P @`2`R@\2000/SP 82 0S@(2ⶃ- P0 Qo` 0S 10S 1 1 2@P x-p1@d10S x4PT1 0pP 818!00,1 00S P- 0 0 0.>?0T p orG&t0h@Q00S x0p0OP0 00P0pHy,+8, ,h+ h=+h+h+,,,,i+h+A-PAM N) 0 $P`P0 0ꌀp @G Bx @0 0\0@@H;@C0+|6PAލ0S 0 pP,h+8,P0@/,P@- )0$ 00 P0,0h+Pp@-o@P P `hbP X]P (pU ,0Q0  C0 &p),h+T0@- 0\h+,P@-( $0 00S/0凂,i+h+f0@- 0m+,Pp@-0o @PP0B 0S 0 ]0S P (0 0pP@tP<P B4P(00 ,,,,h+8i+i+,)0@- [ 0i+,0@- Q 0m+,@-(@(0 F 00S 0 i+,,,0@- 6 0)i+,P00P0SA- $(0 !0ЍPAaq0S000+0S 0S1ځ000PPsP00kP ,A97`0H 0QD084+ , i+hm+h+A),p?+h+:x0@- 0i+,0@- 0i+,P00P0Sp@- '0 0pP`P@P# 0P n30P xl00?o2`SP@8 8 <00S000,h+),xm+tm+P00P0@-S j' 0 ЍP  4P 0vPd00}S`00S T0T0HdP 40 0, 0( 0,i+h+ 60 ,,,0p@-PP0000J8@Ppp d2p@(P p@'1@0@ 0S 0^00ـ,m+>h+,OhP00P0@-S & L0 ЍP 4 4P 0 P 0,O0 ,0@-M P& D1 Ѝ0P0! c4P @1@y*P0 /@Pg*0@0 S 0 00S P |P `@l0 Q\00S  L0P 0gP000$0P,+ h=+0 ,h+i+@-Pr& 0 ЍP 0S t 3P 0S0TxP0@rP ,0 $ 3P,0 ,G-pQ@p`HoobpOP>10S|1ЍGT`pE8%& P1 Ѝ@j5V@ 0 001"T9pX /(`P 0S NP 05|0@0 ? `T AOPppTT TV@T 7@P <P 0 ЍG ,h+, A- MP% 2 ЍPR0S"N3P 0 1CA6OP 00|S 6P xP 0|"O@p1l@C) XP#@HQo`010S 00CS 10S *) 0 0 S v 2P0 T.>00R   ]tp!"Ql00S  \0 00P0040@,D!+ h=+h+h+i+@-PPM M&%@p1@ۍ Ѝ(`7@PC@@%T( ,Ka@P@F/UP+>00S p~00CS0 U0000 t*  l0 20 b*FP(t@ۻ,-,xm+h+h+I00@-MP 0$ `1 Ѝ0P H!E200CS0,P@/0S0PPP P@L QT0S0 @ʴ0|@P @PL QU x0xB~T0S 0H @zL sQ (0 1,,pyh+h+0p@-p@P0 p@K$\0\`0XPS 0S/0S0p@ ~ $00p,,,h+0p@-`@P0 p@%$L`LP0S.0Sp@(} c00p,,h+hP00P0@-S $ 0 ЍP | 1P 0h PL00}SH00S <0<}00P 0,i+h+F0 ,P00P0@-S # 0 ЍP  T1P 0l@PL00}SH00S <0 v}0,P 0,Li+h+0 ,p@-MP`+ $=@T \P.+ <0ES+ <@ 0 ۍpk0 ,@-Ph# <0 ЍP $ 0P  ,@-PM# <0 ЍP $ 0P  ,@-P2# p0 ЍP 0S L 0P 0S0,8  0P,OPp@- # <0 p00@PP0 Pp,i+0@Sp@-" @0 p04@PP,0Pp ,i+Pp@-" @0 p04@PP,0 Pp,i+oQP@- " $0 00S@+,h+oQP@- " D0 <@0S k0S ,h+@-0@-P000P0S z" L0 ЍP@ 4h@P@$~J wO,p@- M PZ" 1 ЍpP! /P 0"p`1`|0S@1D0 0S 1(EP%P0 0S 0@T 0{%`F@P #J d@ 60@ ;0 @ 0@3/H0T 00S00%,!h+)>Ql>+@ h+j+z(,0@- 0},,0@- 0m+,PA-PPPPU㈀ !00P@lph0hP{00`0 @00C;T,0P A9;,,h+,,7@-PA 0P00`{00 Ѝ0P!0P%0S0P 00@0@0S 0 S  @@@00+T:0 S +<: 0 .P,,h+h+h+, ,P@-00?o2 P C!0 0@0P 0P pP 0H@XR0 L< B S00Yl0 i+,),i+h+000 0@-S0 00 i+Li+,Ti+000 0@-S0 00 i+ Pi+,Xi+p@-@Pp@0@- 0$,,0@- 0) ,,PG-uR@`p]P\T- ,PPgT`( ,@P`_k$g$V; W P10S- D1D!@1B0S 0(`PKV1P1@W 00S 0 0B0S  +$ ($t0Pp0@PPlP XP HP V Ѝi+h+,Di+Hi+|F`X-|0P 070hph`h@Р0000 0@0C ,O,,8,i+Pp@- 0 0p`@PcP |@]P XP@)p @ @000 ( 0@,lm+m+h+A-p`P@Pd0 A\ P 00-4 0 RU Ah+i+@- PP   R Ѝ@P  HR  @0S00 Ѝ@`p,H%h+0A-p`P0 AoP@PLp @AP l00 00,h+Pp@-O H0 p@00Sp@000w0$@$P0YPp, ,h+i+!0@Sp@-/ d0 p\00Sp@L0Lv0@@PP806Pp 1, ,h+&i+L @Rp@- l0 pd Rp@T0Tv H@P0P8  Pp , ,h+`i+O-MMPPQ  3 ٍЍPʴ#EEf*P c@3pY 3   ;FP`@)LF60p㓄( @0S (30@ @c0S000p`J2\v2`0S@$S \S0@0# 0!|"  0  @#"00B   BR 0 F )b50 qD`0S@iR0@S 0 F)b50]D`P1v d1 0S x10SL1h`10S ,0u00CS0.  E 50 03/00S 0S 000CS0 S0  )t5z00000h0 Y 0pS7 ,g+n+h+r+&h+h+i+h+h+@-@P پ00P Ӿ00P;00 -d0lM _T00S ID 0d P,00ppxh+h+h+p@+-lM@P00S I@ 0d P(00ppY h+h+p@+A-@P p0 0Cs0S13C `?P@ 0 B RQ@  0 0Cs0S13p@-`@P:9P , 0S!PR x,p@l|,}*`~(P %9P00 0l,+S!0R  p@-@P 00PU C HPp 00p@-`Pp@0P< 0.0Sp h0 S Ѝ00S 0C @pP2m+P/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Br&G-pP(P SR@ ?PP0    ?PN0 0010S / 9Pe )`@9P 0PS $2` P):`8P P)P :8PP000S`UK ⤓0S 00S1 @RđR0 d T>P0 0 U g)d)a) 0 011 ڔ0Ѝ @P/) `3 0S000@) 0S S St0 0S 0`S@.)H0PU %),P,S[pm+zbjh++h+) - BR0 R  P R O-@M M tPE$@8>P0DHLP0(,$04D (0p0,0DHL` 0 0S 0S X 0SR@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;dI@P dֽP TѽP D̽P8& (!000S V PU@ /=IV@0S  2P @0U0C?o20S b4pWp 00C00p0Tp pW H=3pPpUP 0S 230P00 $ 0R 0;001GE+ 2Z0<03 0 048s)3 x30S7tZ   (@q70P0 $3@@(:d70P@ 0 @ (0`0 @h0 `0PPx P00@sPS 'P Y0@ 0'T00SPeU 0S} W +X2+X1+X1XP+ 20!0 4Pp80L YA+ P01E>0000JP1@@DcT@@/60P  00+L 01 08 04@ 0R 0S00}Sr0S @0S 0S@0P/HP0Y8<00 @[*i+h+pm+i+0 ,I,i+i+MT,Ax&D(i+O-kMMP|dUZύLHD`\X1 !0P`0C6xQ0 B?(p8 DA'XH&La\&PQ尡V?Ⱑ0E?oT20S`dQ 0S PVV 0S#UU?0SxP|0s0s0s0s0S0s z&X?0S0 /ZGP&&?0S 00SU  0n 0 /x=0S !~P' Uu8MD-6>O00(0SO !N(P$/>N0 0 (00 6;Q 4t=0S2@=P R( (@@-0 Rg@l}@P@<0^ 00|SZ >\0-0S;0J\0QK\ < < $: k,L0p;`0S00X  UL k ;/ 0S 00S 0P 0S} %>o`а)pPp 0S :F0PU>Y :I;pPX |p0SU 0S_ d+0 00 P#P %4P  0ix!C_/0t1p1l10E?[/ p x10l1S 0S tAT# 0S i?P d [V K l0厏l00S 00S P p_%tQ:Qύ[000D!, H!i8 P!0R PP000 C880,10i/10R`P VAD08 ,@峐PP0S8 , 媐XRU`P@Tv  p 0q_0pP7/GPX80S PPq/Ŭ@|'B/ l>/00S @Pq?/70S00?o 2h#PP0 P60S P 1S$ P 1S$6vF V>P@3 )d.\60T6sP `00@T b= [BP Q00@T S= LBP B00PP RN`UEP< 'r(P<50S2P@T4dL! S&QQ L&R H&pSn `40 WE:e0 0- 4Dpun 1& U0@05 )4@T Q?10/N,0 @ L!&Vv40SlS`V : PY= 0 %0!%p0S0A%W%1p@00S`a\ST0EP@0S 30S 3 ,@@ %V P30S 3 @ %T ,BL%.&pav 20S $3(n`tR0D0`0#@ D0DIP> 2pPP`@(PPi h0< R 1000@ q#@pP`萟(@b>0@h0|! D0P A@ pP `(@@0S Pp@(PP-ࠝZ  0h0rPc ⥎h1Q00S p@+,i+0,<hx&` tA+ ,x`i+H6)i+n+q++h+h+DX m+lm+|m+lq8&& aB1bui+-, W m+/Qd,, PG 0*S0 1Q<0-S8 %QP00P0,0 /R( *R0 0Q@(0000S!0 016gP 0, yd0L@dyP 020Sy3P r"` P `P t2m Pn܍000P }P P  B"qoP<0S S WO D<0K/CR032 V 0S|"0 0 յW5V6ZD Z8 ,p#2Sm#<3Q0SQ?0@0!3 (SQV3 T`Hᛵᘵ0SH40A {u00P 00S0xsl4 r|00 P 00S& 50S004 .l(0st4( @ 0QP `th0S050o5|2S % R 5 P 65P P P EP! 55`0Əs 00@T@ @V  $P|ҌW@0 0 0 2 @R J@0"0C?o2? C@"0 "0Ac0 S ;S0 VLe;P 0 R RT L0SD0S00?d'"0 40< R /$ $ T á @"͡<἗<P p"HRL á0 #PPW#Pp0S0S}H80SH#@P p哨T(`000 R0PT0% 0 pww0XppX0 Xp3pp t?tP #P U 0 |pWH90S @90SD9pd;@`;t |; R0 ;Q;<+0 0 S |H D@<"0S,<< 0R.QVB`E^0S y000S r000S k000S d00kލЍ0S 03/0S R00@-P @4P  4P0P < Ѝp ⾅`P G A4P 0 FUh<P  Ѝ@` 0S S0S   40PPSb[00@-Mh 00P P10S 0S00 0 Ѝ0  @T0 S 00S 0s 0 :d.P 0B0P R  0 o@ T d;9P 0|S ᱲ00 0S00 0000m+h+ T p@+pm+(i+A-` M@p )000@00P70P/S:S X7@}P ) <(p$ ((/@Z?@P/:U?pP $@[P W Ѝ@/000p0 @@PW@p00l0@@DcT@@v0"0@0CcS1S@>*C,PP00/@-b= (0@  000W=@h+B+@-Q= p0@ `00S T0 0Lpp<0000S 4=@h+h+h+HB+@-+=@w\00S P0 0Hpp8 10 10S =@h+h+HB+ d0@- TT00S H0 0@ppt00 101000h+h+h+HB++ -X0lM@ 0d @(80 00ssO  h+Jh+C+@-0lM@0 0 00 0rS sS ld d'd X'P0 00ss,`d $h++B+0,vh+C+@-PP`@ @0@ss00V 0ss0000@? bP UV 0A0T0Ѝp00CS0 Sp0 S 0 /O-TMxp|W00ʿ? p00p 00D<0P`0V0W B@!0 @040SD H 8PZ0S= S D0 S00 岿@P(<0S <0#S <|0pS `1 R R 0Ha# -;tp uTЍ ? 000 $@0 YPP;0S ;0#S@DT|0S ld@"\-$0V 0 `{#N"00 "@B0i+h+O-PBM MdEdP$P QL?0a>0 PPP0p`5(p 5 P<$ P@+40S5V $ 0D  g-0XD S00H00S+(& 0S 0 S     R  T!$PP$p 0 94-@P$p 0tp9# ap{0tSS 00   |00Bލ Ѝ@H3@a 30S VW@@cA ,2 0Z WW T 20S 5V  R x" R " R W WSh2h <202fW @2000 !00D1#0U10S CdPRPU [ 1000P T)T0 0P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V 0    0QR\@\0 RZ P :/ 10 YS P 9/0F3B+̊ d ,m+n+i+m+h+n+n+m+H(, , &\i+-A-` @T 嫆 0 ЍAЍ/0p0$ P Txe , h0h I5oa0@S P 5/an+,B+̊ 2m+5O-@FMs M` ( @8 8 80$0h30(0$ 0H,@iH0P S9寰0  G 3 Fލ Ѝ0H0 @,Q($2@@в@aGT  ) 2 "H 0 PD0P2d c=P h"hd$ T$0S 00S 4 00d ~ rPP d8@0S00?o2 P% m80@6G6 D01@8p  l 81 D0(66S0d00 0d0A0aPS 0⪅P P 00S x0 0|0lP@0H x@00,X@۽0=H+`i+:, ,i+Sh+UgH+n+n+0O-FJMMsn0pܖVXv600S00p  9ĽP勡X l6  d60 9岽P<yJލЍ(60 0 00⁽97S 50SZ5d5य़0S# Ե0S5 Q U 5R "P 0S 500CSL5lc00\=0S P97S( 544(%(^0SX0$000(00000 PI 40000Z40܀C XSX @4`0(  $   TD CP 3<!>\ 0h0$<` ((0d $r 0( 3?$r / &<7R |3a0 R0S R3(0s0?008'pP30SC97S00000 宼0S   0⤼p加养008'┼PL2 0 00 00I∼ 0 k6 劼p\ 087P<\ 97R] Sȁ 0S [Q0sN0010S ;70:70?70>7='<CL0S ,0< t1, /;P!1 R  < 0 !0ZP 0S 0097S|0 >0S [[X  S\00000IRB+ i+$i+m+H+ tm+i+h+iLi+h+Ti+xm+i+4,=dn+9<D+GH+U @-2Bp`WLM LЍ@ 㭺pP=  妺p7 0001ڻ1 0S<0 ?!tq(ͻ(00 Q 00SZ=9Q ='/?@#b!"/@p 60S 60#S }P7s00+0(60 8kpp 60S 60#S Y pKp 90S0 00 0 0_LЍ i+$i+m+Mb 4 B+W 0A-H`D0 82Vp  R`RBR RB`2b  Q  ,!00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41  000d4@T X40S@ H40S@@840STPx40S4Oi`m 3 3K Z` Ѝp30SCP RPHd& \3 4LS P@04000 3 )bQ nP@$R000 0R0 0兿|PP  HP L;@P  0 2$@/2P0 S R0S S @T% 1Ao0S3 1o10S x1 P5D10S  ,P01S 0 0S PU P 0S 0S T01SQl府 $0 H , , , , ,h+h+,B+R  8,X ` C+t h+m+n+Z  A-M  @P0 8 4 t(t@@Ph(h@d( $ T( RS D8Q  Ѝ 00-S0S 8 墾7 ✾770SN0<00@0D07 0QPPGEG@Wn .PZx7,0<7P3D6PPL7`@0 0wK.P [.P6Qx AQ ,0 p,0000()Qq   0S 6 @0szD0s{xFP00<0Su40Sy6$ 0 0  n 00|S  0fpD,,0SΛ5P5<0f ,,0S    5P<0,0p,0PX0: S 5 L4 i0 0,0͌D4Q PU>0 00S,  P 4 440S!@@\4@@0Sh4@s `TPl@40S 4'040 4 (h 41S $ R 4P I3P P P CcD0s D30SP 30S 30S2P30S&Br,0p` VvU㨂c 48 pcU|,00@ S200 0400@ I280030CS,0"p,040q402P001!P X<0S <0,3/0,0@44@m1 R0P20 SBT1##0 ? 0!$$P400@0 0 0 48 p 400@0 0 0 o$P0 fw0#a僚@#D ,0S <0,3/4/8i+0i+ @,0,i+i+h+h+  , ,C+m+ Hx&8, ,$i+` i Z 0 , xb+m+,, Di+( @-GM , 0 0@_$(000E@P˟_. +,0@@P40L0;K@;0 0;00,oDD0S>;0SV 080< @ t+ RD00S0X H0PLKNH<41<S$$x,P $00|S $µP/$2@210SR .10 SN $ ): 01RS 41S $00-S0S |: xd:$ dD0S $ GߍQ0S : <0s^@0s_JP0080SY00S]9 9 h9T00$0S  T$ YT/00Ph90S 00 S$P$00 S$P$ 90SD8Q0SP]PP?D0S!0S' Z+80S F(P  8d(880sS3<8  08Pw00S  -PlGfS000S|P 7 H7 R0WAT41SWn$~+P_x74!(07 6 (0p(0Qp 0: S 0&0&071S ' R 6P Ӥ6P P P F60SP $60S 60S5PL60S 0CSWD0S8 46 4 (p(%Q*$塘$00|S =@$g((0S$ @54! 85 580$ Ժ((0S5$z_00\%p00(0q(0P5P001!SPL/0 SE480S 80(3/0(000L0S04 SDQ  40S 8 4R qp~ `a%'0$`x0嘳pr3X@$P年  0Xf P$D0S s0 0 @ 0(@3P`\ T0(0 00&PP sZ,pJ P @`@#!0 ? 0!%%P0 0 040  P@H0S@ (, pU@000@ /400.0 SE1(00@N .,00(00@T!000t 04Mp@ TL0Da0L0 TUA @(, cp%P1 O1#JXl@PbL ⠹fZ00S 0=<@ (0S 80(3/08i+H0,0i+@,i+i+h+m+C+m+ x i+h+  ,$i+v t  ,D  ,  ,8,` Z hx&xb+m+,, ` i #/+"+ 0"%+?;#;0@#5;DE "/0@S(PY $2@V0TQ@2QML"0 P EP A  Ak{H{7{j4"dZ` f 0"`< < zLfp 0#0 @0S  P0S S dh#Ѵ@p#d̴0 S30ppPKߍ%U[0DEX@-*T0@ R0 @00S 40 0,pp4*@0i+h+h+-$M?0 0 $Ѝ0-4M 00 000|*P4ЍO--pMM(E|Up " pg4 0 P0 PU0( RPU4d" R 0*Pğ^ $0S 0sX0S (P 40c,40S` $1(` $S 06 J{ A0( A{{zdWdp0f0# 3`3Q-AP #AQڗ`3`#sA0 f2 ` 0 ß R#3SPS0r 1D0000fm/г0`  $P(0 0SZP=9 =:k{U@2 AP09 A { QI 5 P;!%#3[QP qD d 0@ f0 !右1`P0Ft1p Rf P 1*|!3^2?^01g)0T!P0mH1 000ss00S"%+0!gU6 C`0Sf ;`|0 0pp¬MߍY@.AP,0i+m+i+`,h 4,@,H,QH h+m++8,@~h<8!P P0  A A k{I{7{Z`0U~&0P  p{P<<`sg0  ޲`  ز@-(@V(@p@-Bd00` pd00CS00p ,P P00 @R0S"P7d`Qd00CS0*p "P \Pd00CS0tp000S8A PA p0 0 `Vup0 c`Pd00CS0Hp 0@S P,P \Pd00CS07p `V0 0 #Pp@x,D&fy,A-pp@`nP@ .PP d@P PE {P@OoB@x,O- U0mMS p8DPd '(0S ېmߍ0P.0͵1]4PPd(0P/S SUpE P\4PPP P,$0CS0 p, P P P0 PsdJ #P P #P d0ppެP 0? h7td5td2p P 0Sd0ppP0? tp P 0S0S di0 P P d00CS0?p`2`R P Q82<0 0 dAQ 0 p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\0p 0 p P`, ^0#S^0C0 hlsP\\ ai+x,+ ,bh+(Gv&r++h+n+@-0 @0SP  P  0 00@ x0 lϜP T0 LƜP 00 ,彜P 0 &!& ,+7<00CS0 Sp0 S0 p/1A-0aS0P0>P3U P 00.S Pl`1h[ \HT1P@  D(P00T,!,!,0 $1$ U 0!:0@p000 00000P0 0p0S000P0T h0h0 @U t0D!P$0`Qxm+i+AFn+n+h+Khh+m , ,s , ,z ,\i+ p@-@P n0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0pn+h+ , ,,pm+$i+Ti+Xi+h+n+ H0@- 800S ,0 0$pp4uh+h+h+m+A-@%Qp0S `0S ppm00`PcI0000 0S p`0S ppO000080xT  n%ph+n+$i+(,O-`"BM |2MR0pB  h" R S4 P 04 SP 4SPP004BލЍ$Rg1+ sB>4P/S + :+ 6 P ܍רpVp刑0儁00g00000000 0S P1o@19 k70@ R 100CcSppW00 0S 0of000 000 ө$RVMq@TqPPDT{ P00+i+,h+dm+*i+,,i+h+,n+TUA-Q0qS0`00@S Q`Ѝ0PYP P p0 R 0000@ Pl00}S0s00T 0S$@,O xm+i+ ,h+vn+&,O-a0AS04M00qSP Q 1O4ЍPH P0.0t~P00`P$ PHTP@1(,!2 (A 1 0  ? @, "P 0 @ P 0$0婪qp00P0}S0s00U 0S(@<ZO Ixm+i+ ,,h+n+n++C@-,@02$ ʗPM,A-`Pdp㼙 @P  @P 9@㨙@-@P, 0A- 0p0@S0`P0LP㬀" P 0S 0"S x0S R00`P"S0"S0 00,xm+i+,,n+0@-M M P  @Pۍ Ѝ0NPh4/S @ XP;0@TP/PO-@pP`V1@@P`3:`E0P԰0Y/  0T@1PSZ 0 10S 0`N0 R K0S*00 0>0 ЍH,h+@-"L0@0 <pppP0 0SP0 0"@Ѝh+ht@H,P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0CDi+ @ S'*000GS0P#0!h+u ,,t,,/A-p`P @mP0  T  `00T  0@ R   `FVp`00CS0 X PpTD000`000 T00wx&G-̀P`t@0崠T&Lp ⟫ 00@)ax0@P 0⎫D00< P 0 Ѝ+?h+x&h+h+O-M M@ P" 0<`0  <3P`\ 2$P # \    30S) P Q PUP  pP 0@00002F. $P |"|F| > F@lލ Ѝ pp08\  ӣp \و020(PS @ (0, 0/(0, ἣpQ 0$S,F␡0I00S 0h$Q000SZ=9Q =*/?@#b!"/E |p50S 0#S [0AS  \0 0 PE0 P0⒤p 0S 0 0 ^psP0\ {A|P<00m+2m+Mbgp@-@P<p@U)p@-@`00CS0EpP0 @ z0S0`00r0#S V l00p0 PA-p@`pP0 @ S0S0`00K0#S V E00A-@XP`poP  jP0S @-@ᆑP L@-5hPD@-@Mhp :P@-,dP-!G0A-PhMQ@00 00 T  40S P 00 P 0 0 0 PtCcXY 3c0S |@y@@p      P \phP@ 0S ;@P@ Q J R P@F ?T0S @P@p4 -0SIHj0 S9 ,\0P 00YP12 qCAM 1 PP 00 @T   P 0 0@T  P hЍT"[8P@ T 11@T 0P 0`V<PP)< &000V0 0 0P@T{Q DPpm+q{m+h+ i+x&,,h+h++n++h+h+,,7@-Pj 1 Ѝ0Q0S 1 1媨P !0 CRxA R Sh10R P1P 0S4S,1 0P 0S 10S 0 0s@@P 0 @0@0 @0 $@0 )@ 0 00S 0S,h+ ,h+ i+h+hm+h+i+7Q , , , ,| ,\ ,X , , ,8 ,4 ,i+00S%@-@0M,  0[P0S8i@0Ѝ0@i+|-A- @-@0S S S 0 \R0 R \ @ RC-P@ M?  ? p ? p` @ƢQT@D0 @ЍC2s0 ,嶢@T*Qs00!&ADG-AMMP`PxB  d2d `2 ÛT2 Pܛ 0 04Ry 0 0 ϛ 0R  0 S!`Pp@D✡0S1  孛1 0S00SR&@@T  zT @n2<1<1s0S 㹀 P0\!n 1 bx噛AލЍmP0 SS  S00<1s0S p 0圠0CZ 9Z <-2 0 @#,&,M%,%,0&,t!,%,$, Sp &b|",%,O0@-EM,P 'P@P2Eߍ0 ,PU > < '7 x0 <  ⎳TP! 1[y p &O-``3MP@ pHHʚD`4#(3 $ښUPE Pb00CS0%p00 R0SdP1s0S6 P#hP2x2l1s0S  ⩚;Q0 PpP1 Ps0S  P pC PXS,1s0S 7 P 0 S 1s0S <1s0S 'l1s0S 0x0H`1 e P1- R @618 U 11s0S WpG'xP`'@<1s0S0  ЍS R   RVP0 Uq 0QDD%,&,M %,%,0&,p &#,O&,t!,%,|",bp@-BM,\@P3L1 Dۙ$!1 PP0`0<1s0S  P00 嶙 Bߍp ~@`CUPp0壚KJ<` y%,M%,%,0&,p & %,|",#, p@-BM5,h<@P3X1 Pq0!n(1 $候KPPU0`1<1s0S ~ P0B0 L O^[Bߍp ~@`ٱUP|@96B?<᝝y%,M%,%,0&,p & %,|",#, 0@-@hP4M TP 0P,,<<0   4Ѝ0#," |",0@-@DP4M 0 0P88 04Ѝ0#," @-M, ,PF A P 0 001 Ř1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍% p &%,, " . %,@-(@ $D @#,{t zt @-@.T㓘@!p@-@PPptP p0@-AAM M^PAލ Ѝ0PEZPa}b/0 ⮞TPPh1LA`1T@pn巘jh00$!0љu ^}YWS+1@L ⮰U 0S S 000 ?T<}   T xdnl  10D0 S B/o" R  0Cp &2 >R %,x&W f k { $,@-MP Ppmp pl@PL\܍@菞, H}P 0܍,0 < 1&, &, p &p@-P McP'@e?o2P0S ۍp@.P55-` `媗PPPۍp@QD` 5  ۍp1&, $,   p@-pP!P h(@PpT[P]8p@*0P L}l1s0Sp0p@ &,p &#,p@-P MP+P/o"P R0 ۍp@(.Sp`ẞ@P\ۍp@P l! r R< < 5初 ,=ۍp1&,!$,!  p &'!/!L!@-  ?〛x&"O-P4M$`4~`=@PȔtȴ`0 `4$$p0Z$ dQ Y  Q|x$0l P0\$\40X4L@4( 0$&!PS pP tU Ut @DOo0B#10<13 B0lS010S P  4 Rpp}> tS`S FS4 9S/S0Su(#a0CS00 yES2 PPS2PPu  PZ xPP[ W|2 @| P[  d PW  @PD D(2!00=2 1 0 060S1/ P* T,%,00!0 0 㐡x0,P 咮 D1 U hUP0 0  0 00C6&`@@@P 0 T0@0?o2/iPk0SPP54Ѝ&,,&,|$,P ,&`&q&%,&&%,%,#,$@ &X ,&&hx&%%%p &%,&x& #"P-%%%%%%& &A&&@-d ,@-@M h \0P0 0D0@10S  10S0S@Ѝ⻭P  h00S0@\Pz 0 00S㔖0S 00)P0P@0 S090B ,ؖM7 d ,%,#,#,-' t A-U`V7P@l @Ptpe 0Ph% /Q4 w LvypP@uDN8e0S+ (5  5@5 5 5 R- +4 400000@T ,P004@Ѝ0400/S@P w w w IP]H]@ 0SyQt0S zp=0#zp;#s00S: `w`P`|` R  V \3Q 30S t5: hEwPX3c0S 2Q P - o2: @*wP 2 : "wP 2l!: wP 2 : wP 2 : wP t2!: wP T2h,!: vP 42L<r> 0H4Ѝ0p!,p &@-`0S@ 5P0S 0000q20\ @awp!,((s@-0Pl00@0p`h R R  l R  T8Ҙ03/@ЍpQ Pp &&p!,(A-$q`AQT 0SP Ƕ@ P0000 0P  P0 ~ P0 tw P  dd1\,0H@H  "  \ p &p!,((((((x&D&#,,0@-1s0S 0P  p &&,(0@- 兑@0 坑%,0&,%,p@-`BM P⒑@0 S0`01s0ST01y0 0Pn00x0 VBߍpB/ BR 0i00P By0001%,p &)&,%, 0?o2 0/p &H-AM MF C ,r,? < 00000P0000@0 3Pڶ0 đ &P0SS WS BS 0 +P  KVdqo 0S -:10 S0Y` Ӑ1s0S ؠ0S Q     |P Y 0@^S00CS00 S00 P0S%,G #,0&,t!,p &&,p@-PH@P@pFP P ?P @p & 0/@-o/A-@PP p 00CS0 `V PPጁ8P0 P00XAA' 0S P0000 !0S0R 00 *)*A-A`P0E!S qph0!0P0CPSJ0 `00CS`0p S X0 X 0P"SP, 0SP`0P0CS`0p SX0 X ! –X!庖0 0P0 P 000P lP妖0"S0T0A&8囖0 0P0 p&,x&)hx&**#*+*@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 -*A-x@5P0 =`P`>PP2 00pPF 0P ,V @P  @0S@0SؼB&00@PP?P PPP P 0!SP8*&,+*p &<*C*p@-@MPP\1 { 噖@P`u00u0ۍp0 FP 0@ 0000S T忕   P00 f (WPp &Z*d*x$,f*p@-`@;PP 0 ",Up$~Pc@p<*7@-@P 岎z M R F B@T|o Ѝ0(R( d峎0P_P O<ZP K(UP #,+f@xt yt +&,0@-@M@ 0(@,0 0 带@P  Ѝ00,^x0 {WPPPP0S g p00@SPU &,p &#,@- (,⛦,&,@-@ ҏ ̏}mP } 0P3P xth 宏 X } 塏:Ѝ#,xt yt 3,9,<,S,f@,p@-0M`5PPS 1<1s0S |帔xAx[ 0 9 0e} <ҍ4S,Q( ʍ,0F R 忍 廍<P 81P` >}0(0S r=Rv 00FS0 xmhkP0Ѝp\XTP D[p &,#,hx&,,,,&,,+,,,,,,@-0 q@7#,,-@-t-@-t0 R   ЍЍ/(,-@-V0 R   ЍЍ/(,A-ARp`P@1T 6pP!9`@DO-dM@P|0P 0X|0P0 0 W880 0(P400Pp`,@@0,@ T R3 U&T  (0 (d(0p ` Z0 000_o 0,@ @,@0RT ZPPU  w 4 JR  (0 R 0S0c} } 0S dЍU 3 ` 0@D(0,@@F00(0 RR 0;0@D(0,@(0 R0@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q  p >W :80!(*PP (>+ R  8 %Q  R P`(1cplh`8@Ht  E  $P $0`000S(1( 08 40TU (0 Q@D0T,@(0UT(0 Qt0(00@DS,@T'-5-J--e--(,-------.'.?.`.x....O-lM($z`zPVpp78@ 00Roυ p  0<0`2 @@000p 00B@P r.@P EpP@0S($+P @ || [lЍH<`@40S( (t Pl  , Dp, 0P¯4 0=P$0=P<  B,$( p( ,0RQ @(S<`@ 0cBP%<0%8s00%4s00u0 0'<0'8s00'4s0P 0w0u $P@'- &/ /////C-阑p0MS@0P x!`0` 006qp@  ?sp$k@`0 P 圑00: pppppW0@ @ ]@Op`6t0` }>?@h@ 00 S @.  C8 ЍC^0 &@/s///hx&A-MpP`ЍA{0@: SPPT@Sy`P00S 0 00iQTP1 rp P PU0DsLS<(    //(,///O-0]M-SP MPP50S ]ލ ЍOv/f]ލ Ѝ@p ᑋP$ 00S0W0S 0SE` xpP  |@pt0* R\ D RP PP,su `oP  d0v: S+ p 3 P@`pP|3Qz  KɉP pd ` 0 0LF0 00 0S0S`- 安P` `㿉v `0S 0 @ᧉP |V ៉P `z{ R Ҋ8MRK rpP Z P w!1Z[  0s ᰊ.ᭊYRp`l: 0S'HQv00 0l!协 P: b  0S- 1pP  W ]ލ ЍO6zP-B3 0S.pP P : R S00 R0S PPdST}(, &//00#0O0J-10 ]0r00000"1'1x&C1L10 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@ `P 3FP00S D00S  40 -F!NNgX0(,d,5,!&@-tH2@-lxPp@-P@xp 000/(,p@-@P0-S@@p kGP0Tpp0p@-0@S`@MP0@ 塎 P@ЍpPU P[ 0P0 &(,22@-@P @[%00S@H (,p@-@PPp00Spp@ (,A- `pP@P000 PP0 022@-@P P0P00S@ (,p@-``MPU= 0S: mKP1 @@?T.  , `00@ C @ F00 *S ?0`? XP10EE>JP `Ѝp2ć 0@-p098p QP@@qp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@5,r,@-P X00S S 9(,0 @ T 5,p0@-@TI0 zqp0@ @}01p5,r,p0@-^ 9 @ 0@&)60 P@ ^@T5,0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/5,P0001S0 0/ &7@-P R I0 0#0 Ѝ00R 0@!"0@@qp Ѝ0@>?5,H50@- 00qp Ѝ80098<@ q|/ 00\ /5,A-p`s PP"@9  @0@  P09   N 09 r`A|(,5,@@A-p`VY@  @ @ 0 pP0 0y0 T 0 0o0@A 5,|(,0P /5,\ -P0S0@  / P2:1S0BS /C-@,QM@`@|0S1U?:ЍbS7 .S6 00C S 0  ?NP k>cS@U:`>0@0CS000000C/  0?NP @@@5,6,]5m5p@-@P 0S`PpPQ P@dPQVL">P0S  p P &4 &5A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SP@u0C?o25,@-XMJpL@DM@M<M8MTr,3,!4!!!8!!30S \0S 0S4x3.P 6P d3Pw0S CP T3Pgܢ0S(80S- 08E0SeVYP0SeVi0SM /Sr *S1 S S(P%UJU!$"0ES00 "6;P f0Z 0S :'0 c!707S iS U U[00E.U S``dP eP PP0S`>0S P0 HP zP >P 00`P iV\0iS 0 %* 0SZP0@T_U0 ,0S U U =U Y\ P?,(,t(,r,4(,,e,l@,^=;|=?,>==@(,=d,T& &><=d,d,d,=|d, =8e,ld,X&==<=>L(,C>P>_>T=<p>>d,>>|(,<\=>>><(,>d&<>t@,d,(,A,(e,+U@  U !UQ0-UQ00  \@0#0P2 PR 0 a0CS00 0-P  00P= 0Sa0@S @P000S. ,YP& 0e`0,0^0@0S 0! P,P 0S_-P *a0ES000 *P *0 /E: 0*U @U !U<30S 97R0 <430S07S ;07S 00#p#v.10@S0 @007S9  P 0S S30S PP d0Sv7 40S] 3#0CSPwd ;P $0FcS00 0 e`!0 S $0!R0)?040S  /0 S 4%0!R0)?0 ^!R00 !ı50S!R0 !R0 0!ı{ x 5r 6!R00 !ıf(60S!R0!R0 0!ıT !R0s)?0H60S 60S >`@0 S 0/70S y0 S 0  6!(gR00 !00E 0R eSd0C0<0S d 0!0<0<pP0hiP0b`Q 0!(8 S^Pf3IcG\80S0Se=H @ \8 D 8 H 8 pP- Q,9000!R0 0!ıX900d90 00!R0 0!ı 0< `0000!R0 0!ır ` `<0P 0P0 0!ıP *P m P !R0p;p; 0 >P }0P0 0!ıPs !R0;; 0i0P0 0!ı=`P \ PPXC=qpT 4< XP0P0 0!ı=`Pl A0P0 0!ıP 5 3?1<`P4)P #!0`0,`LPB(P 00,00  <=0=0S:P V_@H- 1 0 q)PP U U ?V]!P0> ^PP U U o!@0 NPP U U G!8>0S %L:PP U U.P$!0P.% (P0 0S .00S>0գ?00 ϠR0  B  ? 0 S /00S0?0գ?0/0 H 00 `? p?x?0S080k>00S/6,@-@0 S!0O-S`PpM`N`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0D80  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 l  80 [^P _ [0J0C6,O-pZX& RP f`P|` P [ ``F 0R@ 0R U *0@S0S  Pp>p@-`R P@ h\0P @@@ 0ppM-@p M@p00PCu RT0Ѝ` `?<P ?0 `P?p<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P# 0 d,(,t@,p@-P\dpHPV@^8^LP gP @P%C @@A@@T AT T ep00SCBp00SBCp0!@00CQ#b 0 DPp@{T ^gP 0S0^  PA0dP fP pipd,(,t@,@- @ @?, @-p@u+?,> @-p@h+?,?2G-pW|kPP{P0`kpЍK[@P 0pqpt\ Ukpk?SZ f\0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*p<(,?,,?p@-p@`PP ;O,;0XV@` `:D Op *p?,,? 0 ?, 0 ?,7@-dP@ PP 0S  P Ѝ0?,Po/@- * Ѝi?A-`QpP P P@P%U0P 0 P l @[T @P 6/P{[l?|??@-~|0p pl 0hP X 0D H 08 P0 0@|&t &? ? ???C-P1M0SL @10SH 410SF Pp` Ji0@?oPU20S@ _P[e@YXЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P jPE%U@@(,(,(,G-@`M0PSS00/ @ R S"\R" :R R DZ Pp 9P 0H3/0S@00Ѝ?P/@- p J' q)ZЍ00S @  d`)\0PT T F' 8Nqp @@pd,@D@f@O-@x`vPrPPPpᔠ唰0SWpV  S P0Fp@ U0 PPUP@ RpP SpP`&a&p@-@QP >0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`< PPp@pWp@/ 0@-M * srp@  , PP  000Ѝ0|(,H@,400S/@-$@P P@pd,|(,@-@P  |(,P/ @-p@&&0@-M@%hPh00S@(aP DP OP AP dP oPiᤣ|0t00SЍ0 oh0LP 00qp{h00@?(p(,@@ &AO-8M0S 0S p0@S T z P 4X ЍQ @o Pp 00s pPPP`dP\$ P  pPPP(d0S P``40SWPTPQ ((@'#PP3`00FP0`0 xP0`0 *P X ' X0 dgPy% 20SP `DP  @' YP gY |2 p` P2 O@2p<20WF,b(2P 0S P (hP11P %0S (y. 1X P P Ph1 \XP10S UX 410 (0 qp 000Sp 0 *P >= 0 R  [ R 0 0P: p X ,|(,x(,&A$ATAe,AH@,@X(,(,\f,td,D(,l(,UA(,A,=AX&d,r,L!&AP@- 0@|(,00@-P &@H@,AUAA-P`XpVVPU@JTWgP0r, 0 |(,@-yP@ @0 |(, 0 |(, 0 |(,p@-P@@P Pp@2pp@-@`P%PpVU p@ Pp PpA-@Q`Pp [mWiWUG-@@` PР @PUЍppP>W7BP 3W8p0ShЍG|(,@-T0@0S @y|(,0 R/%R %R0 sR0/p@-(PPp@P@p\@,AG-`dJd@p00CS0Pu U   0DIS  1 00  0 'P*Ѝ=ЍO <O-P@4M(0X0 ,0ut@5 P4Ѝ40ST400 ?Q?(~'@PPp,d00 0sp P6zX  ` ܳV0+4 jp` P P@Pᜣv V{! `FV@P,0S0 \3Z0 A'D30pW0= 0$} `P" R $0 S S`) P P  `VʏZ:~P `@T_A[ x20S  P0 O (0 S  $PQ20S 0 @ 1 R00 SA@ P Pd p 4ЍO V  P0 0PA R TA0  Pp``@P41`!Z 0 0@P_ V V@P P P P P@Put 0 0@P_}l00S V V0 0 0S t@P`0 `d,$A,5,r,A,d,d,d,$e,,e,7@-P@P ,0 R  000 Ѝ0A,O-`Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000Sd  RD = Z* P+Rz( PE0P*!H(P3% R R R000#=R00S 0=S#0E0P0 S0PS  P Y PdP P P 0Su p0P Q!&|@,q2&Zx&\^irw}+$ $0 RP  /@,0 14/@,0 Q/P/$&@-04 ,    00@1,81,H1,41,G-P㌐剀nG@jGPT`ppP HT H  !  H H @`匀@,A-8p@0PS` 0P0aP @,@-@$ 0 @z@,P 0 R   /d,p00S/p@-`@mPPPpP 0S8@pPp  e,@,@-@@ZP008SPl0 0m  i;D0&<&8&4&0&00蔃@,4A,@A,LA,XA,dA,P/0/@,0p@-@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00@,4A,@A,LA,XA,dA,C-餁P0@SpM`$p`xx!0 0 0S]0@ 0 / @P(a00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tPe,d,d,d,@, & &d,,0P$0 00S000/d,d,e,d,p@-H@P0S0000p01S 03&P@,4A,Pp@-`0 p@X10S P@@p(1@0PSP5pP/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@P 1CP 6,@,D1,<1,L1,01,O-`CM00dwvP1S0& 1S8 ^z 0A# RfY) Q 000 00P20S P wv  1PS  ps000ap1U 0S u 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[90 `0S$ Uz% 0R 0Q0tP 0C001萄 S vI  0@,d,A,e,(,4A,d,A-p00PS` HP ` P 80@0@D@ 0@0TЍe,@,(,p@-P@ 0p@2A-`p@@PGE$1S 0P $@@A,7@-8PPU p Ѝ0@@ @ Ѝ0e,0 (! ,!/@,0(! ,! /@,P 0@-P/@,P @-@P$0P/@,P @-0000/0@-S@ Q+ 0S \Q@AOoB@0Sp IQ S Q0 0I0S0000P舃p@-`@P 0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010vS00# pP0Dv0q# 0dc F# F#ox 1R P@#1 PR0(d0 d0 0  0U*P0C0#0D001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0cP 0S0C 0Y` 100P0C000jPPUF` 0Q 000 PQ_VP P0SPPA0SV_0Sh jPd  0 ЍG(_V` P V10S t! RS 0  m_PP %P P0 PPPP0  B01S0R4ABw@D pP@DT0CR0S*A8A@DvP  0 )0S pAe,@,@A,LA,4A,8A,@,ld,8e,6,hd,$&փA,CA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S a00S$1R0$aʈjPt` F F)00x$<0s0$10P0 0S $@,dd,8e,C,6,A,@-(@0S =Z00@,G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Ո0 0C0S Y10S0 0S L G5 EhY 0 0R  5x00S U d00SX00S D00SX    @,(,d,d,d,1, 1,e,<-0 R!  ^ !0@,04/@,0 R 00S P@0~0/0P 0/\!4 0 / B  0/@,d, 0 /@,qp/G-p`@P[pP 儐u U 0 > 0W 00V@00CSaP -P 0P8@P@,r,PG-P0P`oPpЀ@ 0@D P  V 000U00C0C0y Tʌ%P 0 BJ 0 Q@ @D 0@DSB@,r,G-p`P@0@@0W  S #R0C00C0Ѝ PP   A 0 ppGA-0PP@q1`EP q 0P 10@,G-1@l`Pp0XXqp00 R00STDP0pT@(,(,@,p@-@ppPJ P0S0@p SP$&@-p 0$&80P/ R/0 0S 0 /C,00 0S/$0$ R C,e,؃t@,A-X@ 0S0dS 0p(0,`P` p U` 0C,X0QH0H 0.4 00/ 0 0 D,C, T,A-P@T  ^#0pP4 044 R@0pW T 4` 0P ^@Q 0࠱`@ 0C,qpO-PP10SPU @PP0⼡p`@` V  RXWA 0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00  0` qp )@PPAp ` W0 0K0  0`qp @TPe,C,r,P0G-`p|PU0  SXW@ U W0S P)^P @P P`@V0 0 0 0@00qp0SP`4Ph`@W 00 0@00qp0SP`V@C,r,G-`P@\pတtu00V00S 0SP@`P@tu TUP(,G-@Pk0p`Ptt80@ p 00 0`Pqp080 C,r,800S/,00/PP//d,d,00CS0 Sp0 SU0 p/O-0P-SP ~ | z Aw ]PNpNPHN@P0S,Q@ 0S 0S%H@T ?>M+NM2sX ? =   0 ) ЍO;`P @@ @_ 0A $ S>$&(7:t@,.G-@P $`P( kpP[ `~   [@yz  0Z Pp@ ;p Tt p@l <  40 r pKik$&t@,C-`Gqp pXqp@@PPP.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   ],c,c,~.Pp@-9 $P" 'P= P !srp p^P 0 &- &P =06 pPtd0`@P\0 L0Af&P,@m_006p谄|(, ],(,c,G-@p`dP4T#0 5T Ta0'0s000Pp0 =@6T` P'0 ],@-o0@-MPh@P  " srЍ08!P m=0 00&|(, ],@-HP!sr@l 0! 0& ],@-d sr @@@60P&6 ==0606Ѝ ],|(,G-6@PP`j>T6k.sq 00P6 =06PU p =P0PPЁ  GP ],|(,d,@-P ,0 0R  |(,l0@-0`  ^ @^TSa04S '0s05S #|(, ],0@- @P0 QA6R 00 ],G-pP@P P.`P<`<p6W @ ],00S/A- M`pR@qpp6W @ Ѝ 0 PUP4P P0 Rd,ք ],ڄ܄@-  0mS Ѝ 0 Q0 @@P 0 S# > PPP0`0 S  Q0 R pV`PPp 6<p00(,17@-PU0P( P@ Px0 Ѝ0%00S@PP <PC;C Ѝ0@H00S< Ѝ0@ 0 0$0 <(,Dl(,f &z 0 p(,<07@- R P(0(@?@0 Ѝ002&(,@Bd,@-P M# @0.S 00S Ѝ 0S 00 00S000^ @ ` PP0@ 0R 00@0@$ꯅ02&Džd,ۅ<07@- R P(0(@?@-0 Ѝ0,2&(,@Bd,@-P M# @0.S x00S Ѝ 0S 00 00S000 @ ` ZP)P0@ 0R 00@0@$*,2&,Dd,Zv@-@PiP  @ Ѝ蚆@-@PP  @ Ѝ跆0Sp@- Sp00S p@t ;l0p `iP p@0qpP@ 0p@ <(,ۆd,d,P07@- S Sl0 Ѝ0XP@T0PP :f@ Ѝ0@:0 00c h2&l2&P/L0@-0@S 00 $0$ @\d,(,Xd,P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@PR: Ѝ04@P,0  0 10 X2&T2&r,\2&000H ;0Ѝ004@P uwud,d,tP @P/g 0 /ᓉP(,P/00Sd,0/@-@0S:d,0/@-,@0S0 0A00Ѝd,0/@-,@0S0 0/00Ѝd,щ0/400S/(00S/@-qp@d,|(,P@- 00@ ^S00S00 Ѝ00 (2&@-P4M & @"`P@@0,S p  h0S  0 ,R 0x 0X0S\ 4Ѝ80D@0P0 00 /MPd,d,9D0@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R  E C R    C R  S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  (6|d,v800S ,00S 0P//d,d,d,$0P/0 0 0C/d,(,d,A-PU  @Ѝ`p@BP|`V 00S0\V0S 0S`@W ᵲP `@$V00괊d,@-0S0*00 0AL( Ѝ *  7Lϊd,Ԋ@-Q00P 0R C Ѝ@- 呛2d,P/0S/P 0  //oP@-/ 0LP/d, 0@-L   Ѝd,A-`@Pᶼ0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍfL0 @Pp88 0 R @@-PJ &$PP 0@s093@!+P0P0h0 P @0+S9P B6⡼=69P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0Pxd   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0fP.00S d,\d,(,X.@-@PM @PU`p0@ uSЍU  j  B U Rz  0H"00CS0 U0S U3/U@`x 0 AV00SXS^U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 P W 0  0S00S000ESU U U J 0S0nPS000 00SD000V Tϋt@,2Vp@-P`@ֺ000C S0 ` 0 Br ^ ST00p pS 00 000S/P/0e,\d,@-XP H0H@ 0S0S  0  03/$@q\d,%& 80S/S/ 0CS/$%&O-@pM0Q 0S [; 0S0 0 Ѝ`V$P  ]0P  AAQ-P $YQY0 >0@@Oop B0 0S `0 0S Wp0p%&@-1P.P0 42&/@-0M @20S4P 2     B2 0S@ 10@@0Ѝ0! R0< "$01 S 10S 10S|1 \11S(  B2 P!2 R@ n$10P@ 000 0  R  RB0 @000S T0 0S T \0!PL 1 10S 1㪹Ǿ0Ss þ0#So @Pe,Te,s,r,D,d,42&5,(2&xd,@-hTe,@- q' Ѝ@-Pᦾ5`]@Z@@ᨹp0 `~H Ѝ@-@s5P  #`f,G- @$pP` 0? )!0 4@@ό@0p\p3#@- d 0 Ѝ(7@-P@2"@? Ѝ0@B@-<03?B3c/ $ 0 0 AЍMb@B40@-0@@T AP  0 82&tf,t@,@-@0@82&0$R/ $徾tf,p@-20SX` 1``FxZ@P 0 @PX SiX12`[@Put0`V@P004S S S ᢩ0PS  0 QP04 叩0S  HH P? 0 ^R0 P\ S$R 0C 0M0`0000 \P0C R 0 C`2&`r,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c PU Y< 3T yQ5PPA Ppp@   @@Z 0 p$᥇W "l 6P@ "T<"0S000P ;04P S@ - Pp 0S 1T &QP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P ? U0`00002r,`2&x&r,&`0@-@ӨP̨P |ǨP l¨P \彨P !1P61`2&@-@PDP P@ꪢO-x1M0S" @`0 ЍOsPp000 0 Ppxy@`Ѝ00S 0 00S  0P @``e 0 00f0 ! ! 0Sr,r,Тe,e,0@- LLPR^0S @T 0 Br,`2&0@- LLPR^0S @T 0L Br,`2&0/r,0/r,00S _/r,@-IP C0P>0P@-0s,//@-L@X 6p0 PeS0PЍs,\ QR0* /QS QQ*/0000/@-@P !000000/0S0C 0//0@-  0#A3@0@0@- 0@SPR? P &*`Q   ` PЍpA-`pP@T@  G-P`"F$@p(, ᱐QP 0$ GfFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0 00Pa0C`@S0  PЍp  000@@0 0 0 0 0 0A-^\^ ^Q}[\9[^V ^\00]QQ$ ]Q0\[Q`.FqQ5 `@p 0]QV0@Q@\\@0[T T nT  \TR  @0\00Drp@- Pd00@S S R 4@D@T p@,0 @ &1C-p`QpT@P0\`0Y 0 *PA \Y R T R 0 0P@0   [R .0Bs0S830 00]RT[T@ 0QT 0QST[@[T0Q[S@ 0 R Ѝ,,00@-M M00P/S $S! +S00! 9S\S @P 0IS@P p00ۍ Ѝ00@00 S00V@̣O-@T0tS bS rS aS @{S000pW` Gp 0S0QU 0VCP 0 0 PUP(b`Ps,Ѝ,O-pM>4Mn0  PIW ܍4Ѝ000Q 00  R Q  R  R   R @    0S 00@0p00pS 0S @P#S ;S @S0@0 P00 ϙ0P 1SP  0S @,SP0S 00@SP  0S  00@0r0W00 r 0@p0ST @;S }S p j 0R @\R 4 ZPU P @ Q R ,MP  <,0 \\^ ^00\ APP00R0I S RP0S 00@:0S00)v,p b 0S 00@0S 00@00P0S 00@T0S P @0S( X FR 1@( RP0U0 廣P  P\XX $;R I0Px $^P I0~0 , 8 SR0 (  Q 7哎00H00 PP R00C0 0C S000RW,X, `P0pL\RC [D Qx␸0S <,00S ,, E 7P00A Q 0(0 [^ 0  0S 00@MgQ\ R9QI0QcQ Q \[08 9R/RR0C8 &R$ +P 808\R \ 00ARs0  S S00( 0  \ Rl  ;QY IQ00pQ wQ$ iQY 00Y Ey0"S YK  0S 00@<,0 [  RR , S 8x O3 0S #*p p  U@P IW[ 0SD @;S> BP0110P\SSpE ND  PP< , @P 0S 00@00 HUp'a0H Gp Y20S!000 S90S 0S @;Sa }S0 @)  9099090H 0x tp000 XH 0S  p U`   pYP 9)0     呻!pP1 ! 0儥0 $(|9 09909 00u,& },%x2&6Nݤ , +.;Bs,HTi8, u,ɥ=mɦ-R\}&|A-D@`@PU@Tp00S OX0T0OD0 0pS0(DPs,Ѝ,,,,p@-P @O000P @p3&@-@O 0  @03&0p@-PPUph0@P 00CS0`p ᯅO`p0 F`,ЧA-p`dB R3 RQ R P$0SV0(  R R 0$0P ,_P0 P0!/PQ$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0_( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(0,ЧD,ƨ@-|@X0  0S 0S00CS0_p X0  ,G-D`X0pSM00S 0S _#3X 00X 90C\ `00d0崃XP 00CS0 _p X寄X D#pP0 W0 XPލP3 9_p0S )0(P 0(P j p4S ),0p0p4S \2PP _P T 00\0l(Ptp0`0d0S00d0000S 08S0i )P0  ^0  0@ @^00S +塏+m P0 ^+0Ⓩ+0J⏏`Pp)Jza0d!H/. P8Q*5)\ PP ^0C/P\a ( p$p'(\0pp!"( 0`PS(00)/PX30 00,0\`0P l000S SP@  0  lB(00(03,̨x&x,,,hx&(@R^Ч--AMM@A> 0$ 0-0 @0 ]@,8,`--M MA>$00-( (  09ۍ ЍЍ/@,8,`@-T`@PP c 0$pXM0  $ Ѝ耍,@-`MQqM0S000@03 0@厣0S c 0] 0 0S S ` 0lz.@P *0 - P] 0ѓ00ڍЍ脍,l,p,@-@P  Ptn] `p\0 P `P 20P S x U] Ѝ脍, G-pA唁!0`PU , R:(,L0(0 &U# \U   0 R`Z &R\RP` , R:(,L0(0P    "pr P qu PE ,  R:(,L0(0    0 ꄍ,&A-@P p0R`*LW00  0P P 0O-p/MlO00`PЍ080D?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0  P0 R h>0R*SL>0@o!P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S8=0@oP 0-=0C>S00 L0 R: L K `0p垛00c0S<Kt<8 00 \\04 0<<0S ",H0SP80S4PU 0`  E̓P0800A E4 0T P "0 | 004 0x 0 dd 0H; 400{ 0 4;0R, <0p :0P 0S AP 0( &P2S 0` H:0C0 0S0`V: $V S00@ X:@A0S < 0,][  H0$eP y0 H$0ߟ$ [0`V: $#  ` 0 0C 0 P 0`V:P x `  0n[ =p  :0P `V:`:0\0(CE +0 aV :K ` 0 0+0 SD88 00 ,h04 00<0S P(0801 0 P&80S"g04 0 <0S  80S04p  G⤒`P <0 00Fpp40<  0<0S |V 0400<068 00 V04 0Ґ<0S dL0 R: L 1J `0p^00p[  R  Q 54 J4000  P 04`Z Z Z000 G 0Y0 00 V~ Z0 0RP  0X ?0   PQC p0V `XOdH0p0<Hp<(0000S Xt04 0;<0S p P[ 80SX0sF@$@T#p@0 $YQ0 0  0p V0`0  `?0P  0 RS0 0 p0V R`0 0 !PP04 0"4 0P "P"0 000S 00P80S0s""p 4 0"40P $"P P R0@u0`pL<0p<80S4X ! 0`Rl0#0V*0000pW(p0 1(W0 \;0H  ! R 0{P 0 pW*0$ ("1 0X`xpH0`0h<Hh`<x0h0G0| 0)@8,,,u,ll,(,ԍ,hx&3&ht@;$p,'A, [^\}&,_<0 0R0((Q 0{Q  u,^ԍ,p@-@P`Tp0wS {S sS 0p 0"P 0 DX0`@p !"P `[G-`pFPPU00X01@ R  PVAGWp0!p!Q <0As\S00 0  HX0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: ?pP 000BS ῾p,wd~p@-P0`@T P P, 0S)0 0 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@,i- 0@-MMP>!@P  PW !p4W+ &! P?!ۍЍ0蛪H0  BR Rp R( p/x&x&@00CS0 S0 / (x&@-,A᳑0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@b ,0-01S ^00oS^ P0\ S0S Q0S Rr P0S0S0 s00Q qR  䘋- ,0@-  `Ğ\ @ T\    %R     ,-p@-TA0 5S <0S -00$!<Pa0U&!0! R8  (P  l0  ,P  c0  4PP _p@㮃00\P P @ G00, AP$$Spꘋ- h,d,x&p@-@0` J6$T  -'t(d lP`PT p pP000ST @x&x& ,̪@-@P ԓP 9@P @0?SP@ Xp Ѝ/㘝P@KP 0S SD\4ݛ0Sٛ00Vܪ@-魛 &#Ex&@-0@<TQ T0B0 &0001S R0Sd0d@TPT T@0$ @<,&T ,  @ & ,x&-ǫѫ@-d w&x#뗬x&7@-@Py  Ί0S 0@T k00 Ѝ0e0"S sr@-@P  p sUЍެ<0A-@X``# ^p "RG ^<0d#N R 23& 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,c0P01p,H,01//00/00/00/00/00/ 0  /,ڭ 0  /,00/00/00/00/00/00/@-@⨕,00/@-@⚕, 0  /, 0  /, 0  /,/00/00/00/00/00/&00//00/<00/F00/P00/b00/o00/y00/ხ00/Ꭾ00/ᘮ00/ᝮ00/᧮00/᫮00/00/ᯮsO/gb@-0  0Ѝ@-@ +@-  `,r0@-%R  +@-  `,k @- 0,, @-,(0@-% R ,  @-踮 @- 0,, M@-, @-  , (0@-% R y, < @-  p,< @-  g, < C@-^,< @-  V,  @-  M,  q@-D, e@-<P, e@-4, e@-,, @-  $,  @-  ,  @-  , @- 0m,p, @-  , @-  ,  C@-, @-  n, 0$S00 @-p, @-@DԓP d 0  ̮Ю 0@-0 |1假, p@-0@-@Q1 0%R   @ M P \03S lt d` \ \ T0 h, , ,,̮ ,,0@-@Q5 0%R   @ P x03S 0 xt p pl lh00S  0 q, ,,̮ ,,,,0@-@ Q8 0 S00 @L C   lP `03S  xt p pl lh00S  yp, n, ,, ,m,̮ ,,,,0p@-PQ+ 0%R   p@  x/ @hP 3S/ @< ,A. p胭 `,r̮ T0Q @ @8 8C0 , ,( (/ር, , ,, ,\0Q H H@0 4 4000S  /፭,,,,H0Q 4 4C( $ $ /ᑭ,,, ,`0Q L LhD D@ @C8 4 40 0/ᕭP,,, ,, ,H0Q 4 4BC( $ $ /᛭, ,, ,Q Q Q/ &  , , `,iQ Q Q/   P,,`,r///00/////////////00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/ @-@0@,@-@0@,0S00/ C@-, C@-, C@-, @-  {,  @-  r,  @-  i,  @-  `, @-  W, @-  N, @-  E, @-  <,@-l.0,@-d.0, @-  #,  @-  ,  e@-P, q@- ,+@-  `,rA-T`)qW @%1@P |A开0 t,NA-@PP 0S Z`F/P  .`1S0rHP 3/P 0p R; .`@-@PNE P x h0 0P}h000A-@`\@*T<0p " RG\<0d#N R 23& @-@Q@-@R@-@S@-  堼 x&Jp@-@0S*BP) \^P @ 㵍LAj|PrreB@ P < 0@ S< 00pppp,$-3&O-,M@0P0 T; R0AT 011!0 S01  R 01 sP5^P },0S  R3/00S 3/[1P PP K0P 0 0S[`p: p` 00 1`@S0` $0ʀP$0p7$0P``Pp1U00$0PeUP0ἹS$0 0Bs0@0S SBڰDP@_@p00$S@ Sf^ 1  pP$ 20 `p B BR V` Z `1Z0ZA^ 0 00000 "P P ˉV`y 0CÐ   S CUPPEPE_P 0 vP ^ 0 0@0 PGA݊P Ji1  0 v | Q l7v8XXW`1XPP000;ᮄ1/@00R  !s0 RRQ0!R0c01S 0C" !s0R1ڶ1$PU|ewppxp0 bvP u|vfa`P 0PSY 2C l5i0 i 岎38W P (500xP/ qP, >P( dP& <PV 400C`F V$P SuP4P 0CP  @@PLp4P P0S 400C`]{k1SR !0C B/!?1B]!NRAPN P  ^Aжq0r0xP00S11A)zP`PxP@a@1S020-(PJ @$3@P, #0@S00 2P0CP?P <P>P P2P 0PVvP tpP1aFB P uLz1S'ʰ1 7B P u=zP 00P1 RE40S 3/Pe PP e P,ЍPR0y [\ 0SpW 0m 3/pg P 0`A P Pu e `ye00x00AM%0 b02P 00P000 `yze p,x&-(-&$-oS&R 001/p,P0 R0//p,O-p`*@PP [ ! 0P @ Ѝ0o00 1\$<0'P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @p,P/D0 R/0@-A1 P d@< %p,O-dBp0 =W`@4g0p 000J Ѝ0P@P 0S 00@ [& 0 8nP LW0S FW000 00 `[0S nP 2W000 [0S nP #W  W0 00U P0IS0SPPm0 00m0S mt0#?C S VPU  \j0Y!0Cs0S( 23PP PEVꄏ,&VUUU @O-$MH0[S0P 0L`Dp> G0Y0 0S 0g wf\Pmm m@` 0l@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  00g}mX 2 f 0  BҋST P0{ P>  PN P P!VUA`E Dr@DP`0f ff@`"PD P AP;  KR !   ` D0_r0@0!P`1 V0p00@  \`Zx`F`FV0p00@  DPE4r@DU`E¨` Y @  wᝅ@T`— R   BU0S 000 0 0v$ЍOq0Y S ꄏ,ɱ̱ıDZ&x&A-lP`Pp `l@l@0T `P@ P HP脏,@-P@p 00T0* p@Ѝp0 00D 0l` 0@ q@t 0唆P ) J&,αh0p@-P@XP0Ps H` R :P 0S@@Q@puJ&,@-@>脏,0#jꄏ,07jꄏ,-@-@00u  Ѝ@ Ѝ/-@-00 f Ѝ Ѝ/-@-  ЍЍ/@-@@ֱ@-@ֱ@-pP@`M,0 0(5 0 00`Ѝ@- ЍٱO-M P`@pk@kUiT0 0aP 0D0PSX 0SU L00SQD[PPL00PT]y@DO@W <p zPRWpV`KЦo`0 S`K0 p@PD@0 ":PT0 0P00L00$T ->Z  q a1vaaЍ00D R00S 0S L0X3#PpvqP 0 Xq똰$EDcc =0 EGdpcP` ED`ccꄏ,ڱ(-@-,, ($ +Ѝٱ@-P@`$0 0 E 0 00`Ѝp@- Ѝٱ@-pP@`M,0 0z(( 0 00`Ѝ@- Ѝٱ-@-00c  CЍ Ѝ/ٱp@-Pj@jp脏,@-7@- ]@ZUA$WPU % }x{C00h@PU $T mh{C00000S$$ Ѝ0,$ $ ,$ ,x&% O-TCM@g0PD0`@ J&@ A@ȢyPP  PCCߍPpW  @ epPY Z  ` 埢 @ =R@8喢@0~ p Ft' ' ' x&' ,% ' 1@-n0C-MM 0p@x`P0 ~PP* P eP 0S0 0 J G HPPP 0 Q000P}vۍЍ00P 0 10 0 1' ' ,00S/ 0P [G@-,,@-TZP  P < O@(!Pq@$ ' C-@M @.0S0z$P,  !0S#{P  m0Sl Y0] )PeqA@PaCJ'C2*jA^&'ЍP@R;j}P'P'20S m@`Px'.@p 0$!P;@} X t$P 0)AT PWP @P plPP 06+Q !Sp 07'SpT+pAW33pp0W3:X# t@PQ  R@4Q p0Q  R@T@P`XVp003/P,00  h0S  R l 10!fpL,,,U, @-MM+@(r+(rB+(rB+xr(}?PލЍBt?P 0 T @@@@@ @@@@.&B(T>X, _, d, -MM+ yr+L Er+ qr+0=r B?P  6>ۍЍX, _, 0@-@M օ1@@"#P @  qP A0$*!PRU)QX[&Ѝ0RL00S 3/P 0$003/0$*H@P3P/[P+W@P'@P# 0P{ ?:{  0S 0_ Z'P ?P4o0m%()00L,,b{, , (-$-@-@M T0@@Y>#P* =@  q9P 00*!R00$Q )g@P  0S 0` 5'Pi%S()ЍL,,O-`M!  0X#*0S ` 0 SS 0p0 S00C `@0 S:ZPP@ B pQ %S0S iSc %S, dS (0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 p&7@-@ ;PU  2 ^w?00 Ѝ0lmP T H  FwQ+$ 0 [(,, , , , , p@-@Q`T8080P00S0S   0p@4,,, 7@-@ PU   w?00 Ѝ0PP x v`00S H 0EB[( $ ,, - - ,/- 8- x&s@-8Q`@8iV z I_c~ _cz >_cb4c^5ye 0 Ak@Pxx% 4P ?T?@^C^  yЍp$-]- `- x&c- O--}Mp@` x 0p 6V  0S   P R u 0S  l 렵P >v됅P 9vhpPU Pg TRR0B? 0I)P >PP  >00BP=P: @  |: {:0S w:P s:D4   3 y 4$"0}ߍ4[3 34剂0"!03140`040&2ыҋ 0T40   T(0>P500  @>"!!0# 3 PW O XT 2t 0S l2P trt=w0S$@0 U0 <"QS 1P Ou 1 T0W$2j1@T H" 8@>0XC0@0S@ @  0R0SQ Ꭾu0S  )GP 0 P]wk0  PS $2 ,|T&ptbt- f@,,- - - - - ,- - - ,/. - . . 4. 0@-0,MP0 00 0\PPP@P DD1@0Q ,+ ,Ѝ0@* k T&x&7. , -O-iMs?!0v ZP 00iߍOЍ/\Ax `PD1P 0 u Ar$`P z[p P@' [P?pT00Z&<U0P 0 "H 0GSW 010#S 00PpP@ PG%U. ,-O-p0MT@X   p$pm `V  @Q'U` arPP{P@P 6<븤H E0`8PU m0'SP0U*S / ᓃP0 0qX/0 0P {0@ 0 0H0 wPX1Z oRp`PUQeR( 2S022SP0220C2  S xS``  v$00 00( 0`,VPMUSOR IPPCV   0%S @S B* B9 0.S 0 0|P1ZpB@P] 0A0 0@› R)5Gf`Sv00 (i@0 0 (aP=b>bq0S  [V0A 0E?oX20S `g[_$d[`bUvV @ x 60S. b@^M[Av00CS0000;Q0S }X$0S  `4Re$vWU _([_X L"[v%hG0ЍO Ѝ/. . . . ht@$-x&. . 0@-CMl|)PP 0S .Q q@P 4kCߍ0 Pk ,,G-p@ 圀PB`AT:00Y W ,/Y 000 pP EQ 0 n @&. A-`Pp ep@ ) ,pk P@誑,A-Pz@zopl k0S DQ0Q.SbP @$ $Mk Ik謏,. ,p@-M 48PLP   ck 8PLP  Uk p@ ( ~ Fk !PU |@ %tP 4k 00 ` &@PЍp j jP!i,%iȓ,,8i(ܓ,. O-NMX6Q >M=xx:"`ێ,Pz0尪S py W:-8 4e0 w=C$ C/Bu E009u=0ؽpQ>e0 jP400Dy0 zP40  U* (Ur0YR? ;/ 0np @*<: R0 :P'P P 0X60,0:P<I0.̟   0/P `d< B 0 0u`````WPp(00ۮtl= *D00lq0,ݍ<Ѝ>0a XDj -z`P  'zP `;{ 1sS1lS8+2 0P%QPH WP8;z`Pp},j*0x*0wnzP\8 0\8VW*0yU *0z*0}\8p*0|wX:U :H*P0Q4 4* Q9ʟP \ʟW^ x9   +9 @H- A)b0p 0HAmp p=Sr 98)a0dd CP 0H0 H0Amp ( AAY`P( 0Vi 6pPSUp`jvC |! J|H p00n`<T(0~C`<UyP P(PyP <JyP EyP }JA?yP :yP 5yPg0:4LP '0\6S '0&`P b4x lh`$'[7S0  '58p& PX6 AAy0\8^P P & 6 jP `([:4S $ 5YP 0: APڴ  2VF\80%8\8nPय़` h  mP0%08P  h   mP0040X%S\880\8P h 0S %8P tph  `wmP000S\80\8%P0S\80\8`: 4S3P h 0@?S X@P D3?h 0{C:$P0R#R#p$|ßRl#hW%RL# 2M  !0S2 P 2@T zAvL HHB* 0G~0S t"dw0S h"pmn73S5 U\ "R?0ⴂ0N?C0C `.`0  0F0``Px9A?Fێ80I,07>E`I00x P"H pS0S "vWW5S (!$iorXv@nX60S`0 <IW45 4 4 P 01/. X5 C-pP@,M wP3S0 ` 0`:00 0`@0`00n/00 Pp 0P/S/00 0 /S 0/0 0%R  @ 0 `@ yߍh5 l5 s5 p5 A-`BM|@vPlP3Sp (pE < X800`0 0  3PBߍh5 5 ,, ,@-@ @p,@-0  0] P @0@ 18 0/P $  #Ѝ, ,,5 @-0@XPL0  0@6 P | |0|` x0Et@1P0/Q   P 1 0/R@0@ Ѝp謏, ,5 p,,,,@-M@DSP#vP  $f  f0 D00Sލ\0\ \P L0 (0< 0, ,/ ,,,,,5 ,5 C-bCMX6S P \8BPCpt2tB0S 1\6S T1L2L"{ 1PP4 1,B 0 HE:4S / "=:\@gU 00 /:4!SU *00 0 B$!qgGA1@P@+ 0 aGAcG aGA 0S  !(!0S   4 1P\6S @#U 4lCߍ 0p Bd@ ꬏,5 6,3 / ,5 ,6 0 6 ,,6 P6 ,,6 ,6 6 D6 6 @-@T^ S C @TR \00S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-P`phM 0S%phЍ0L0 3/@P 0 @P  Q 1/P @ @t@0ᄠ80:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-`$MPA@T r pftP00 G0S 0S0S$ЍP P00 S RtS, R ,0S R : 8 80R:P3#///A-@M`Mp" *0P py Xd5\\ SS=S 8 d3R 0 ,0 ڍЍTT7 7 A-`QM p@ 'P JPP oPЍsPTP0 pvP@$U@@UT @ @QG0 @XP7 8 8 8 G-Pp0@0Mw'PP ,`0 R & PЍ 0L03/P 0 q놁0 qD @Q$0S P @\c @Xc`H,8 p@-P`o0@0S 0p@'08 A-0Mq!P0`L0 3/P< 0t@T 4/@0@P0 q 0q 0$0S c$0  cT \c cq0S0C, 'ЍH,78 H8 J8 M8 Q8 0S/p@-P@K 0000p@IO-p@P|M YB0P,0+`q,oP|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U/0 0L1<00 00pP ,0<<0@D@0S :P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0L  @-Z P 0P 0Pp PQ` QTPQH "P <0P/(/$/ /7 T8 Z8 ^8 p@-8@Q0@P@DPp f.PpT&p@-P@P  b a00pp8 @-  pT&@- { pT&G-@PMP N/ru a0 0 s0S1 0S XP a,P ލv0S v0S1S P qP @l0 1h0$1d0(1`0,1>1S nP >8%0`>P@pԠ+ PpNd , ( +N $0ܾY 4p <*0S 3Sj pTt t t0`0? `p䀍0P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`F0'Sn`pF0'S``Vn`F0(Pn 0C QX > 0 0B,0! s!4吀P0#0` ^InP\hP foP ,0!4!k`~0#`j``oD2P  @000@A0"p~0N?P0S J` 6tKR /t0`0K?(081l1~$10 100 P@a C 01/@P00pЍpP@00003/003/$Am9 O-`UM MM.x0Peq.q QiT,>EfhD=T@[@,0p%SppW ~0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯N℗ 54, Q~W <S P7h4F>D0C207\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @ t00, n3E "]5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$#@p00,0mS` E`40S N?,$$d4PUX4 0}108T  A ^] "Y] U],10!,1 101$14141(8H!L1 1$!0L1H!,儣6$1(1\),0, 1401$141(!>8!A $$!ŸR   C^{Xy ŸH#0Ÿ$1P00$4; xx2P >{\{ $10S0$10MP00: 0 [0H55S Pg $003/$plPM pQE!> ,! 5$H0@;S 1 HPhP? );=S; $10A>@C418!<100S/ @_ 0bWQ!!10b/o0@P,1014181>@C0(1}1S0}1$1S p E@L,$-x& ZQ8 T&,,,P,w9 ,5: _PP$030/0@o//BO-P@ MMAT0*!Rp0)A`T0 $0   P S Pp , *'0t$0 `$](pP H4\,# ܍Ѝp 4B_0Spp0 P0 4p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0 S "S S/ Pp  R <,pWP00P0)|2YP0 T P& 'pP 0s 2&P }d0S "88 ⏊O@d0S !8\0 @S !8`0S !8|X0St! p!S0 80` DcL0@ O@\0S ` R !8A8 LD@D~F@x@?D@Dq@8D@DjX0S0A.@`^pQWppc  ^,; 8 f; 9 '; 7 ; L,8; >; M; T; [; s: o: b; {; ; ; : ; ; : : O-uM0M*QU$e UB&&@&d P Z &0 0 6wT Q ލЍ3 )qW nP7 FP}' zP  @aP' @ pH0X l40jP40 ]` P U Z@D`@ 1 p PU   c0SJS   : 0S #S 0P000P Fq^P14s10`#5:\#\S /%5%;%0@`S D% % d)`spp`0 0 ,0S T0 S00 P0p0SS 04  0xP;8.5/P>0400S8RT0RP S@" SA0 0 80iP80P QL ,0@8aa<th<0X !L! 080$ 0 40d( `5 S/  S" 8Q0PEu $PF_ iP005S0+4^Y04  v0 S r0 k$똰0,< ,i< < < < < ,= > w9 !< > l> ; 7 : 9 ; ; ; ; ; ; < < < w= ; : 8 ; = K= "= p= : O-@BMTM) Pp ` bG@PpTp$;VGPpppkPP@BލЍ D AM0j@0@ 6M>0 $04@(8 ,M>0@00P@<DT@0 GP pG\0A00@3 0 !G, A0 $03(408@00S0ؒ; F}P F > : 9  > > m۶> ,#< ,Q8 '; 8 w9 b*< 0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PB , , $0@-@"!P(@ ,@-$@2S 02 ,O- @P@J`P@   PP@ 'f@p0Ec#రPU* ЍI IP  IP @JI    R0S kp&9 @-@00 ;P Q P 0ZЍd O-p`JMMԢPppp HjP)NU\b`H9PfPX` EpGGYK -gP 0 000!00P T"XT1P T2X"TPZNT"R0 0XpPX 0H,0B1A 0101P0000PPP lP,Pi0S9 0S)XaJݍЍQU"P 0Xp$1Q QP SU T"P 0 003/PT2X"S0 S(0S 0SX'(0S003/PT2X"SP, xV& 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> of? 0@o/b0 !!/,10/fp@-@4P0 ` V1111p,O-P@p`ԐԠ԰0/ C !  !0  Phi00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ,l  T 8 0@-P@M/.5i1, 00 0d0@00 0T0@@@@1 0 000@P,pߍ04 ,O-Pp@`4M 0SpP `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   0Q R  TU0 0P  P  H   4@R,  8pT  TX $ `\ ( ` , d pA- 0R 0  DQHa@1QRpB   !LAPAP0 \A0Q     TTAU @@,@ @ O-PBpXQMU<24PX\1S2\U \QUЍ0C`1T`1SY`Uc001PS \1 X;X1! 0`1Vle.0X`0 T1XX " -h\GP6 \ ! #h000: S.X1 2 \1`00X1`^P 0 S 0.S Th<p ` XXPV SX1, 2 $ e8T,V&p @ p@-MM``PoۍЍprP@P+DT P*+hT P*+T P*P 4P@ @ @ p@-&M@(EI`P5 ?h <0 0{b P (G5(G &h] <I@P  Zލp@ a@ b,@ @ O-p@MP! c0  A 0A`嬢Y p` 0 0P0S&ߍP X%]P0cP0 a0CS0S  pPU`08Sڠ0SP` R SY0  0 a00A p 0T1勅00 0s [+,pY 0sA @0nA0t00 00S 0 DP0h!R@O O0㏐ 0S* ?0!CUa0 ,>AA A d@edAx,!A &A A ,@- D@01SP@ 0S 0   , @- @-G- T1  D1D1/>,>66wYAtY$-,@-@)P `tdN @ 0aDЍЀXC x&0@-EM'P@ O TP0040U0 ((0x:@Eߍ0\,C ,@-dM\A rO]<1G *01M<0P@T 5X Ѝ,C V&@-@<!0@- 0 Ѝ0@- 0 Ѝ@-0@M/0+0  0Ѝp@-P<@0/SpQ ^Pp@V&@-0P  ,,C-$M@j`pPP 01 QP) 0 PP0P00P l @`0PP0L`ySa00ͅ0݅000͕0ͅ$ЍC C ~A C ,,,,D C O--,M`\$CS@pq[ UpPe $6SP@cdT10S@ \PPEUN TT0 (`$0P0   @$0VSS00Y00S y\ P E H $R0 0$0  0 $ VRR   P # 2R @D a0@QM\ `P$ R@,Ѝ p  @ p \P[PۍЍpp@-@P Z` DP  0QpPp|d zd@@-PM Mp;P ` p  @0PPPrU[Pۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPZ00/00/4\80S0 S001/\80S  00@-\\@"SR0(SS QU S!0$0S\  00J 1Sp@- l@$\ 0P"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/, H0, 4 T 8 X 0J 40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 BRp01 408 00803/P,000403/, H0, 4 T 8 X 0J 000/O-0@p 4MPPp`204ЍOa$0 L03/P$ Ѐ0 \ p!D@ Z["H* 0*P T P , [p pY8``pp 0S0P 004Ѝ0,O-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R?!S,0S 0S00 0S p  0!"0 0  SPH P00P00 0 K`03/P L Q Q  Q R S# O (   0%  dV O-0c(0M<00PSp@{p`00 # 80s 3 0ISh0@l0 S@3`a 0D@\  "(0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D00p2 p0 0SHL0  R00(, 00 0RP23T 40p0P<0SNP0 K T00SG0Sj00p0q  x0 0 000000  P0 0 00000PX 00808/R0 PpQXQ Q(00,0p 0#_p a X0S h^ 0$0p0 0(00,0  0#0p>0б,H,J Ա,J J K G-lF`0pSPhM^PzR0S r~R0 SjvR0ScoR0Sk\hR0SGUaR0SHNZR0SIGSR0SJ@LR0SX9ER0Sa2>R0S$+7R0S000$ R$000 "0& W40SU4 QQ00Q00Q00S 4 ehЍG( R0SWAD4W>0 P Q Q+=3003 0Q0 hЍ3003 0Q0300 0$p3 0Q0 0TS(0p`@ 0 SH0pP0`@SH0pP0`@SH0\000 SH0`000S#H0rd0S tP`@g0 # 8Z P0 RS R>0 GH0L0 @H0L0 9H0L0 2H0L0 +H0L0 t$H0L0  \H0L0@ DH0L0E ,hЍG !耟SH0000 #0PpG0  d :/ 000(00б,# ( O dV J (J ?K ,H,HK    < VK < `& JP/PP0S0M O-pMCP TUtX4{ 00 rs> ,b0  * 0` P  1@0 B )R R+PQ0R r Q0CFS0TR000US0a0Ѝ@0  lll+PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V .H @,+P0 /S`Sp`` [XtT00U0,`0M ,N O, N ,J T8 Tܳ, 8T,,M O-0MS@pأЍ`  W0@ 0 P0S% cS2 %MS) CS, GS R 0GP PSS! +0C?oW20S 000 00SmS sS gSR 0R RO-СOMM P#0 P0P<0@0@0Y0P(0` 0H03/00040 00!6 0R 0  0(3/ 0Ps`` r S08 H&a0<&PUa`v0$0800s0,00&$0TIp(`DpWP0`0T0d05R0h0:` `pV S1` z`U T)` rPU#` lVU 00 00PLg4P0@ X000\PS400O>=C0D0<004 0F$p,UL0 R  |Hg0 000D0H0 F0+HL0S pYHP 0S80Q00`Q0S 0L0 aA3/P 0`0` 0%003/XP\p0E0 7#`@0o?{FX` X 0 Z0R0 `<0S@00 00S8P) a`v0"T$0$0,0-T0,0$0&$0倒 X& 0FF0 p&0  07F 0& 0.F 0 %p0`00d010` Dl0h+X7+77 Y`*pV 0 LfU 00 0dLf0 8LfH0+,0$ Q00Q03S (0A( 2`K#mp 0 `%D00`P3/0A` X`Q4VP04`L(OލЍ X 0BZ0? X 08H,N N #N ,3N .N ZN N )N (N CN MN @-@! 0$   0 P 0"ġ0S 0$ O-Mp@( P,`|1/0@T0P5PZ0YP0 0ZE @p0TE@Tp UYp 0 HE X00 $P $ T<000$08900p@3/ 0pXn0%WQ@XcXpF0Z0 0唳+Dtp  DpW000 0Cpÿ D0DpWP70W000 000W 000$0>H,.N N N ,CN ZN N 0@-@M0@L0 3/P" ! !XQ 0 0 SS@Ѝp@-`MMMP;` k@P H j5 EMލЍp{dЀ@-@P DTEP 4OEP $JEoaO cO oO p@-0@ 8M! 0`P@@ 0 ,P8Ѝp(EPUJ0 00  0 P@oC-T1M MPM C  01/@P  0Q$AHL Q>0 R 0S rP P 0$003/$q,#0pQ@-slr #"T R0//s@-(@T@ЍpH0P0 w003/@P@F/@-tM`P @0P p@>@(P  90@Tp@tЍT0@ "Tx0 Cdd0d p `P D 8iP ,tP P ,P P ,P P /@-@@@P ///@-0@Q s̻@7o?0 \ 0P000@-@4M0  _EP0PUEA0 00U00 0  04Ѝ0,//A-pP@`VT0S0S XAPH0P$1UA0U00 0X0`p@P ,0SR00/p@-@P?<0P4`" 6D0# A@$!pH,,A-<`P@wAPp( w1 A ,@-O呻Q @-+p@-M  D0 hO0S Y}PL@L`@%U 0 0 ܍pcQ ,_Q 1G-1MP`@1P!t1t1t0ppl`PBL@E徼D0 [㻺8ߍ W@P R_? @@P 0=S{??A@0  @+T@  {P 0 l7P P 7@ UA9:sQ oQ lQ Q Q Q Q ,Q Q Q Q 1A-1@P`p1P!P0P0P`P`P0  @gb74 g,9:Q Q Q R p@-0M002 00`P 0@P @T 1T 1TO/11 ,PO/11 Ѝp+R ;R 0@- MP o,@-CMp P@C<P ^`0 0p"0SO/11 Cߍ5S| |p pPd`X 60S  S(A1 1,PR ,k,xR R M;߹Jp@-P@`1 1  p\,1p@-P`o@Pk0 p@gR p@-P@ỹP wPN/1 1 pS Vp@-P@1⫳1(1 _P1 1 pS V@-㐹@OS C-@aM.p2CTV PS2PXPG aߍP P @"080E0$"uP ",2X , = 04, = XN?1L0 0!,P Px1x10 pAPphaU U UL10$0PU@4!44+`A,ppP0S S  @B 0` 0P@hP0@8 ^C8 0 0 0F& 000 p @,LdL,5(S fS S ,T =S 9:^&H,\,,,k,(-$-l Kl A-`$Y@P Qq-@T N HXP( 0 ;P  0}5 P >@5oЍX0bn Dk0 0P KT [T ,]T 0U >U T U h//O-c@T Ѝ@T@T( ^& L U[Z [Сԑ YZ PUPE P P$P@ P$@0"/l,O-嬵@詵lV 0@-0@S0d Ts0"S  @0<00R( T40 P,l,p,G-lP0`Sp@;S S 2@1+1:X bp  QBp\T.@T&RQ0000(Q $5;p Q 0S T v+ 0@1 00 0TRT0T"1t,{p@-P@u@op1O-0@SpP`0 PQQQS RK0VȰСr0 $P 0 0"00=0(Q $:p0, 1X#Q  F vQ 0W+0  R [ R pR L0L 8C= R# Ѝ  W1Q:`0P,V p@-P@P0S!U 0E p(0"PE0U055403 0(2#pP,l,p,40@-0@SiDP0@0ӕP,HU C-AP0`SW!U 0E p0쀟@SV  Ѝ 4 U(@0y`P `4p00 0@0N>Pp\0 xH p8 `0P n0'p(0,0`P,p,l,(W sh1A-0PSp@` 0 PQQA S90 > 2r 0 !Rv?000 V ! (0$0X3,00S0001RPp0S0 00 0W1S` P,P@- @&00S T ]㹳Ѝ=O-X0MSM0 @<\0@S0 @@`0Sb0/ @@d0S0G @C@h0S0c @J@H *0S T80S 8< SRS80S Z7, 0HPASTPPKPq @@`P)~G2 @ `, \\00`0d U.0h NX JŸ;S"@B0!,00@0?P@_odRݍЍ 0:S 000a 1\0  0 0 0 0C0  ;0CSLLP4W dW |W W W W &W W X X zX }X O-0TM$00 (00 40 0800p000@,0 0@<00$$ 0!$0 0(000 P 0ST`@`DPQ 0[ [ !1R  r7 [`RP`XP` P40(S80 00 $ 48R0$0 (P 0XX0S$ $ `P;S S2P11: 0S DW 00PA`^U:PU2QP0 Đ(Q $-8p,0S ! 0S E ,v(<0P1 0$ 0 0 0 S 0  0S 0$ TЍUQU0E"1t,{p@-XP@0SE!R+)r00 S @ 0N Dpt,O--BM MXt\0寰@P 0P(` ; PWpѱBލ ЍD0 2Pű Q 0  0 d!dpPu0 00!$0`4X00 0Fv0`F;S P |屺PV +RQ 0P \Q SC0Rpʩ0S R2 S - S/ S0S0000000`0 0 P 0S  ' 0 R$ ?! 0$ S0S 0$ P0k edAX O-DMhPl`PDЍ@P >$6#Sp 0 5P` ;#S05p0 d00到`0\ h0X P$`P`t0 (0KHگ000 00 00p;X @-`X0Sg0'. C9\0@S0h - C`0S0i/ Cd0Sjp0!. 2Bh0ST0k}/ pP S 0&é Ѝ5W eW ~W W W O-MpD001PUЍ` ؠذPE0S Y0@  0 0 p1/Q S@@@  Q  Q r@ 0 @0R0 0p1/P @|,X A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-˭@P`p1S 3/`V@Td0@@ᶭT0P0S@000S4000S(0000AZ x,|,X j `y p@-@4`4P0Sp@10S 3/@|,x,0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 ꈪ 00//00/00/00/10/Q@-@@@ 0A0003/P@ Q @NZ C-B`0SPEM;0=I40pS5A40 St- 940S &240S@+40S($40Sk40S00$ R!000uF 00$ $ d 00qp`倨@w0,s0pm `t80t$4`@ ps!0@ pld40 000 f0,0ad⯨0$10D0\$10>`\0@ pd0?200S< p0 PÁh ,`3 000000 000 0 0,0p≥p` y3d,0eΥl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV $"P2Q ^Ѝ[Pc00SZ 3/@@OoBS U@0&0010@!Rl!@!x@|@pPpt@t0S|0X*@3P PQ 0!@x 0T:x0S@ 2et@OoBL@|0xT:Y@,[ L,, R̚ Z 08  x,( u@9 ,\ >O-UM8 ST44@`[D 0P(0 pP(% Uߍ0P,0j30 40S 0RD 80S:(1SK1<00J ,H!0L\." A 4T#H@; $ 00@P P@T ( (0B"2 ,0!P0S 3/P20 SU@0%0cD0`| p2R尦b1@82PU?000X N 圦 ,H!!L䱟H@P0#`P`T@刦P ` +@ +0+000 0040* @ ~+   0 ֥ s+0 ͥah+40P1:> t/P@0 000000 0000 0(0㿣p` D⟠D0S#, 5Q7ZTX /-(+,)v "x,|,Z 8 noG-/0@JMM`0PP+P& 0S" 0`"`/!p/2P T` H 0@T* /R  嵵P,1@ߵm+a P:!1?0 `H P+0: S pW1>00ꨠ t!場PJ>0@0/S0@!+ 2 SvP`+& P*P 0/S`0oo`bS *p*0&000 SV+t P*+ P*tP0@o0@`jJލЍ\ \ \ \ @-㝸*@-M @ᗵPЍ(0  2@P ' P A?P:00p R G-` PPp X`p%@P)Ѝ0S @ p+P0 \ JpL P Xp0 @ \ \ \ \ A-tM `PXP HP4+e*@P@0 @ @P+JCJ.0˭+J4x~J.0L㼭LvP 㵭PP|<m, ᬭPPs+J^0J.ᜭPPcr+JN JB`F ᅭPPL[+Jl7pd0\!0J>⏹P 0.hP UT ލ↴P@[+JJⅴPPp0J.C@+ 8P h J>1PT \ \ \ \ \ \ ] !] -] <] O] \] `] p] ~] `&\ +\ \ \ ] /00/00/00/00/0@-0@4M#|0$P 0(P\ P0T0670 Pʣ @P Qţ4Ѝ0H,P^ ,,O-AMAd2 ,000PB,0 00000 80s0`0Q, p $  ?(0 $0L 0s$00 0$l5 h%T` @@`@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0T2y@&L"@(2@@,0S:((0"P&P@0@00 +0@080s=0 0@( Y աW|Ѝ#ȡ!@&(00T1 0&X!00 ص*80`0000Y9(0S` ` 0 RH03/p`0Y80s Hȟ0Q 0 0 0  BR0S0pS 0Yp08 r  *   * PU0"0U  YP R 0S  D#p0    P P 0$ PU$0Y0 0 Ypp0 PUYj0Y) w!P%:p0 0 0 00$0 0$0 0pS 0pW "pWZ 0 p 0P Z$0 0 S&I0 0S "0  !2 P2S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S0 0Q0000 00000000 \Ѝ,PT P 0Sp0 0 ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S LP 0 0 , 0R 0R  `R  #P` #P 0 Q ``T R T  R X `( 0Sf0L0( 3/P <00S D0SS000(( N L0( 3/P 80<00S (0, S004 Q 0 `( ],0Q G0Q0Yg80sd 0*0 PZ 0WYpq  !QQ 80s 0  00UPpp~0  R 0S  !p 0 0 0 # ,_ ,@,a k^ f^ O--`M,p#@PVZ pVpPU Pp0Z:`PU`J6ERUB ||03 D%00#h R 0  80s0`F`pHU p &h0S 00  80spHY pPp &h0l0 0L03/, 00Y:pPp4p00P80T5ЍO>p0H03/,0$ 08RPP0$P(<00WP:< R2*p,0, 0$` 0S `0S< $`Sp $ PR( P`" PU` P0 Sa@D S Z0S 0 `p8P0VS:00S40000040,0(pWq닟8`0[:pp8`"p0< p 00<<) `8q ,0,( 0L03/0 0000 0V `V0$0( 0S `" d `V`P p0o  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P0H03/s0@08P0D00Z}*p0 0 `<080s_00\ <0 0RV04 @ RD0 0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0   V00 400P m۶a ],! 0 0Q4 0p0 P80s00  h0S~ l Yz* 0L03/Pm !0 儐X09/Pc ʛ00040$0$00(0 00 0S(0  0 H3/P+ X$ 0 03/p6  0L03/ pPpP$0( 0S pP"; W00 40 00040(0$00(0 0$00c<#$‚0  0  0H3/P0`u 0R04$( $ R( 0  0H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0S ,0S~ P0 P  R0P0v 00040(0$00(0 0$00c<#$‚0  0  0H3/PP80s0 00- Q ( 0 S% 0 Rj80X T,3/00T00X0 0\0 $0`0(0d0,00Sz 3/p^p0`0W:0p Sn:Pp`,0 0Um:8務P  0$ 0S0p0$ p  SpD`P 80 p0R:pYP Y:PpW00 U0#S Yp`Ѝ L0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0Pd00   8 rp0hp` o!8p 40U 00 0S 0P*p ` #_80s0 L0 3/P 08400H0, 00,0+$0T00X0pPF 00 80sh p "P=p@-@P(M(0S](`,`0 00P0F0 P P`0(PP,(u(P(Ѝp000͒,6(i0,`(P$-0 h R,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1X!S<1\@17H!L0X!\Sp(0 ,1P"#0@0$'80 ' 0 W %&, 080000, 0 0ٗ0՗80000  0'c.0ŗ0HLH0P (P0!W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000pp 85P,0ڑCXpW* 0GS0.(>P C$ 00S H @3/4pGWp @ 0L0 3/P 00S 0Sp003/J0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0^Q  01/ 0S 2 ;C $Є  0<Pl 0 Hp0  @D@0 ᄀX60X< Pl,0S3pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0&P 000,L,U^ p408  x,, u@9 H^ ;b k^ 0@-@P`4M#}p@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80 s#   ` 002  Ԡ`0SQ,  R) 0 0#Q! Q0 2<{# 8 0 r  1# 000 S   ,7 1 SR0r01/P,!0 /P,p@-@$P x1SP 003/p@{x1xP$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,0_ ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0I⭒pK܍ЍI≏+R*<o=(02#8 ;c&@@ u-O-`0@PMM,0h1h0p 0S (0 S> 9 H 00 0 <0.%#@~40kP`0V,p0U 0000000 0 00000000p 0Sp`ލЍG/ᘒ,0S*< #0+,0B#X0S000C0C0000S0 0,0B$PP, u@-@-0  !<$10(10,1P001.@-@0 0! 0O-4M\T`Xhp(0P  咕"\ @,@;/,P R7P 7PpK jp WpF2 ` 0" ( 00 0`ᢎ >(04ЍO/P4Ѝ[;0p@-@Q* P 0 P40 Pp <0dp@PT 80 P@,0 P00 pdb 'b )b *+p@-PBM `@ w 2 V` Pߓ 0P֓ Bߍp`˓P00Sœ0`40Pp`库80PS<80  4X0S0!@$妓 0 P垓\0 `0S Ш @`卓d0Ph0S @l0S ⶨ@p0SH ⬨@T`it0P^jb 9b :b ;=c >?c c Ac BCEp@-`M<P@M   1U%P 0DPK0 @0S    8PU@- 0 #P% 0"܍p(0S p T@h,0S H J@D00S , @@$^wb c /b c 12c 30p@-M01P@Q#   s  ? 0`N 0S (0S l 3   / ,`V D܍p4Œ  P   0`N 0S (0S     ,`VP妒 $0P坒 0 P㗒0 Pt呒0 P`勒0 PL兒0 P 0 |b c c c c    C-`RGMP@8 : 6  > C"\0S0 `F` tr0p⇞ 0S  H`,p WV o$ Z`夑 0`0"  &ᛑߍ@呑 0  0S  4 `PV 1 `S0N  `t 0  0S @0S @b ߍC^<0040!00␦@0Fo$ 0DL03/00 O0S !0v{D` 0S  (8`Y0,p x Q0X 8 < RFO    G 0@ /6@ 0  m R0_| 0.  b Jc [c ]c hc kc mc c tc wc &c }c c wc .c @-x @+0 @0p0ld @sc @-D @000(0,0000Wd{ @^ꐯc @-hQ`0@sKMP!   01!S=0 Kߍ0 00@ @@0̑P(@UTpp (`0 ᨥ0  0`0`p峑<P< 0" 0 0p@080 0S,P,c `,p-, 8c ,7<,d d t-8,e x&,e e e C0S@- 0@S !1R000 r0S/-Df 20S/O-@`P]MrP2M T]ߍ0 L0@ 3/P P0< $ 0Z:X]vU Y xZ $1 0V!7 0 0p!0 0ѝ1/AS B$1S8  0QH $ 㛑RX[ 0S ((~ >I1P/S L((0(0 00Z0SvU (g  d 0S `P0 1f00!15:%  ZP p Q 0, ($!` $ GP^ 00 8a4Q101Td,-,c Hf f Kf =c Zf f 0S@0@-S@00 0S/-f O-P2EM 2@T P0 |2P p|1S$ $P| 003/P 02P (  Eߍ$0 R P 01/0P 003/P A10SX PaPE  <0 040000,00800 忐pP@3@0S. $P+ 0 x0D 0<,f -g d,Df -g 8,9e -Cg A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0<, -8,-`,p-\0p@-T00P DPPp0AS@  1SA~,,,0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2",l0\ Q0/\P ^U Q0000@-,0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@Ep@a< ((G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P P C  01/P ,00 H$L Q>,80S @- 0  /h m G-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  T P $Q吿 $00S U 0 |1 08ЍpP ὮP P Q i ᬻ P ᩮ  mP P,A-Mp}P8 T U`ЍGP $A003/0 R   01/`P 003/@P$a0H03/0 `' WFP2 p0803/PDA 0!! `b8# `00  3/P"#"#00 03/p p0` L03/l +u` 0SWp`@`C88 0U 0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv  0 |1 0=8i h  P,G-`RM@Xr APP dP`T `2SP P9  ,Ώp  0S  csߍ<0H(00,0 00004008004004 04$0D0(0P vW[  夏pU l垏p* `\$m` 8 -  8uS ,S  S S S 0,0S0 S `  Fp 0`?`a8SڜPb 0  0**0P0ܴ m 0* Ki d@edAbi zd@i zi i i i i i i i A-@Mp`;@@ Dp@ݍ P@00@᷍T 0 2 "0  /O-4MFpT(t$ ,`&X\p@T  0fYY 0 0<R- R 0Xppͱ @P R$ P#2Q4ЍS0< 0 Y+Q X( Q   0T pTp 0pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0pWW  00 R R\p\ ؀0@-4MP!! 0  P PP@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-` ^ PYp|Z? 'Pd0 2p! t!l14 80 00 PpW00`,k @j k @-00@T ^3#%:/o" ^Q0 y0\ Q    $ ( ,   @l G-M0QU% `p{@0 @ P0S X U @ ,p0Coލl l m m A-0P@pUP3#:/o"P RP`0SD|W@000000P`,O-]MM`0@ p6ŝ06TP 3 # U:/o"P RK\  ZMD R R0 "1t 0 0P !R`31Q H @D#-#-@0S D0S'# #@ 0"ߐ;.!PP 0 p50S ᗊ]ލЍ@ JR0 D@@0S Ѐ $@ p (,0[X $0[  zP0 ΋Pe 0000ZI Z[ ZD0S0 \1C@> R0 >t!z000㓛#000X  :  ,╋( [: &{T  P ؀!\R 0 0 B@"0St 0 0@ H0 0S4 4 0@j m yd|d&m {dЀm m m m 0$\ (00t S S  S00/Q 0P/0S 0S P//!R80@-4 :CR )r0@/m  80R*@-0M@"P0 0! 0! P0Ѝ/00S/`,_p@-,P@0S0S< 04 p`,@-@0S`,A-pP@0ST 0S` @ P<0@P`V@`,s@-S@P ' dP A|Ѝp<P 6|`P (PP )P` P P(  `P` D {PdOPP 0SL` P kP @0`0@0#n *n 0n 6n >n @n Wn l p@-M  vP ڔy ?@P"` yЍpPO0S 0 (q PyPyZn }n n pn O-@QMM@P;.,@pP}0` Fpw p㒈00p$@ @Q&D0S8 CR0 ) 0 ⑂P[0D04@T.4@0@T50@`T$00 0 G p P P    00wP  p$ pp00#U؀8y@0V  00# l#C000G %`#APQލЍ04 040RP8< 8<0RPnx00 S 00#PD tvP #xP@p Y #YLP@k P # xP0'% D00S00 D hأ0 S 0 0 0 `Ł@0x0#Q@#000@10 4㮁d@n 0o n n n o o Go ;o oo 0@-M 0zt 0@S( wxP\lxx0P @8⣍8 P$0$  B@{Ѝo so o @-u0SЍ@-@M tT0  CR$00S ЍwA-pP@0ST 0S` @PP1: 6#Q  p#p0 0,0)P,0 0 '#Q?0$0>0 0=00<00;0\ 0:00(09DЍ ppW0`VpDr t G-pP8M@(P2 0S 0( " " 010 020 0008Ѝ70 0600500400300100000.00  ,0f P #00R R R l `P (P 0h#(00202000Xu Dr p@-`PhM" P@0@$00| 0 0(0 0P0 0@00T00T 00T01T01T00妈 (6/UhЍpDr t O-PM@8 SHo*@PT `PVr``PT\0(Ѝp!SQ0P ؁1/T 00\w O-DM 000 0 0 0 {p 00@4p@T0@4p800,00  (0$ gp ,08<\`?! (0_%"T0$ P_5#$<0_.8̅P R0^W I PSuT h"?L1 0@LH0 R p ? 0 /G$7@ T S@``000 00  0 p  R02# !"8 0/RSYL0 V`0 0P0pZnYXDЍ,/C-`@40M` }p\ X \^ PRPR VS  RQ \R  0    ;pЍO-y @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0pt, -08S^:/ -(- p@-@ 0(  P0R0PS 00Sk RppM-Pp`NM@< Рp`0| p ` 000 ;$PP <|pzNލz Hz ydG-xM` @pᜐ堠dP" !0@P 0S PU 0 R=H!H0 bB00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZD   YZ  WLTz {z z z O-p@PBM M`/0;P( ↤0P@0P0iP) Y  $;$  g P!14"S5 0Syto@ U01U01Bލ Ѝ ~h0P0  g?XY$0 0I0,j?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q  @0 0@QD 0H 0L0@!1F41Q 04 8 <" 0P峦@ឦ@Q Q' Q0PUTi 0"0S0S0@0iP P `@@=02s 2 02@F @DURX A- 0MHd l1lR/ fC:Ph@P( T00 0R`0 !?020 2002p$04 pi0Ѝ! 0S" $0Q00 L03/P Q 0D Q 0 SD S003/Ey > -P/@-\ @  0 2BS02D0C@AuOvO0w.#8\0 A- P\\0@@ \ 8\ @T i@ `Č `Ȍ `̌b` ` p SČpȌ` 2aaa0q1P eip`T8B{P08} ^\ 0Sp`82S04@11111111108 q2aqR 2@S22G040TP 2SX9T0S  z O-cMM00 QP ,00#.;0P 0`cލЍ0 J[yp \6X&`RS000o?00@ , -Y 2S 1S,2,/ 0@0 Ḁἰ  &      0S@p!?⩻D  0 eD U <  uePWbV w R $0X&0 p1Wp!p'q ?p? @p0Wp!p'q??p$0f@P   p5e?WU E ,   p"eNh?W U `d@x Us@-RU0 B@W@(`\0\ CŠ"; P0@0`04 oЍpz { @-@ ^ @ TD@@@ Pp` TPPVPU Sp    L"4 0"8 0.4 0@.800 0",<< . 0 -,O-@|MHp4 (P   RD }$$P YY P^ 8RP QW# 40 RQ }_PbV VZY RP``P`V W4p|ЍRE  0 WZZ 00` ^ V ^Z Y  `VRU` P  ( U S"!RQ8"H  @08    0 4  D "< ! ", , "S01@ 5 @ D pF W2zP Q PY Ƒ Y ( [Q"R$PQ  R1/  "#(SW] fY D0@ S(0, 02o(0HHLPTpPB 80 Ă2 R020S PP fh00S0 0!40S`1 0U0 <0 1R o 0t$  RQ   0ST0`,2 Q HW(0 -!{ x{ x TPlO-@MP0Y00000 RP8L(L0/C tR4  XD00P}/ $00800 0 U"oQP RP"4!8$ 0S40$ 00SR 0XSY l70XYX7$004 0Z00/$ 00(0800,0(0, Z00"0 <0 0@0<0 000@00400 (0S,04 08B4Y6u?v/0808 S 0 S4 1YP6BT@q?r/`0sh2`0 (  R   T R00S4000D0zdpPD0GY50\6o_P 0"P0S PP eA0$ 8 @ U 0 o?0 R S RQ ' 0^Ѝwτ (0(00,0/ o_S㴂!P# 0 .00S4000@ P0X\0" 0"P,0S PP ;eB `H ` 0  00 V0R0 2@ 0C0 0(<0"0 ^,0,0^ X0\ 0PPT0S PP e尘 0T2S2 R800cP@0"2? 01@22rMUY $00d2d2 2 S 0  p 0 H 4L H0Lp_p L0S000 XRH` 0@@H@ $  $@T$ 0T @ 0 p`  V`V X`\ T040o 04"PP@u0S A<PP d/<PR3C H0HP002S 02#38T 0Ro_PPUPo/ @T \ `TV R \ Q -{ { ,UPC-dM‐@Y`p 0P 04##0 PPPY dЍ003/00S 00  0!!2 P02V 0P ( jP 00D0"#"# 0 cP8

S@ P0yx P0dY0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\ЍQ| ,G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/,>0@-@0M 410810!b0 P0u0L b0 J0PU ! 5/Ѝ0,T| @- |Gs@ q@-@ 0]  xus} x&@-<@0sq(00pp`0Cola&  <P  0 !   Cmp0 S 09S 1Ѝp0 S   000 00P0 PS @ \0 C p@  Ѝp@ p : dp@-@$`P[Pp0 @ `P0 001 0pp@-SP@`xM  OAj0 0mp@)  mp$  mp mp  lp  P  D0  p(AxЍpt lm d0 0 s@->@P`Dp @ p0 p`$Aq L01p @ 00 p$A^Ѝpp} `p@-@PqP  l0}1LpP`qpR l0"18pp@-pM0 p @ tlpsl@pЍO-QMMڲ700ۍЍ e  Z  @`V l@pP` @-`R00 ЍPp@0ST[@PT  Q*R@00 S   0 0S0 S *6\P ` ] ] W 00000`0 @@P0   d@-@@k ꤁ L1p@-S@T1S"d1S,tRU6\RUp`bV7\\\bp1C\L10CL1SP\0P11C\T10CT1SXʹ\0X11C\d10Cd1Shʬ\0h1x2,P0Cx2xbVt\tb`2,P0C`27@-@0 PP$ H1 0D1<1-@80@ CB Ѝ0@6 Ѝ0Q@-@   b>kP p 00\ Ѝ@ Q @ ,0. p-Ѝ@ Ѝ軁 Q@-@  0A  kP p r00 Ѝ@ 1Se70|\YP| 01@ 00 pAЍ@ Ѝ @-t0M0@Q0$*p Ѝ s  081/@-@di'P0S yP 0800L0S S@BP'S I @-p@\M Q t0 = Mp\Ѝ[ 0@-800@@@?P@-@p ?2 @ c Q7@-@  ,A; _ Bdjp & Pj Ѝ0@ P 11P,|1@ R  |&AQP x`00CS`0 Xr@ P06 p ,A Ѝ0@ X0 X Ѝ0{ hx&x& p@-PDjp4p@ @jp p@$jꌂ p@-@4P   0F8 p@, >꤁ p@-P`80S0&0 Pp P W  g03?0 0S %/0p@-8@` Z40 :0HP PpP  Pp%pp@-8a%PUp@- ꈃ 0S/8p@- 0p\p P@U  <%<1 x1pQp@ 0Spꒃ @-t0@SPLM 0$Q0@N(p 00 p0 `P  LЍUP @  P "U` H10D1ꚃ O-@PP 0p4` R ( 0 w08   Z0 0 XU HP  *< 0S 08   Ѝ؃ @-| R xDH!0 ЍA-@x0P P ЍAp E 0 `  0  [ 0x1PU 0" 0SZHP ЍADT 0S 800 P P ] Ѝ ! - A- M@`; p[,0PSL`$& 800 + PJ 0Sz PuPUv 0 `8PU=,P  D) ЍA#0<1 xQ EA#E;080SK $0P    p0S  U8 A ЍA W0 0S V  P0S t`QP  {+t R .P 0S X; 0S 04# ЍA ЍX s ̄  A  0@-@x P $ LT@- L0p@-S@P` 08PU $00P  X 81 0800S>? $0080S  p,s A< p k p@ @-@@O--M`@0pRPU@T.Ѝ $P X  R$ R#W 080 C #0   C0800 ?@ G@X 0 0'|fWUP0|$ 0|x0p  A-H@ CPPj q`0 ,Up 0 pЍP- P P/ P5 hP? PPQ IE@6 p$P  H :0801 P #P @p )@yVD!\10B0H1x.h 9@ix LPʟ 0P  ( P d t @-@  A@t ,ep `3P<1 ^,,e0,1ЍPH0/M<1 P7څ ԅ ) Q/@-@ z 0S@C-q`@ x @P00@ 0S  >0 Sx   0@ Ѝ<1  0H pPp @P 0@0PE5V ( x PP 0S  $0$0> R>  **mX  0S @0 S   000x1  @  0SP Lm 0 0 S   0$> U l 0A-M P0 0E0@!0Eep}00`+d`pLQ^w07S 0 S X \O0E 0\!`1  `Px1 ,Mލ % R Pp P0 S   x0  pP 0PPUyUxex  xk dx1p  P  0S 0\ 0P Q@-@  p A@*p07S@Z0 S 0VS0S@ A-`R@p@M P'P U m700 "@ЍAP"R 0S 0 r>XU%  *P 0S <0 *2h p  } <0' &tV>P  *@ЍA1@Ѝ = d O-P@$$M`pTP   MP 00A $ЍOx>Px 9P000 PPPXURP    0PEPE 00X  J ST 003#cYpPs 8118100x1`V+ -cPx1`G 81181kP NP 6P4PUPpP xP 0: 0 0nP00P 0S 0 0`  P XX [p 000 0S 0 0`V81181$Ѝ  P XX  7p0 H00V0 0 0 :0F VYx1<1 :<1 0Pc R @ [WP V @(0Ȁ0 00  YB Y 0HȀ0YB !7 X V xx(0P 0S PPVPP0 xv꧇ ȇ ؇ q&h p@-@>Pp0?R02P?00G,003?00> *> 0Cp耼p@-p1PSM"`! $@P T 0p1!V JS 0S X.PP <@tAtЍpp>0S 0x1@T l1S   @>0S@ `l1S   0 @ DP 0  @  B.(0$pl1S ꐐ ʐ  @-MP0@) \.P@ P`pa 0H # ^  @@@P@@@ A00\  L00`B#apЍ\ @P^ `@@p@P`A 0p@-@Pp0@0D0X0\0PP `R0 0P `R000r0p0P PuR00840P PkR08<0pp@-h@`T@@@0St#dPPT00ptQP dh@pO-@RpD@T@P ЍP@`Vt#``T00@OP 0 @QB<84`(``` 0` a@R/qA- 81`0SPp@R000S= @T@T2 0 S   00S0@0 @@00000pp10  0PppW 0 S   00000@@0aq0sO@Ppq0@-PM@ 00Ѝ00S @T00 0  0! 0!  @H0  @ 000`{`pR000q0C0p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M@`qap p P 0p``F\ Ѝ0S *p0 0 0CR00B *S0C00ʚ;G-P`p $0@T 0 S0 R  S 4  0pT@QT 8@T 0 S <  0`0Q 400@4@N@P0S 0S0 @@@-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p9, 0B0 0p"#~ ЍMb@B0@-0\0Q@ PUPUR PU PTP4PP@PPSg00@"!030@-@Pj`p _dP@P@-xN@P  `pO@0 0  0  004  800< l0`p`qp0@- L0S 0 p    Ѝ0M-@(rMp0p0S r 0PRr00q0U0Sl7L 0R Q00 S 4  003/00<00P$|M@M@-@ p !]p !]p`@-q@ \01p \01@ ]p@-PM@`   0 T]p 1@ R! 0 p`Ѝpii$0 /L0s P/P  //@->P\MUV0P0\ЍU700@ p`R0 PU B0>000 <0[  ,> x PP> *d` @-@T=@Q/@-@T>@0P/- R 0 R00^ PG-`P M+0(0S @ ^P P WP:^`P 0!00 0   08S0 00 Ѝ080 300S # `pP `P0P 0iS.S  `P04S 040:S&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   <@P @-u000Q/Px1P/$0/@-@M    0 l\pЍ~iO-YM `F/@H9X0IpPpYߍ0pK 0S 0S PP@ Y MP @T0SL0AP 0@S0@S@@T1S X1 oPAT1S@\1S`1 aP5\1 S S R@L1SP1 PP&L1PC_oSRPU@XP04S 0s0P?AB@@$P00SLQU !JPPdh1 P Pd1UP H@ `  0[$0D  H `0 S v9X001H \0[p X0 PB000S0 15S4 S  CR.T X L@@7S! y r R02 > 0*<81 000S p S 0 S E@@0?H0p 0P0H0}>H0 @f000L0PPPꆑ ɑ i @ A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ R @ZY-Ȁ 5S @0s0 50A % 1@ A  + A+": A !9 R50,@-`p}@P@ Ѝ C0PX0J.Jp Q,P }PPD K @-`RpP$M 0S0U00$Ѝ/@P 0 00 0  30S dU 7PP, T/00DU 7N _ O-`@0p"S0W"SpG` Y PP u700 ЍTU YP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R  T0 `T 00T 0T 0000 0    00 PP 0S& T  s>0 `P0A\0SP0S  \>T PT0P, &P /0 S S /S/P0/S S S/0/O-M |PPЍO=`P ЍOH@Y@S   pWH|PP  P 0QA00Ѝ=c0@S. <P( 0S l|@PfH@`@G0P 0 @ 0 0 @ @v p@-@P H` 0SPH$` PP(0S $H0(0$0p,e P,e PO-@/4M10C`pXPS00 pHU- :`Pp $=P@ ^P7 7  '$ !0P`0@T\0@T U0 @2 0H050U( H0lh>0P #H0 F@PA t014ЍEP 0 2pA 0S PG01@U  CUH070 0  p  P! .R8 Y 0R77@0U   0pP  H RU H0@1Se{@H000|U -P0H0r ,0 00 0 J,0S4 a J|U ,0!00 0 ,0 S L Uv <1F80w40xbt000 0 PPP00 0  P  p@0  @P , UH <180w40xbt0p00 0 PP00 0 P  0@H0:0H P 0<0UH# 0S /`P /`P00 V /0P0 Q00<0000H060U ,0 00 0 @J,0HSL  Ah 0A  ap  P 4p@AK0  U \U ,K`P 0SU0 pH0 50h x050,0 % 00 0 ,00,Y`$ UPPeU700 5$'0 5'@p 0 .  0 p P" H0@40U 0S 4S 04S0:006S 06S090 PU- ,0 00 0 I,0HS  U H0P SPH0;00H090U ` m`,pP C`P 0%)[ CEH0Q7;0UlQ _P0l1 tXP0l1 \QP0l1 &P pD0Pvp1tH000U10H 2{.P0H 2s &P 0H 2k P PH| ] H000WH020RU @ 0pP$b H0 S;70?H020:H0605H0;00H080+UV <1&8xb0w4t00 0 P000 0 P0P0P@U2 <18x04gtr000 0 P00 0 PP00 0 Pp@0  @U =PD 8p pPWH0p000 SP0<00 UP WH p P  EPWHp   X8P  D2P  0,P  &PwWHR  Bo|P  ($yp< 00y8 pa&ד    ; W j Δ Ք  H % 3 6 : ? D H M U l u ĕ ӕ  " + : ? N [ {  ʓ  : M ^ ,6p 00lpP3 $ (} H,8y  P B+ P*WH B $p =pP ((O (L H$8H  P  B wP  qPW ,0 00 0D LG,0HS M UPE /o"B ($P/`P0H (0ΕP 7$ ! (0'0 ($P/BP0H  (0P 7$ ! (0 '0dU H0^X UDXXH020SH0 000M5gH000EH000@H0 00;H0 006(07600R 2 d *_ 450S00T01=5 =50H0UB <10(@0P@47x0'tP 0SU) H$,CvP$U 81 800 ,0 00 0 qF,0S0H0800 (PP0 0 P 0 0]H010H010H000H050H050H000H,';,UH090AK3O0\ U0` 0 YAKοOAK OAKҿO+U \0@T$(@" |`P  ,00E,0 S8pPPH  ]`P0:0pP { {{,0{0E,XCPsJP;`Pp =Ppp"CPp2P#`Px $CP%P`Pz CPP`Pv CPF P`P| ~CPpQ wCPyJ qCP9|   @28|?o2= V [ 20Sk YP0, PPA@CPP`PqM2CPr ,CP p0S P\00CPs (CP .CPp 3 CPp :CPp CP p 0BP@p 0 BPx |0BP(twm җ ؗ . 4 @  + @@U ʓ  ؘ t L y ę   0 @0BPuI \0BPu |B |0#BPu: 0)BP|4 BPws 06BPwl 0 BP| BP| BPvV PP0P0uB`Pr t`P  R  R 0,PS0P , S%00 0$0(00 `0X`0 P@}@ ( dY`0P ʎIY\0PY YU@HP70P7H0"800H080|H07 00vH070qU &6P0X2iX2S$H000^H070YU d`P 00k`sHРP؀J P PVJ6 sP P+1Ȁ0'H040"H030H, 4,H020U= p0 epH  H000H000H0@00U ,0 00 0 }C,0HS ~U ,0 00 0 hC,0HSl iU ,0 00 0 SC,0HS T KO-pУ@`Pr8P TP `nV<1P ЍO{R('RZ0 078 ЍOA ЍD W H O-S@M5 P 0Q  8p`tj⬰<1 0  0@0~Dp0@   p   P@ X 8 *  Ѝq& j h P-G-@`pPU T =PPPa@@P  ڵTL?0S DD0 !^@D@DYT 0: @/@ T A-PQH 1pS`01S`5x1hS`8  ??$?0g47S90 ?8g<7S:8?@gD7S;@?HgL7S<H>(>A>> 1`P>>1`P>X  BP T0 ST=47,`0C476<7,`0C<7/D7,`0CD7(L7,`0CL7O-MLM`h$ 0z=PTWbxP E3&7 E0 + 0+0 0P70P7( H0E00 0:00 30000% p {M +8 0 E 0d0 E+ 0 P#Z 1H@[0X,#=P0047(״P @5: ؍LЍDP #PA0 D  D 0 0J<DP078t2470x24,0<'哸 R38>@,0D'哸 R-@ >0H'87\"L'<7@7D7`"H7L708 p0  +@0S R R P\R @MJ0@ R (#P0 00 a?op2 000S002p0p@p(0 DDP 0 0# 00tD?P P0( & D  P;P5 Z$d h➏pP#22C8(, ,0@0S 0 S S0P\S  @ :0p  3PphqdqPd p(0 P$0S P $1 P 0S P Ppp} 0 0# 0 Pp Xn0D00D00 0  0Cb 0 S E:$ E000Xe ب xS-@ t p 0Q//Q *///G-p000@0P `P Y 0 0 `R:S@C@3@D"X HGU( IG"A-TpW0 %T`@V0? C.CL0LS @sP spX X| |00 S HH0P 0RS < p@-P @Pp <@-p@-@Pp PPpT Pp@1@-0@.T 0@0T0S0@- eB@G T0A-p `R0080810@: PP?W0A U t0  t0 p@F0S d p;0S <p? @U4 fJ.P P @$T T0Rt0t 0SnPt0 t0 88cPT0$0x x0R Pg@OP0S J@  +  : A-`P Pc_@T T0pS@p@-Q Mz 0 zBT0S0e PUx x0 BPc_`@P 0 8 O   Ѝp萧 P k G-} G*:SR0M" P0 ˿(ȿ ſ  #P  @0A0 0(P  0Ѝ lB u@T|   nT0 R0 0800, P T8p(0SS90SS₿PT0c z| `P 7 R|0   P @T T0R88oPY0Sx x0R C' >⤿T 00 XXXNPR 9P T T0R88=Pk0  p0VS p/c_ @TG ۿ0`SS-90SS)PT00S8 00 G*: S R  j p 0S 0S @ƿ,T 00, ᓿ@P | Ũ Ψ Q00@-@1LS? @q@dR@l̠ BR00 1BS@P@-40; 0S A/00 P@-40QD 0S ./00 P@-L0}O 0S So/00 P@-H0a 0S Sp/00 P@-L0o 0S S$0@o/00  hp@-@Q0 eCRP0_ C|C0`S0 SQ 0X Mp@p0 p@`0 p@3f {} 0P@-|0| CmQh0i CC P R !P BR #@A@荩  p@-PP M0 E0S0S 3?@c@Ood@T $S a0@0 ЍpZ/0@``Q  0000P 0 CC S- 'A-0S00@Pd` pW &/0000Pp 0 CS-Щ nP@-<0<.Q(0v CB!>000  @-@QBM @ C-`TM@ P `(dp) 0 Pd ````_d1pWp0`V& Kd @ 0 F@ dT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0ꌐ \ -3@- P bp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp  ppH A-0Pp`@S:0SS 0? C/C  RS* R0 $ `V1S* P a 0@DpR: Q ꡪ N O-A 0MTP` 0 vu?@PAH{@E081 0S  wp 00<PЀ 6P 1P ,P 'P "P P pPp 0S h Cp X61T!R D9p 0;1#3K00&&*pа L0S% %S  p H p P p $  p : pw P0S t0$0Q0p P pe 0Sz08!K0x1ZsfLp M ₼Pw lp@ l咼P0hd p1  tp+ %P %P0 x1`@ $p X00SXppW0h 1SP኉p@H{޸sP  >|p 1FF upp%` lp~ 0S P rQ Z T  Kp  r"BKp4 P{ $Pv Pq xPl Pg P P X00S 0Sa Ta FQp\%P `V%RY pTr0S]   Gpg 08!lpM^pJ0SL   < 1pQ 08!p<HpPB 1 R6 0S  P4 Ѝ 0Sp plP     ! + = E N V  | Ӫ ت ު ˫ ԫ |  6 ޫ  ( H L p@-P@pp p@RRA-P`@@pL0s  S$0 U@ p@@@dW0S R H R U p!  Q p@-P0U@S ڿ00p @P@Aሹ@T:幱p/Y hx&@-P`1pSMAT  p@x Ѝ `ϺPЍ@!R 00 0 0 p@ @aV 0 !p@{`P ☡p m0S |00#40  L< SP :6,0 %^ o t \ A-PP 0S @0p 0S @@000 S U   ^ @ .S0.S0_S-S```&00  @R"0T0 0D0& @- @0P PT00Q    DP `00CS`0p S00 P0S X0X /X,Jx&p@-h1@SP^gPPE @p 0.SSPP XйP H˹P 4幹P 0  .ЮPPl s } p@-@P'Uh 0 H0 H0 xH0  hH0\/T,L)D& <#@4 , $      ~H0  yH0  tH0 oH0 jH0 eH Ip@x DPꈭ ȭ ϭ ڭ    ! & / 8 A L hx& 0(HLǒ -\ \` Q^ ,\ ,@-QMM@pPYp  0B BGQލЍA> 0!>0 0B Gp`0SPE@E p 0S:0@0Dd O--,Md`pP. e|`  @P?2 0S  宸P@ 娸eP@,P$ X]P$0X2 2l00,Ѝ P,P, R ᑸP,PE0S h R* 02L0 X5$ R, R oP E5$ R R ,Ph!@P !!! z P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 ᔻ.0 I@0 0IU:D X0 0 `TT  DSPO-Pp0` 2" Y*Q@ U V]700 Ѝ$@@P`Fp  G00U V 00  P     @3 \Do   ' T/T$\T0 U V@@U V\$0@00@@`FPpU V @`Fp~&l C-RM MPLp`Hp< @x;pF Fp㜓 V=p ;4 FpTN    0 4Ip PB IaP I/    Rލ Ѝ   20V002 0@I p h @`p1P 8$`Fp @T*npP0P 0S4 a`@T*T  >Fp @ Lp{ t h /r (Fpm @ 0/r   2/Fp[ @@ 2/ H  %  ù FR .0I/P: I/Ep4 0S @00SP%<Ep$00 ꙮ   A- @pTPM  ЍR` R ƺ00P0S 0 -0 0t0#0Q0 A$ V0B  00 0DǮ O-4MX@p 0S\`d` (0S<0 `p40 4ЍO 0  ,   xp0,0 ,0SPFP ,@lp 000 ), /4ЍP V0 00 0U0  x 0,pVp0X0 0 `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  08,P  p@-P@`P 0S P$`(0Sp,e P,e P  0'>0@-MMP+ p P0@ۍЍ0;0 C@P +P @- PΠ R00\L  ^@-Qu00P`PV0 V=`V xЍp@@T   `0x@ `DPЍp`Vx1@P K0>0S *P PU@wP PP/`,/0P@-404 Q 0 9 C/C @p  A-` (M 00>0@SP  0'0x B0epp ᭷0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xSPT (Ѝ0 8 0>0S 0xPT A-`lVPPFPPp2X@p`Ehm,P hpl"h20 吷V0  =l20l2@-`@MpP! , (( (⨣X( 8p=PU@ T^700@Ѝ Xi///p@-$aMY@U 0]  *PPЍp 3"Qvp 000)00<p^p0000@ 0<pl w 00 " 0<p<l Ip 3`p ι p@-QUp@p ;,0h1p@,@->`GMV 0P0Gߍ@PF/ ᔶ9  0l0 p 1`ж0 DF?<P> *ö0 F?< ii@-@M~P4@ $޲P P@Ѝ Q@0@-< Cg0SSP`///8 $0 /Lp/@-Q @ ?t0@0Q00@-P@,M(  $  ᤢ P<p 0 00S p,Ѝ08i(p@-@MP  `  {  (PU<PЍp:iO-PQMM@3@ CT0S(3 CCpW 3  CC@H`"˵0J01801\0t0 P00K`T0`V3P `0P0T00T0 P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0 0FT0T(@)@@Fw@  弱ỵ T0R  B  @ Y? H1F0FᶰF @T0  ᝵YI @T0 0F0FᶰF @T0  XP ႵUPPEPP@ D$r 9p`ݍЍ  =  gYI @S g z  C-`p"0M` 0$`  0r,pP @T*Ѝ`*PPA   0Z,p%0 S *@ ``T*x0V*00*T00V:0 (P| P@Z ( ᘰY 0@P꒺ @-`@DM pP@  ᙴ  !> U 134  R2$ $@0 DЍUi@i@-l@QM  p00p l2 0"h2y:Ѝ@-]MM`@FP#69p PP VR 000S0S S SS wR0S HapsVPS CQRS 0  Vxp@P V$0 Bp 0S$H`  რ h^:p 5 $ L J80Su S S00,0S  R000@0S  R00@ H @ 0ҳ HR!>50H \0):p\ 0S 01S h_Qc0 0 000 0 0p9URZ1S SN F F]ލЍRIx^@P= t@3 3P0 0- H)@9TY$0S! H⼳M PPN0 40~Qii@ @-40 000 0*Ѝ䴺 2S/2S00/@-@@兴V002@-S0@0 @@wV0002S */ A-PM`p (PP'@P. 0LL`07p0 ,!4>7pPA0Sp T9p PU0S p 7(@! (_( :9p | P39p 7/PP (9p j&P Ѝ@ qB@ lBpBfB@O-@p`0$M00PU  70S;P  0P0S P弱 00SU 1 !  N0P00 0彲P0 PPP0PU:000y $Ѝ@-  8 ЍgBp@-0M2S`P@x (⏲VP@0 \(8v00ލp@  B-$M^ * ! 6$Ѝ@-@6 '@'@-@pp H8p`~B p@-A^ T00p``0@D^ "000txœ\p@Tp0,p/0/Rp@-00@ ^  0s# R0ppP0QRO-M@@0Ҳ0`1Q ʲV00ЍP0p Q :8Q@SH ᷱ넂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C X&P 0 B0 { 0 S2Xj00cSc@-@ 000P 0S00 Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S8Ѝ@-@\0S \0\0@-@`q0 `50`0@-@08$:@0p@-800@P >0S0&0T0T0x1 RpR 0S TT0Q  0800 >0S  p@B p@-`PK@N%Pp00,000S00 /0KpcScO-@GM`АQp  Gߍ0RS*R?  0 000KC%PP d0S  FRV ( Q  R l(Qh 0 00> 0200BS *s0 360 RS00 Tg K4 pB' `$pQ@ DPV VdP h00Q 20000$0@00$Q DQV0S <0S 0GS60000<0@0V0GS 800006 S0@0 0Fq2!31 0 d %R  GR0+  %A C %0 @V 8    GRr2   0@08 R  GRd3   0GSY 700 0 0t2@,0 x" R 07 ,04'R SK5 FP%*p<0fSV (1S 0 G0S=00(  ⎯(100@0S W0 2S 0 GS<0 0 " u 20@V081 0 Z00 GR P0@  2S P :0 GSQ0Y0 0 2 0000Y00 @  "@V 00  ^00GSt0`0`@h 6S 0pGS^00 &A  60@wV.;(, "r  P V: ART ,0.,S P R:(, "r   PV: ART\  ,0  00D0C0W0 0GSL900000@CpD 4S Y 0 GS8M00 $A ⦮ 40@B?S6? B?S6s 00PD0 KS:KUKe 0 S0P0"1P ?0G R 0   z @@ 04 $S [ & cSc5N i 7@-P\ R&@P\U0S x0x08  Ѝ0P @ 00p(e& @-PR1 `0@ 0p\ 0C R1 00 R0  06 30 0 0P0 0:0 00P00;0 00P0060 00P00 ЍP 0000000 00yp0 00mp0 00근 C-@PTM -"P@, 000`0001iH00 P00 x0`  (C#0(10: P  P( # 8@  ' 0ta P( ``(1 (1  0(t!pg0 +"70 (P 0B y>``v` P( `"(1* (> >Qߍ 0*"   .   0@-p M$M0i0PS` G1!pp1p@0S i lp ۍ$Ѝi@ +0 9Pp  `81Q50 00pPI P(@ 8 x&$ O e @- 0080@P PU@ 0S@ ( `P@Ѝp 00O-IMPpPHLL `PR a @P0IߍOH"0,0B"600 04400` 0 p00,0 PS2 V30$a2@0 0 !,0T:0 ` OP :U@PIߍO@:0 P '7V`` 0\`0T:0 8`$:0 Pꑽ @ ½ G-@pPQP,tb,`x2S#PU`,@ ,x[7P`T7, Q 0S ,9$F7 tP,`0н RG-00!`p@0PT:p T  X ⢑00U *̬"0 pЍ0R0  ⾫ @%:0 47p :  7p p@-RMM000PS`B S@ 00 0pۍЍpd p p `F0D9, d7p Vr @- 81SsQ S0 00 0tPЍ 0SJDPD3pO-04MS@ h@@ `_0P o0 00 0 KP |3 00 y0 @PX3 0 0S0@0e00T0u @P0n 00 0 %`Pe 0 $ ( _X]pPv 0$,0(,8 eP@ Z0!   Q*׫"00pP 0$00S  $ʪ0 j0(0p,00t0$(,8 -P@0Sh0` 0h0 l 0304Ѝ 00 !0 pP @ |Z{0p$00S,0 P@,0$S  S S0t0p0P !R "R_p( $>(;,88 P@   O-P0M040@`0 `2''`pp'`W9 pW6l0S,0S`,0tr0v x2S`,080w0v 847S`,0\r0v `"Rtr0,p80x2 Sp0匳0g47S \8 0` Spߍ0(000 `2(p(`  `(A8 0 8p (` 0 .p 00 `2,gp $8 0 p,8 0` p'0z0,804l0$ 40pl'0k@0!04,0 40p]`]`d`k,0 !P !404ǜ R10 `"`P' 00$100,0G0 ` 0 X00, }R0SOQP 0H ` `  00,p6S  ,0 !P !0 `"EP 00@ 0  0lp,`ꀳ. ? Q c x  @ p@-PUp@0L0pp@- P# M7p 0` 0 ` 0@.p-@ Ѝp ` 0.p )X` 0.p  00; U100.p@-p@`P81/(080000'0S  0R  dp`L Ѝ@3@ 000pA@ Ѝ@ Ѝ豾 O-`@p 0SP$H` *000 0 0 `00`0! Р80 `  $6' 00003H081y H ЍO|<0 $6뜳 {000H@0Sp3H000s$80406 HgS 0v0008 R#:kg{{'{z40S' zkg{{'{ z0زS+d0S( $0P$h0!m6 00"R::kg{{'{*zdA8 S zkg{{'{* z03$J6 00H0S0ST h Q 0R<0S 0S11H000s8040 P14 P18 Pp10 #\00@0S0i ,0.0 0p 0h` O P0 /0S00H s P 0dh0 ЍO Ѝ ?? ۾   ) ȿ I x  3 I \ p@-@P9T  (00@x1S0pS|q |+0|2p +02022p R Rp0A-p@`0P S pH pph0 00 00`ppd0h0  -0 0 0$003 0 AAs p@-P@UM R 0 Ѝp@0H8003  l0 R,  0i0P% 0S" <0S 0 $ ``5  | 0 @<0 jЍp0 Ѝp@n{ O-R@`pP\M$P X0 #3P 0 RT0|00 p` hPP. cL0S0 0@S@0#/L0} |?I00P X0 "2P 0 Rzgjzzz{T0Nd0S  $$ P $[ <Y y& H" @"p  $P(P Q ,  0  <  @ , D  0H  <48`LPPPTP|*pZ LpS 0 0bPPI  0v` 0h10 p E000M|@0`0v P00 0\ 0S`ev  묦04S 1S0810 p  FX @0 \Ѝ7S zD CDC< d q M  4@-`@pP`f0 zh0X $7S R @`0L0 , ` 3 0 Ѝ@4   ط{ v p@-P@ $ 0 00L0p@  hp@-PUp00CSp@0@ +$3  (;000L0p@x  A-`P@ p_ N800 a B000@ 0<0L00A8 % h YA-P`@ 0h 0R0P5 081HAp` P!081( AP     Pl l 0 ]B@` 0d 0 P{ $PA7 i r h00h0 C-p@ PR0  R $ RP508Ȁ `2  i@0S NPP ? P0 P lHw81 0S; 0 S<$1  0 <`0  @ R 0P yЍG 0PS 0 PD0A "0 00 0SЍGЍ * cSc8 U m 40p@-800@P  Hh00h00L0p@$` Ffi \/0S/0> d0S  0R/L. / O-0M0 0PS000p ,8 0`S@ T0S 0 ЍO> R*P7S Ǚ ǙY  SN0  @ !  Q 0 S:500 0dp00 00  ЍO Y 0 0Cs0&0S0 S0L0 \p    0P 0 0 E0SY0@60@ 600 0#p0 0  `P | 0 S 081H{i@06P >P0S0 0<S<0P0Ѝ0    0XP 0Y6S700S0 l00 0P R`532Y@0KSK?34%05+0 JY0S0 ?  P   C [ i+0 l4 @0S Y0 % 2)  Br  Br0  3 $ 0P 0   0 Y 2 0  p3@S R@00Y$00D0<0<081(?0< P0 P5 0000  000 0P00S* P *   pb @ 0iЍO5600 0<P0 (0S * P  p3`81 000H 0 000 `0`Y0K\0S   0X!YP 0 8 R @1ЍOMY 0 cY 0 40Sg0 00 P0PY0 )@. x ЍO w # ? O a m x D F  4( % 6 S p@-@l PT. 0 Lp@ `D N\P d  p@r`$ O-4M@PP Q0 4ЍOPE ๆUPp @RL RIpUD:paV@ U=:$ ^P3U0:" R-   UP% 1S 0Q00R0<2  ;4  5P -  04Ѝ0 C 0 Bi p@-` MQP\@M  t0000x p 0S T A @T ۍЍp 0\`V \@T $ G-`Pp 0x1@TT 0S R T0S> R*|P  0 @? A- p`@PpA PU- 0 HA 0S 0A\0S 0Ab o G-0 ;M0MNp`p Dd`870 P480EL80H8$0ED80@X@8<8 ` m@W0|` 0E 0"p$ݍ0Ѝ`   7@-PX0B @P 0S.0>8 Q0'Q'+ " B r R "'    00 Ѝ0@p}t zgjzzP+S, 1@ 0 Ѝ0zD p@-@P0( Uph0Spp@XO-P`@T Q Pd0S r 0 0d0G)P0BQ 0S 0P +,  0800 |#  81- 8 0 $ 0R0hd`h08 R0 , 00C0 0800<0  P`00 *0 00S $0 pWp1s00 2   0P C @RR 00pwpWH0H0Ht0p ۾ 0/@-0P s0 @Rp@-%00p0`PQPE@ `Ϝ @d@$,b p0P @-P 1S P/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScG-` x1PM@T+ 0S pW$ P ℗ PPP@h0 d0S4 tmd0 0S ,PPPЍ|0d 0|0 00d0 00090 P p8PP  |b PP$0 00 PP 00d8dX<V ΗPPq |0x 0|0h0d|00|0XDU 0S lP 8 g P  NU` P < 0$Q S "  Q  ቗Pp h  5< 0   `ipP< t0<0t0A0 0<0 807dxQY X- UP s  U DpP bАY $0% h  5< 0 5  `0<0|| f * p@-PP1 yC͙  p`01S 0S 0S 0S  (;0 @T 0Q0 PSP 0wU d0S0h0d0p@   p@-@T PP@0p7 G-Pp`P@Ѝ0E @P00 4 @P 0P000000 000(<0  W%$0 P pEp(0 ppX0S <0 EP  0@R 0 0000@@[ h Q @-@T PQ0 8 00*:SR h0S dP HS` Ѝz$`  Pdp (0Q,0Q  ! `P Z800000( ,0BP0S  0h dW $0Q 0h0d`80SHV 0S/0S/   O-MPH0<`R8 0@xP00ЍpP P0 U@ UP R R R0 P 0S8Y0000000Cs @UЍO4 @PЍO p    @@0 0'0 -$ S h 0S/G-P@M T 0p `xK00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000p谓T P 00p0000 S0 @00:S 0S @\S000@:S @S-&0@-P:P@A0 P\:R \:\P@\\ @R0/e& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO0E`VK `0P0E@ PP_ 00pCލ Ѝ@@q ;04pW p40(0= P 0 `R0 :R `d4@0  0(880P4 PF0 {0S  p PP ;000P p 0S#0 0 0׎p8`@Z + 80P R 00SF @ @ 0P 0O008`0 SWC p@DW:SY @\Sp S Spp00T:C P@D h 0SQ gNp0P0@ 0 Y@S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0> P0@DJ`F  0S  X 002  @ ` P D,0~  ~,0@PE P0S $ D0A00T* PP 0P:SVrS-e& @-0  0 Ѝ@-(@ P R0 0S-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ Mx0Pv Ps @ RR Q0"P ލЍ 2x0P P 0@P7R0 PP U L"P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  S-& p@-@PDp@NG-`= @P@ d PiJ 00@^S0S:SQ @0 R0FAd P= \S@0S:S: 0C\ 00C Z @ 00CY~0TS @ ASBC\ 00bC|^\ 00:0 0 0Pd 0:SS0AR0@A P Pd p A-p= `P@ d4 PPd0`F˖ 00@0S @Ad Pn Pd0 :RRAS@A ~ P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P {!PS- G-A0SRPp`ʏ PU00Ѝ ᕆP00CS0Q Pp0 }Y( gP s, oP 6P00SW  R00S 047σ,P R   S@T PR   R S-V-) S-@0@-0S |P dPS-Z-@-@[P08GS-p@-P@PPpAPPpS-@-@FP Q 0@87ST S-Z-p@-@ PS P@p p@-@P * 0@87ST S-Z-O-pWP`@P @ ЍZ K P 堐PT  RT@ Z //////O-8r@00SRP`  4PU00 Ѝ  zP00CS0O Pp0 0 ӓ h^Z HPD T8 PP P00SX00 S <P P00S  -P 'P x!P \P DP ,P$ : PZ-, / 0@-4@0P PZ-1 X0@-0S ;@@0@00DJP0DЍPZ-[-@-@`0P0`Sp 0`/P PP ЍZ-@-@P08DZ-p@-P@PPpNPpZ-A- P@`pPЍ0 `(0P84SUP @Z-@-$ 000B;P Ѝ[-A- P@`pmPЍ0 `(0P84SUP @Z-@-$ 000B;P Ѝ[-@    /0A-P<<`0@ j<0p0D0& SQ 0@/0PA/A/O-@PDzpDpG``b0Y:0z  Z# 0@@D` 0DA\0:Z: [=0 S: p `$ Ѝ `p_-A-@`PpO  I C =A 0@-0A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @Pyp TT0 5p6@ ,<0@40 4/(00S 0TЍe& _-A-`@ 0s P00p0pGWp0PP @P @pT 0@@PP @_-p@-@P?@0 ?@0R:@@pP p_-@-aM$0Sj Q1@ 4/1@A C"+4/%0AS&0  S00PpDU7/'0pS(0  S)0S*0  S007/ ,p0# Dn7/ p0# Du7/ 0p0# D7/ 4p0# D7/ p0 7/ `w0 6/0 P5/Ѝ_-e& O-Q<08@0(00iPR @p☌`,@48pT:(㙄)<0( T:(㙄)p@0(pT : Ѝ  z030IP@`(4l8p00 D3#00@ `@4\<08p4  b "0 0, `0@80@ߑ00 4/0SD0 a_- e& p@-@0`,0DPSp1S@_-0D0P/_-G-0DAMHPMUё`000PP, p0,0_v0@00`o`SLXp Xx +Dpo A>004@ptpG0SkX$0`S D 0ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 00 \\墋`D| <噋0,`\PPDpAލЍpP 2P 00PpWA C9RQ  0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0廐h0 :/1, !ዏmP 0H0_-e& H 4* 4 _-_- 0H0S/_-0P /_-@-DAP|0`SDM)0S&D0S S f<0P 0P@ DЍ LpW*P 0 000"0ptpu@ k`0pMX0 7/0S ѿ0SP 0 P0DЍ@_-_-e& G-\qPL @0P12C001b5R 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0RP00崊0S0PS A&0S,P P,@GJ_--!\  0L0#0_-@-p0M  L0@31 ^AP 0C! 0Ѝl_- @-L 0 0@11D ^Q       _-A-@b@0Mu L0 @2# p PW%cP_  Bc p\  Z<$0 HD@,X#1010 2R01   000 S" V00 S ☊ ЍA X 1(410~X0威42 SV Q`ЍQ0S ׉ЍAщ`\c  Zߍ lm@lV%0S Z ͍d0@0_- A-Q`0MS 00S` @P9 0s$@Ѝ pW   @0p0|0S0S @Ppup00FV@@lP 00T l@#p`W 0S:S* 0ȉ 0p0pp_-_-O-`HqL1P0SU#,@T,P@P5 &0B1 `P 1"h L0C R P!050%Pd @T: ᤉ  0 p[L0CY1T*Q@@_-G-qT0So:\0`S&; 2 c@Oo @d(0d$0P0@U1 0S. 0 P B N %Q * RG  ֌0B408@S 1:X 0@D8C 003 c0?o< @@D@  PP  3POPP 0 @ S :    b01"!00000P00-0P_-e&A-p0@@ `P PP0`0P P@lY%Q *0S  c_-$00S:@-@@R_-@-PP` U(0SP@P )@T \0@eT0 4/뀍 00'0S 0 $( @7Ѝp_-e& * O-$MPpPeE00U0SXc )Z@ D3@4<3 4/ẼW(0Sp0eWD@XU0XZ5 0PPW00 # 30+*[@C@dQS: BL{P5 KL ` % J2 10X0D30 2%Q b*0S _Z_1)Z @] 1@֌1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P0P0 K D K0@D   J%Q   X0@P0'0S 0 H0pS$Ѝ*0S  _-e& _-* @-M@pP0aE(0SWTP )@T; 0@I0 4/ϻ0#880 P0Uu@P  '0S 0 x( @Ѝr@P %Q|0S0S P0 00_-e& * O-@QpL$M(0S@ P zP'0S A p$ЍW %0`TM\0T*P* 0`0  `?oo 0c `S PP T 1b*D4 T!P030#P0S X $200301S%T#2QZ FD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp<؆`0<0 0 QpP 2PP% 0   D;   %T#2QZ J*0T00S  D#ULP )PU @0@=<0 ;4/ĺPPT 005_-* e&_- @-L0@'0S 0 00 0T Ѝ@Ѝ_-* M////e&/e&0p00/&0p00/&0p00 /&0p00/&0p00/&0p00/&0p00/&0p00 /&0p00 /&0p00@/&0p00/&0p00 /&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/\}&Z p0 0CSp0 S P0 /p@-P@,`眅Pp@ Tp 0A S010// 0P/!R/P/P/Qa/P/0p000 /&P/ 0S S//0R/00p00/&0p00/&7@-@P@@P 04PSPE0  Ѝ0e f i x&PQ 0S///e&03P 0 / 0 ACP 0ABs0P r CoSPS//O-MX@ @ЍOSQ`pu rTp 04S`\kP0@`S@T~WlЍ_U` 㚔!`PE`0r>T 04SJ:`\H㌱  >T  QX ( Q   t / Z P   lT0`[?oT20S@ X@ @0R @T`0-@0S S @0V @ X 1=@@V X*0 00`00P 0 h 00S00/@"& 00S00/!xr&& ///@-@H;)@>P (  @zx&< ? -@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P @p@-0P `| @P  \*. Q  Rp R  (  p 0 B &_-qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00dv Ѝ0S/1>3 !/0S 000/_-0S*p@- @PN P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!m0`A-PRp `@{P 0!n000A-@P`p쁟0 SV1 V00W W0Sc0 P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & `PpG  B0Z  Bv`FPpGo`FPAH A-a@0PS0<R&*1 21<0S 0R ,0PP0S*!!! 0R ,00S(!!!,p (kM0PA , (0 ,P\}&&&A-`P P0PS\ ]\ xp@BX T 0| េP-Ppe&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00_- 8 0 s000/`Q'Q!//&0sA-0p0@P`M⤂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0n0 "0 00 0W_-p@-P@,` P@tp Tph Q 010//h ,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`\}&&&O-P 0R@pM @ P&  $ P 000Ѝ 0@  KPP ЍO 0 PS@ ᅃ 0 00<00S*^Q0R08 ]R00-R ((g Q* ]R -RS\T0]Sh-R0 S^:0S006000S80S 00000`d0xS ,ZGV ,0Sl40Si$0Sf<0Sc(0pw_  0(`c0 @`F p@  Uj 00C0e-R [RS :R =R| 0S: R 2S0S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``G0 0I~P   0y S0<R$ JP    wP  $0  0$ 峠S0hS0`0`0-S]S0`S0`0= 0 S:0`S0`00S0 -R[ QX]QU -Z00  YJ 0S- Y0`S 0`00S0<Y00 Z0S  Z4 0'JP / {y400!0ⱐᲠ40  =P0S 00100  0P  +P{ U [ 0]SS0<Z*0 P80 P <0 S P p`v`00勰P00 0  EB#ЍORZ =RW ]RTR :R ]R007 \}&_-&&&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@&&&A-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xIPu 844U\ 0CUUt0SU 0`B t  | 0D OU &83U N 0  , 0000h30>@0S* *Q2  0  B  BI   B0  B=Ѝ 8 0S 0S 00t200}PT\QR {RO00r0PS;* ,R8 Q 6 2000/ ]U0 R  !   p0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \h V 1L  0 S *R \R )R003 0S00000+_-)>{^ ]&@-0@``P?Q $0As R % S 0 ^Q [Q \Q 0S Ѝ{Q |Q?20V:0S00500 @0` V1@`(P G0 S*0)S  ) V 1L  40 Sf:0S00p4000 S**@?PQ{PR ,$  "!,Q 0S 00300\0 0S 00300?P  *P 0 B5  B   B0)  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0@20z`o ksi0V:0aS0`000<Q >Q q`x+P {N &   B 0  B  Ba  B5 "X A, k0 `S0* ,R-  0000< V0 R   0 S*}Q00@ R 0}Q 5000S 00\ _-&^ ]0S G- `M pQpG ypL:@P 6W: ЍPEPP P $PPxP @p~P 0uPP6    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A08FP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 f  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S* P8P@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U! R0>P P PS 00 00H0@0 @000 0 R00d000F 80S@ 0Q10CRZ/TUUhuHaz`_-Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0|P`\}&&&0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@\}&&&O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  XP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(& O-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0\0, 0(0 000@$002   0 X @ Q  0 R  R  PZ$P  (    R    ``S  R  Ug h V pt p r _U RQ v   _V R up  r   _U R w v  _V RQ ppX u0] v  r    _U_V QO  X 0FP|u  p $ V    upv  w( ppu  v X pX wX0wq uc v _VX 3"  Q$,ZS (  `X S 0P&v u _PU PRPU00000S 0R0 4Ѝw`Vw_SwPu4&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0800@ 0 YS  D>31># R 0800@ 0 Y_  DS S- S* S( @` PS 0e800@ 0 \Y  DSU S S 0>#0FϠ2@P0  @P0  0P P 0/VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  tTP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(& O-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  OP ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E0  ?oR20SpG pGP x0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ2@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-3S S8 S6>S1 0800@ 0 YS  D>31># R 0n800@ 0 eY_  DS S- S* S( @` PS 0I800@ 0 @Y  DSU S S 0>#0FϠ2@P0  $P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O--P@pMLP 0H #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0/PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0pP T @00S00 0S000S00u 0S*0S0T S00S 00S4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{ 0G a >#RJ RT RV R _R Ra R 0>c0D2H0 00 P0 0 B>c pr9 pRd[3 A T0-  MP&0a !0R@pH0 00 P>cp0A0!RH|H A>3   0GhP 0G>#`0 @ \P01!># R 0 p`>c`1>3"S`F 0 D>c2 H0 00 7P0 0 ( \(& O--lM%PQ0u @%Qp ppm        Q 0"RS. 0 YP,Q 4^ 8[ <``F0 0`Z01S` 0s vQBo \R 0C1!S` `0i0 0Q[0 000,@4H80<@ Y PP 0 TX\ L0`n Vd 00 S`FY1`0 0 0`,UP XD0S 0 0D0,E`PD00D0 0R < 0JS : qLP Z Z `p4`XD0SZ 4P ,0@P4 pj,0@ 0S%00D ;0$0 0D0,PP5DQ/*0 F00,`PD% 0 00,P0HP 0000 0D0,H0SPHDhX 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y*,Q 4^f 8[c <``F0 0`Z#01S` 0s vQBo \R 0C1!S` `0h0 eE\}& 0Q/0 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S7 0 0D0,`PD00D0 [ ` 0R< 0JS: QKP Z`XD0Se 4P,0@P4  p4P (HP $lЍ,0@ 0S%00D ;0$0 0D0,fP5DQ/*0 F00,%`PD% 0 00,"P0HP 0000 0D0,H0SPHD_X 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^s 80S 0o <``F0$0`Z"01S`$0s vQBo \R 0C1!S` `0g0$0Q0 000,@4H80<@PP 0T X \ L0`]lV 00S`FY1*`0 0 0`,7P XD0Sc 0 0D0,'`PD00D0 0 S` 0P< JP:$0 *JP $0Z`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$0 0D0,4P5DV/0 F00,`PD% 0 00,P0HP 0000 0D0,H0SpPHtDjX 8 D0`F0C0X?4@` 0 ,0@` V 2 1(1( XPppp pnpl-Ѝ///@- // //0p@-8P00@S Pp3bP p_-7@-4P@0S TP Ѝ0P _-@-@P 0S _f@P/\P0 0 0/ /0 0 0 0 0/////0P P@- Z /$ `- P P/ /0 S/ 2#0/tO-,Me`pPR0@X$*$0S$00f 0Z0000\0 0 0 R0030#$όZQ^A2  # T P@PY*0 0 0T 0C2@TPT  # 3S R0 YR00J 0S1\0S# 0, Q 0S 0YSr 0 0C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S 0R #3SQ  PR#  0 B 00Y00S  00C 0S000b 0S  AX 00S 00JS 0 0 SDH S0" 0{0 C R9SB0 S H$0 0CR0%2 L Q1000 S 0!03 BS t0 S 0 0 P $ P @ &$0S$0C[ 0SW 0 0,Ѝ 0R3Z0B\\00S SC @PTP>: 0; $ $ 20fLQ0@-M@(,4`0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&-M{ { {Ѝ\Q0@-M@(,0  P#U` `0`/"`o R?#0.o^,AVU-00ĵЍpFW`&0O-M@0p`W PV P'Z P2Y PyX PV P:$  UW Pr U  {UV1  sU mUZ  eU _UY;X% h SUT 4MUЍZY!X3  ;U ,5U  +U <%UwЍ U $UXVZ  PЍOW0\D|dO-@Q0M0R0`0P|$0x 0 pP R nRk a BR  $  , dP Q DdPL Ѝ3 00dP~Y U000T0003 0$0dPNY U070T070H dPY} U000T000 PdPY U000T000YW U080T080 oR 0dPT000U000v ~0 XzdP 0 4tdP 0 `ndPjYL U080T080U0 t]dPz 0 WdP 0 |QdPTY8 U000T0008T080U080/T000U000&T070U070T000U000 ЍT080U080T000U000t dPYv Y0 hcP 0 cP x8\  0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  p, 0 shp@ `hp@  p@@@d{h0 P\hthPrh0 PkhP`Ѝfh00@O-1M M(@PDdPp \"(` p (-pdp^ @D;@h@ 0 0Sr pءp 100 0`00p@, ` )@-0p t0)0;  PP 0S Rh001ݍ Ѝh0S 0F\ R Pp @0`!@DD4 [@ 0 0 0V   0R- 0p,R 41ݍ Ѝp0 FtH   gt0@-P@M 0  PKp Lp@ P[ I Ѝ00 0RЍ0@A-@@0s/ PP0P 0q!p` `u`30`0vgpp(X`p lg``0`0_g 00T(p@-@PCM0 /WP2 $pP@ ` @Dg000t0 @ 2{@P0F0 {@F\0S VS00 SCލp|@@0Sf@d00P0@  P@1:g?00@ g00 @}p@-QMP4@SMZ TF / ۍЍp+0si/Z0p0 +Qf@0P0@  P@1:f?00@p 04f0#S5p@ f00f@f@|Ą|h|h%@{@-sP`O-$(X,p.S`P@+Wu00Sb [0 0KP:[$" 2Q%> !4"0x"3S20*rW00Sa [0 0J P :;! "#.0P@AQ#Ou0 {0Qp w{_ J P :;$" #0P #[0 0JP:t' 00{S' w{P c 0JP: :) #0P@AQ#O[0 0J P :[y'@w{ 0}JPy: )Z@0S20o2" U%> "Xw{U aJ P ]:4# JP0S20S2">" R01Q"Oj0S20YD"""""""""""p@-@M@ P, `S 0S1h! R 0SL[B 0407+Q !POT d!$ *0C 3S00 F< {{~P 01C /AFPV$ 0P  [ `0% [ P$0SP (Ѝ00Z`F* 0C!< R Q!h! R@, Qp0(0<lx0t|`t0p,0x0lp| (0G \9`00W1<PSQ_ }Q) ^, S*P008$ 0P 1<`@(Q( !hQ0Wp0(0<lt x0|@t p, x lp0|@( P 8$  L A!h! R"0, SS:p0(0<lt x0|`t0p,0x0lp| (0 00W\P<Q`5 LS 0,^0F <P0A  0=R@ ;@ %0@Dh0(00(0000,00,0  F 04P S F"x  RQF#0 SF P\0s F`0d   0 Q0*0^*{ r0s{P T80<0 @0D 0 0h$% 0S 000000(00(0,00,0(00(0$Q0PS $R" :"  R#Ό01"?!x"0w$00$0s 00 0o000k0S <\ }H NR LX \ @0DhT 0Rk{{AP{$hE` &0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#P0L dS0 {{ {{{{{{`0{0{d 00(0S  R $ R Ÿ\ :6Ÿ$4&60!$ 0Ϡ! !>0T"!!!0C 82 P02@.3H0/#0Ϡ R  " RD#L .@0L  ?8 H D<00 0#!/":N6@ 4$&60.$ 0x.>Â!!!0C@ \0RDL,"΃0,ώ #1 HL  LH @00SP0D 0 0T 0 0Y{00v$0S"xl$0S"xc0$0`qL\(p|""""l'.%Q(\)\²0 4080DP @V:($^0Q<P0L 0=RH FH %0h00c @D0D0@YD0@#:6D 0 0@ . 0Ϡ.>! 0!!!0C" R 0L  Ό D"L!Q@X?#"  ?00 #1?B! H " H D0 L@0S 0\ 004 0 20DP :P0 0<R$0h00c 0D0@+YD0@#:6D 0 0@". 0Ϡ.>! 0!!!0C" R 0L  Ό D""Q@?#"  ?00 #1?B! H " H D0 L@S0 \0#i0  0C0  BQw $0 h00$%S 0dR  Pe@D \DDDQT&@0TP08<1  \0H Q00000S<PT8< F ! 0 F! 0 ! 0S(0S <5@0P : c 0D@mX0D0.:@6 D0% 00@. 0Ϡ.>! 0!!!^0C 1H02 >0.D0LS@/2"́ ?0 0 #1?B!  D0 @0SHL 0Q 004 0F000$02p rp t t   0 RR  0 & F% F RQ#u!F RQF# &f(0S@0$0D00{0<\v=QqH NRL0X\r@0h@0D0D0G0 000$0@0$0= PT#RN RK  \Q?% 8&<0dP(003( :60 0!$Ϡ0! !>)0!!!0C P?00.!?@ /" R  " R D D0 @ 0#1A0H h0 0%L00@0D C00 00S ^0  $0h0 C0000S ^  0@D h0 BQ0 $0h0  vps; 0 *R" O-Mp@$y]08l0u]0W`0 T' 0 2c1 0嘐0 0<PP/ 0v> 0`0?d000P0?T0 00#?<0 0$$%"P˟$@ 0000  000T ;0h0PM 0TP dP> P? $`Pj0Sg Rdʰ R `ʸ R \ 0 0` 0`@Sdp ?O$@T'pET0}Np0`@dp0\0@D 000000 0H0H0PQ0l0X0v^D 0h080P0 PEt PQP0J4 0px|PUpR[S S  h@p| Ux Zt 0Sp0Xl0 Rh0 Rwt [[8 P0:=C 0p00@t0p` VPw x0S \0t0p00@ 0804p0 h 0P  0| 0ȟx0\ Sv. !0#/!! !./ŠϠ B ǟ0S ,?.Q!Q00#1 ?Xv.C BL\S|  Qxt Pt(\ 0 'qp  A 0qp `p V@P0 ?oR20S\00ߍ 0[0h0Iqp@p0 T   Q+! !pS@-NRp* h0 P0,Pa000 `0  ZR 0`S 00@ [0h@ [0S 0V0ZS dh `z0hP0? T0q0h80? <0h0h@0? D0_0hH0? L0VX$`\TZP M`h[T00e[0S@Tp1ß"bZ2*:##c2S$O[0S- \TP)h<PP  hß嘐dT0CL30@p>4[0h00 `0@4pP8P ? /( Rß&0Q 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 EMqp> @p(pNZ#00Z0S @㼰p h @pZ00@pߍ輰[) [[ʔ 0Z0Q  s!P ZT00Z0S10(` #ΌQ0"c01 2c1@TekZT00]l)\P(\ ףvɻ %I$@-@ LmpTat X00 R 0 R 0Q/  /  R  DQ 0@-0P S@@H  ^0 S  Q 0#0S0(0/Q,H  Q j.0 0#  Q/P00Ɠ\ 0@-pPo> 0@" \ 0 /PA-@P `p@P0% P @PPA-\@`@P pjNP0& P @PPOA-\@`@DP pH@P0& P @PPOO-@ M `P< p p$0n@0PP P p $ aP pP0S  Ѝz T0 0V R  j?0`0SNA-pPQ `@Q *P 0@DDB(000S  $I@- M`qPPp* X 0 0@0S X0"S# 0p000S0 07/ ЍX0"S1Ds`0pX000S @ Ѝ1Ds( 뤲xH,H@-@\ Z@WO-PMU@`  PP2SPS PW Pp B `Xa `L`@ P) 0nS: P= HP0 0Q Q ~P P 0 IB"S0 000P Ѝt0 00 S Ѝ0oSP  TFO-BMM@p"X0d0`  0SNP:^HPP  8FNPn00QhP PC @P`J$ 0 PP&p S0P0 0 PPp ti@P" 0 t0dSPkPU0 Pp` pw } 0RP~ F@PP0 PpM iP PX VW 00BލЍP/U ` P .p:W0SL  BP B0H0PP0 p=  }BnW00 X 0BPT! 0  I0 0ZW00 X 0BOW  0x 0yX00,5W00  0jBP*W0p0 @ 0 P]BvW00 @ 0SBPl\zd@H-{M 0 { .PЍ -{M 0 { PЍ >-{M 0 { PЍ ?0-,M 0 FPЍ--0$ S   0/ 00KKp@-PAU@pV? $0$`0 6/pPKp@-PAU@pV? ((0`0 46/pJ@-@P 000l3/J@-@P 000l3/<XJp@-P?oU20S@p 0 0 P5/Ip@-P`UV00P00S@p$$ 0P5/pIp@-P?oU20S@p 0 0 P5/ (Ip@-`P@PpU(0(@0 p@/Hp@-P@P p$$00 0B3/phH-@- M  pp@,,000G3/ Ѝ@ Ѝ/ (H@-pp@  000G3/GG-- M` P @J0Sp ЍU4400 MP@:/8GG-- M` P @0Sp ЍiU4400 aP@:/lF@20!P (///|////////////x/l/`/Tt/Hh/<d/0\/$T/L/ D/</8/0/,/(/ ///// p`P@0 p`P@0 @-@$ MP#055050%A0!0%zP$00$0Ѝ R/,0p@-S@pP($ARp$0S*> $0( 0C\ 0 CR$ *#0$00S3 5$07$050$0(0,0!PpO-@XPDM@p, fR@ [a P @: [ [|7$0P$  0@X Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P [ S>3 57,05  50Q,0R 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0DR#00C R700C 1L5$0qS<3 57,058`0,0 ?R0@SKS,0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQ `0p@ FQ)Q* AR  bQY fQ ?R0@SP  b8@S B;; C c3<2080 S ,0 S,3 5407,05 50,0FQ0 0 ,0R S5 7,05 0,0 5RS=3 57,05 0 ,0 0bw@0fp`F2$0?Qa R^  2! a, A0!p @ `+ 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@5p`0``` VRQQ W  P [P=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`W  R `S` 0P0`S<3 57,05 50,0080:Q,3 547,5 5,@p`0%#jo%#jxL%ju-M{0{0Ѝp@-`PM0@ 0 4/ЍpO-PRM^  `WpP+/a@oBP L0  D pp Ѝ@0S 0  D ppR0S Ѝ贠 Q0S(0D @p0D @ ppQ0SQ00Q00L@@-$$@M ЍO-EM MaX@P+p `E< S0P@(T 0 uS0P@T 0 }0EAP < <UEލ ЍQ00Eލ ЍyQ00@-@`  pMPLP, / S 0R rR  P    P@0C ;ЍP  rR 0rSX 0 @, &0 Ѝ@v2Q 0 8A-`@ p 0P/S /RP @0 Sp 0 S L7  Pp@-IMM@`PP p 0: S \0 040pp IލЍpPO00@IލЍpP00p@-IMM@`PP p 0: S \0 080Dp IލЍpPO00@IލЍpP000-{M 0 { PЍ P 80Q 0 08080//p@-@P PP`  PP u dBP  p@J+#PPp--00 M (0  ЍЍ/@,P --M  Ѝ Ѝ// -@-MO<@P@ 00  0Ѝ@Ѝ/꼏,0-@- M@OP  Ѝ@Ѝ/O-q`Pp,M;  PR $ Ppp @P$ PY P@ 0 @bYP XOW!,Ѝ000:Q!0P00,Ѝ$80p@-@P(M ' (Ѝp0 00 ̍,p@-`@P&Opp p@p@-P000 0 (M` & (Ѝpp,p@-@@ @  `  @PNpp p@k ,p@-(M@PNp & 8 [(Ѝp@-@PP P  ,M` @Np & A,Ѝ而,C-PP,M/  @` p`FV`R V @`0 @T N ,Ѝ00 0:2 0,Ѝ80p@-@P(M h& (Ѝp0 00 ,p@-`@PpNpp p@p@-P000 0 (M` A& (Ѝp蘊,p@-@@ @  `  @PHNpp p@wH,p@-(M@P:Np & 8 g(Ѝp@-@PP P  ,M` @ Np % M,Ѝ訉, P $ Q80 @-8M80@08 Ѝ880/LL0000 0<gR 80880Ѝ/HhP/0@-@0@0 M0S 0000 X0R |0PP h00FCn0T00 Ѝ0D FP0+5t,tO-3M0PP 0 @0 `0Dp@ P P00U tpp0 0C Z 2ATT00  RF LD@D T]:[ 2 0000~`K bM0 V0 W8 \2ATT 0`Fs 0Ry IM 0  0 B0SH 5M0Ѝ0 V  0  $M ` 0 0pHX;0S2 0  Mv 0 B@ 0 B  BL`FtY  0 B  BL 0 yz L 0 l0S 0 Bc00Ѝ 0 Y]ꔇ 00 ,p@-@PLppp@ 0RS00 /p@-@<0<00P  @Lppp@ l,808 00 Q0R00 / ,p@-@`PrLpT T   p@pp@-@P\ \  ` @ULpTT  p@px,O-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDAA|` Bp2  W R ? P QQ Wt ,0 000IC1100Q0 0, Ѝ0000 00w,@-@0@ 000 @T AP80@080@-@P AP80@0800-M  uЍ0-M  ЍO-ϟiM PȡЁqal QP@ P? `K͌U P`? K͌T P? F͌(Z P> F͌(1S tP1> C͌ X bP@> JB͌8W PP= ̌V >P= ^B͌`=@ 0S078d H0P< `P P  P P P P p PL Pp(, qP P`P (aP Px PP'( Q780D0x100C40S000C,0h0Hp0L`P$$0PQw ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @eT, V   @@dqXhP 0Z Piߍ P 1 S  ,00 0! 1S 0D 0| 0p@p000P,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua PU, [000 P,0匠0Zp(0p1P0@`@PぼP`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L0弿0P@@X1(@P0崿0P0$001T0孿0PPP1 PX0奿0P0000垿0P0, 0pBPBHPP@ 0T8`<@OH Us,` p@PW 0g1pV@10P00 00Z00 \Z,0W0 P ܰa[@@PP  Z @pV @@ PT 0P@ UfT0@0p8`<T4 ! , <B B P $@0p8`0[/To0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 PU,0 V0 @ PqY0P@ セPP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|A>p`FR 0`0 0 0[0ꈰ  0PU 0P  0@TP0 @  0Z 0^ύ @  0`V 0 Jύ @  0X 0Q̍ @  0PU 0P΍ @  0PU 0,0$ 1@,  BU00p@8`< ,   , 0 H T0封.1D|Q*>p@T[ 0p8`< T P H00 0R_ (0Sk ,0P0 P ~8XC h!(0ST L0!11 @ T p @妼T,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@.!(0R1P@PB0P@ T  0PP0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @0T,000 @,0,0Q@ 0@1>PpP`Ź Pp W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `V,0 0@ 0 `Tq$0W1`V W  0 z0P`}0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a P咻U,000 P,0|!0RP0P1`@*0P`. V  0 @ P50 0R80000S / 0p8`4{!*prQ>{ R 81 R 0SЍQ L0 0 0mEl0T0Ѝ!f\Wt<0l 0̃ S/$O-C@p`ᜣM[ +(p( $W㮷0CS0SLष3㰷8ⴷP 3 0/# {% 08:x{rHȲ pŸ堒圂8ırtrhÃqlr(rdrq\r`PrTr弁qLrxrDrÃqٵpp<Ե^ѵvε8#˵:ȵ0'ŵ#µ0z# 0彵H#㺵p-㷵-㴵`_㱵|㮵o㫵p㨵r㥵y㢵z㟵{㜵@|㙵h}㖵6A-\`'^`@ p 0\@(`V(P(O-8g887M`  `P `0ǟJҭp 7 000 S00 U0S}`p  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0⽴ $Q B q/ 0 ;0 宴p4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3 `} pS 83003 `n p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#s p Sn p  0 s 00bR40 ; 0 p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 p E  `Q q 4 00 0q0cR  0 ` Ѝ 100#?c p; 000#?c pv/` 0 `00! 0.h 4 00 40 s 00bR 44 `OALQd p0(  0 + 004 00/4O-T4P@P0DM 8 `$Qq  :Q#R3Z 300S 803-P0@P@P@p@-tQ@P8P  8P 6P10S. (P:  p0@Sp0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@Sp0@S mS 0C;S P   0@S;Co DO-0lvSp@`MTf` `ZP *T0 ʍr `r 0 I"R (0$00 03S4PK -T$4P # 0XSڈ%$ |%T 0p5"00`4S03`00S5 p0S2 4S, 4S 0t25W】匡Tp2 1Pm 4p2[& LAT# `P P ;@ᯰᬰoH5S4S 4S0?o2ᙰ44Ztx2 PtY  7P3[x2  7Px2?;~0x2W  6Px278x23Y|2 PV x3|2hЍ0 D p$h l $ <%$(JYi 6P Z 6P [# 6Pp2?;~0p2|20P?0 rr 0"H"Rp2[6odcτ00 0#d#lm0 p _F?2? 0p2ͭY?w 0`w b2uP`0  0 0#`p@-D@D0@Ppp (0l0m 00 pL"`p@-@0@P:#Rt t# R- # 0pp-P`p8:p!$dp@-@0@P :Qld^p- pp#P`p  : P@ ,0H1`00 0 0 0~!U,00pW$  0$ 0 00 0(p PEU` 0 ؗP@@p  pP! Ѝ-,0 (0 M0 Ѝ,- M0 ЍC-@P M(p, P00S 2`0 GR  0 O@0L"Lb ``8  0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00&0   0T S00% , W10X0PXpq T0pGR Wڠ`P`W 0  pP Ѝ80  080 000 S0CpCxp@-`@P6!pp 0p@- M Ѝp@-@T T  M` @P!p 0 Ѝp,l l0 00S X  8Q Q @ ,@ /&R//,H H0 00S 4  !R@ ,@ //,`0P0 T 0008!R !R @0<@0/6S//@<0P0 0 0001S@0<@0//l0l 000S X *" (Q Q @ ,@ /&R//,$0$ 000S @ /,P X0:20(!R !R @0<@0/6S//0P @ /A-p@Pp" 80  P` PG  @ D000T $000S0X`H0H 0 ?o20QQP T//,000 00 0RPT00/P,A-`@P`$ 80 ! QP}p~ PeS 800PU b 000S0 `0 00T,?o20SRPT //0PPT00/,0, 0000P/P/,0, 0000P/P/O-h3@P0Y Q T# PU D#00SPH00SPQpP0GP0HS``HpHW, 0 ^  1  !!pGPI@Yep0S a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!pW`YHp0Sa>0 S;,0 0D | 0 00P0q}pI PX 00C 0HSP 1TX[00CS``[TY0IS`YPY0 0CPYXx0 00,p@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CF|0 00H,\000S  Q R P (!00//uu( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  Ѝt0ts(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0rO-`@ MP VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`Dpʒ `| tp Ѝ@0 S RQ Ѝ,9P d,020P 00X p  ``F , B,(`aaA0  T p0D`4P  Fp`,004@ 0T` p0Du@U   PB  0SQ 0 0PC 0$ 0\R =@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP X,PQ8 0 /$ $\/ P/ĿPQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ETpL @10 0 QT$ D 0R U EBp: x0 0D  Q SC$ 0R U E,p$ 0$@ P0*@0B0TP @T 80@Tp` 0Qp,PQp@-P0P`0*Â$ @P uT00PU pxp 0QꌽP- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 0S0`S@( 8XE?*00@-B  80 P R00 8 $ P R  R0 00S00!R0$R0 R d1S0800800080$RQO- M4zڌ`@Ps |{툰 {Pp,p  PP0_ Y4% 80!S0` ``pX08 0 T``0a$$ <@0H0|08 @!\08 `0d0h0l0p0 Ѝ܍P4- 㻌P' 0*Q- Q80 SpG V P  PʫR Ѝ ߎݎێَ@ Ѝю  A-0QM@PP(C p`QAR   B P1 \.X) P$,P?PP H0 DH00R00D p0$`P!b@0SЍPЍ$@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI ˎL1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @Lx$0@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0l,@-44@M00 MЍȲQP-D00M  ( @05ЍxP8 /00@-MN  P@N000 0E DЍ0QPO-4ŸDM PPhlpt@x` RK SL0[ B\ 0CQ@A PDPU A@A\UQA PNPU[[H p @D11A0100!0lp,00@0@0-*@0l @ V 0 000@ [@:  P Q [@* p0pW  DЍ 0Q0 AA괱O-PDM4 (0 X0,00S80  S l0( S࠳ࠣS࠳00CS࠳h ^@4 @D,  p04\00\0T00S@t80<80808080ql00s0SK0Cs0p008 P(@T ^700qQ000, ,0 (0q`0s0S#, ,  P(p@@^ @P8@hPuPC ^hP4@N~@t@~PpH~^ ( npH^, 1 00T<08 <`! 0!1a S 1  0Cs020Cs0Sq 80rD 0S 1 @t@PT 0uPs08<` 00 000 h00 h (000 0 000CQ00( @ 0 0AP8 h(A^ (  h   BQ 8000c(0 pRp 00(0 R 00SX 000 0 1$ 0S0 !1!0$1Ḁ{0Cs020Cs0Sq D 0Sp1L0|100 pC 8000` 0D0 !L| p. 00MDЍhCpPp4p 00 (pQS 00ã080@0808@8p@@pDЍ [P [M 80&PU0,`A0s0 ,pNq ,p  B   S ^030S@;A-U5P`0%@00?C5Mp 00TP 50 05 0@0@0@0  00P P50 0@5 0@0@0@0  00P 40 04 0@0@0@0 00LP 40 0@08@0400S@0@@0 0 (P !R 040 00@ 0,@   8P !R 30 00@ 0,@ T!R   P 30 0y @0;@0  00P L30 0h @0:@0  00P 30 0W @0:@0  00 P 20 0F @09@0  00P 20 05 @09@0  00P <20 0$ @0;@0 004P 10 0 @00@0 00P 10 0 @00@0  00P p10 0 @0 0@0@ 00P ,10 0 @0@0@0 00P 00 0 @00@0 00P L1S 00 0 @08@0Ѝ00@P L00 0 @00@000 ꈧ~h\|x0@-h@h0@P M006S 0  Ѝ0(0 000  Ѝ0@vlhp@-tAPQ@`7 Q`1000S 1Sڸ0  @T @TU p0 0X pp1S1&0C( s00B0Cs0SBB 1Sڸ0l0 00:h2P000S j @T 0 0x -M 0ЍC-P@ p$P `?LH\/ ONI ^pGPE ࠡPJ@$ @ 0C@-B2@`P0 M@0 !p Q,  !1pP0 01 0@00 @0"! . l!OP6X10 R00S Ѝ@,QP: * Ѝ 0pP0 00 0@00@0 0 0Tx0 @00P@0 Ph0p PX0 0L 0` @08@0  0pP|h|~x~\A-@`PpiTV,1 @ 0 @A O-/dM ?, 0L00*#Rt,/@ T8  (   ` (`RU(080@80@ @ ?0Sc,?@8? 0@000D L00  0SF (@@000h0S80@0804 L00S8>, 0(0\,0!0 s0  S^LPIL00"? @ t@T,0Q0@t@T80(00S&L00S= ( R , LP S800,0 1-$00Q$0 0\( 0qQ 0 , S(0 0 00,1$00 04 S 80p0L|@0H00D00ap 0SL01H@804 0,0000[,04 0Y0Y 00S0`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP YpH @ R T0 00P P 00 SPR P)!R00S 00P ɟ`V0 0CSp SqVp4 0 AS0 S P0P ` P R  0R  `9,00SM@ Q0C0E 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   L000Sj9, 0@000h0S(00S8000S3 80 ;8, 0`V 00Pm0 0CS<0 HD D<0NN Œ Č Ȍ N LL\oɟ`VWY8 T0V T@00D R 0 R PPZy ! YR  pY $Re  0E0 p0]   0E  @000$R , 7@  a@000!R~ 8x6 8000Vr00C000C0'P6, 00S?0X *1h"0 @, 860H 0  8 0P4, e `p$t00S000 @0p 1P11qWX5X0 ^@00 00S  05# X0:h280V @ 50S 0S4, 0pQ0A0 0C0 ꀄ 10&0 SPP 1 11RY@ڒ RRQu 0    m,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00 XX0დP0P0S^L L00S3(080 w 800  L,,20 p`dЍPL008 0080@080' R d1SdЍ( 0 0=x \P1, `p0, Q0A0Ո8! ,\PY @@YP 2P0@, QcJ   8@,@ APX@T `P `p̛xF|Exp>t=,<t43h3,21hPT` P @ p0 `, APYD PDI  P! Y   @@T`Q00 BCP`P P8p0 CQN @0p  0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$00S00 $X00@ p4<PLPA\L0(0 0R( , p0 `, Jz @Z0,  \F `0}8 0.00@ 0C(@ 0 0800  } 0XPx    0Q0000 CP4`0X0H080 0DP# @P 80@0PL Z J D| p~Pe d1Sb , 4@  TP:X X@ P S@DT H HH E@E0 0: 80R0,`0C 0B0X00@P `0 40 0E00; PU U R0 R  X R RR)0SC 0 R$  9, @` 0  `f@0 0p0 `Y00P d 0@` 00 B0X P0 P<00 p 0 P0+ 40U( R X R$R`V] 0` 0 0 |:, @p@0 0`rUH%RPP p RM $R $R X  ôQ R9 L5S<  (;, @` K0  `@0 0p>0 `00P  .0@` 00 B0 "P0v  Q0@00` 0  @000P  T P$ , x<@ 000 @000P" , <0 0 0 C R! U p=, @@0 0p1S U `=, @`@0 0PL5S 0 0RU p=, @@0 0Lp0 0 0 1@000=, ,>@ 0`C000` @000tW $ v 0 U@`= 0 0LfP4Pj @00 pWU zʕH%Rn0 @@TI 0$ppP@<@U; <PP$p`@0 0H`*UpH50S0X0S* 0 0 0 0, @p@0 0H`U~0 0 0 @000jP$pPdu:h(p@-P@PPM/ 0`0 R    80x t00 0 000P 0 Ѝp80 @000! B/ 0C?0Ѝpz0 00y,C-鬐M@P 048! \` d0hlp`PpPi80  D000 0 B0C 0/? 0ЍЍy@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S  x0 00w, 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP `~Vp`M|0P 0@PUpT` @~T @pp  ! !@-@P@v~T R/A-p0,SP` @T @`~T0`SP R0Q/ C0A "" Q/p@-`Q'P@0N "" ^ "" T \ 0L "" Q\PV@pp@-@@@0S OP$00C$0I+O-:z0Mx*p$P( ,pP H*00\c S@@s  nRXal HR @@i`40IS0c0@T ^OoB@TP AA  RR0|)\ 0  |  bR\ H)` R&8) R! CP'I@, 4R S[80S 0P0$ 0B$0X @C, 4R CPf S ^\ X( 00Q 880, 0,4(0RJ0H 0@0' $P)0S700S00l0S# 0 S , 40R#0l P, 0S h0P0$@P$@70 RЍ $70( U$(00 SBFf@`< & (00 S4$&P0C (00xP0S  -P$00C$0'@`&  T60,@(@0 R 5060, 40RpfF`@ 0 0, $P,04 CS (@Re 0 KRaڠ5%0 p p @d% 0(`Z Uq`nR `F%` V ,00P0S 0P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z p<40,04$!,1010y d 4`000P ^$ $@$#@ P(@h0 Ru ,,Zq  P+ p# J d# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R % P $@@ lP "  20,  , o40 S _ ) @20$ ܀(B@0S 0P0$ 0B$0$܀ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  0P0$ 0B$0@,0(A@0S 0P0$ 0B$0 @,0T+t*8*`d)T)H((((8(''|'x'`'&&p&%%%$L$H$$#<#"`"H"(!!! !O-lsl3phC@00 S M 400040,c`(,P Zm34@3`0T&#0C S402PK袟  ?0@DS(00S00lP 0S 20 0 204@,P0T0hP \RP0 @P 0( 0CS P 20 0 P1040 ,( Ѝ00S00h0S00~1 0T0 @P,P  `@1(`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( p0  04@SSCPE@D4@P,L 00SL004PhpdThD@- ,(4 000@-  ,(4 00O-x1x!0 p *⨒YX!X P!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 0d0 00 08QD0S0l%R h%R /!R!RtP/P//b 0 000 0P/TbG-MuPp0 5` 80s3  S̠`D Pr LR!1S85@450 50 `\Pᴖ 40 00P 40 040 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q _S~VZ]9 Q gSf2 Q PSSVi^* Q j^S! Q k^S Q gSf Q[-S 0Y[=20  0SP R!=-pRt000 0S@"R 42U8,Ÿ= @0A00+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  Y<PUЍY 0   0 0 00R0  00!R 0ʀl2 00 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf SUcb(h \1P0PP PKPK 8 QD\B@- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //@\<1P0= 00` P7ʀ :l“3\0 /@ P 0000CS0 00000000000000000/Z4@-@P@M&\\ Y #3t P P 00 '000 0vЍYh`P -P\P Y͌# /X@-00  |00S d d0 8=0!D00 R 0\X@-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\ h0Wʜ0 000:h/TVp@-@0@`P0M*l"R R &Ѝp`   P H00 040@ 00 @ &Ѝp(VhT02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R R, !p@ '( V@ Ѝ1=00QM0SJ\1p20lP10 0O0剑Q:20h1=00Q!0S0p20 00 0/0剑Q:20t 00 00`0pU0!Q 00pI0!Q `Uh0 000/Sp@-x0x 000@00CS0 S p0 S P00pcPp0R0p@-0CS@0 S p0 S P00pEPp0p@-,0, 000P?v@pQp@-P5v@p0 000S  @-@J Q P\,Q    @/Q,0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp0O-3$MC0P`Pp@ W uP 0p#0C S-0 00$Ѝ*T0 S80  *2 0@ဨ @D BT p`$ЍJʯ,0  1@Q!R 1Q0 CPg(^01A@D D P[Y :0 0 0I U0@D0?Y 0封@0p@`P`p rPP+  U  P `X(0 SCJXC0 0(0C\00C"^$Ѝ X TP P  D0|0ap H0@D002 T `V ` tV `` P|강O\0 00K,p@-@Pppp@p@-@80800P  @ppp@K,O-`6lM0@P,0 j Q 0pt`Pa Prq0P0[ W   0<0P 0R 080ЅP 0@SF0 0800`P0S 0P 0 0PEPUV 080 00PS0P<0? 0005 000p`P0 @R  <0T R8 2 0<00800C?80ttP0`FntPY00` et, t480pP pK 080 `0p`8ppP P08 E<,QpQpP Qձ4pp( X< R!p! Bp G" RX :     HU pG< S8 8 (P4`< @p$0,0 1400H0@0 @0 0D+PU<$0 (Q00C 0 Ss 0( 0C04 Q00SP{ 80 0? s2, 8 P |I000 0P8p0i08 k800C?80sP0pGS00C0`FQsP00C00p000P0 0PS08 B! Wf 0 0H000尡pG WD0|0pcrlЍ80< p` 0<0T pR0`<0 yPo 08HrlЍ`{P0 0@0 0}00 P00 Gr R0S0 0?P4/ZXЍ G\00r R0S@0p0pP4/pWXB4Q# @-@ RM !R "R pPĜ\  00@bЍ/0Q # @-  MS S PpP$R ,@8Ѝ/?@-0@,M @ Ѝ@-@044M0 @ ЍH>0@- RP\\0N ^\1   %@@ _ ,\'\ { X"LN!!N0 ("!! L}0 0% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  0  o %X  +p {o\\:\   l>QO-M  m EPP@ 0 p % p 0 5S p/ Ą`@Ḵp,S 0 0  C@00 S  Qr%S+0@ GS0  %@0iP@0@ `fv` 00#1.Q0*Q 0S @0 SE^0 @00% d dP00 @0@00 S*L0 0 r 0   0 0  < @ 0D@0 @00 S^4o 00PЍ0 S0^ ` 00 @@D"0 C0 0 S^ 00000 h0!@ @0 @0g0 S!00sp pp00p 00p 0@p p0, T \0@410 0rp 0  0@ 0ppTp0 S\R W' I00 S0   m  00w0`f Sv` 0S0\S 0 Sa0 00 l; %p%c%+%cP~}$</>p@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 Ѝp\06l8lA-@0MS0D0@!0@P0S? A 0 y!~|!!`"bNL LL 0 0210B qP `0 pW$P@WP 0fSPЍЍ 0Ѝ 5N{gA-@0MS0D0@!0@p0SE  0 !^\RN  L !0 120B Q:P `0 pW$P@TP 0nS&PЍ"0ЍЍ3kLy>G-`0MS00! 0p0S[  0 `1` I $L0!b!bIO4ቐ გ1c1cL0 0#3cl 10B AP P)0< X" pW $@r0sSP @WXV @T lP0PPЍЍ2-?Lx*S0 O-TMlj`PN ,$  0 : 0j @P 5 U000P 0:Z @P 0S  R 0X F #X =X =pP 0000pPP, p WZp  00Y*S k`P V30  Z l0S l0q,0@  0tß $ 112cA112c B LL00#0#pr!qpC 00P0q0pL@B P@=rH`@X 0Sp  k Z0` kP@X0`0TЍpC  0{ "$ L衟‚  H !1 2ਁሂBP㈁L 00@>p  0N `1` $L $$H0!b4!b Lƒ1c$1c 0L 0 00 壀((!h!b!CaP㈁ 0tS0cS0Spp~G0@00 p< p0S `x kXv8, NgkLs>-?L@r*SA-P`p0\ %\0@pS sS lS P0\UUW 000@1CP0PCV` 1E!00O-̟qM PQ P` 00S040 p$ b l@H XZ 1  RS GFZ P P 4 Z %Z%Z400 R,:@FjP 400@,%,`+P p` H˟,@ 0:ZAZ JQ  0JPPp0-00 >Z A0Js =R* =S00 C?QRp  Wp1PW -.R0 XZD cJqQ   Rp~ PA0JlRpY PA0Ja0Js Rq11OSt00qߍ|I@[/DhP 00040;hP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, T*R 0 p 40P040 P PPp1  \1SE 0C111SB Z0! Jr 2( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a d7@D!&J0AqVZ ຠ `OT` a 1l!01ATe @DAAAa0Js RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RU 1h BY!r #P`!`1`Q,*P  0~p^ 40040i10Js Rd1lp1OS!!0l1PUAT @D`1AP OT0a11@A?0Sl00l0 0St00t030S%   ?R ;R P0S %S0 01S2 0C11AT/ #Q,,*P  4 @ , 40,0PPp1BA0JS30J1OS!l!011@k00@`:hPv 400`,Vp p2.h Pj 400p, Q000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT> `V ᜜```&``VP``P``ý`@oobP``V ``@Q AOQ AAT @D1!ZAo!᪢Vp p2gP 400p,PZ00!Jo0 0媢0`0001&J0GZ @po0`00000-0 0|@V``pT@`V`pO@`fpK@opG`@pCoo@bp>)'   V8|{-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/ᄾA-PQp@M 0S XD fP (`V! 0v0+ V T 00 PP0T0j 00ЍT Dm 0 0 R T 5T|\.FP0S T`@  $ xp 0S R s0r (0 000ST00P \ p0 (0P \ p0 0`TH,ڬ8լhy$yxxxht@xwwxwdw0R @-M@0@S  ЍA-pPP U) ?@`TV 0PS |@P0D,V  'P oA-PR pQ P00@ `P % P P |#0 ES  fP  .0 000Q  0 R0 R   Q PAuPP0 QV \`Q  0S  0 S o W0C  s0_S0S  0 S Q V0Cs0S PUD 0$XPFPF "w X< $0 Ž20nP; sPG fPY P?oR20S 0 0qQ :%eP NC! ePJ<ePL5$ PP 2f$P.f dP$$ W PP?o2?    0S V P(C-p|Q@x!P`M0 4{ P F00C0S8 @ЍfPP p  0p R 0S 0P@ P@ @Ѝ 0 zP LPP+> P *(PP004rPO-M Mp:S$0S:S@ 0PS:S``E[ P!*  `0  oP 0P:S ۍ Ѝ@ۍ ЍC-8B82M@M0`PpjP9 0/SH @P S0@IeT PI A@4KP 0 ۍЍCD@0P  L `zP"0 @\ۍЍCx,0P 0S/S P @ eT0 ۍЍC0  PۍЍ p 0dYX H0H 0 (04ۍЍ,0, 0 04\p$o`o`n, =.pP 00p`v= <00P5 P 00 R,P `z`LЍ# @P= pp`v ,0 S Q0S Q0TS 0 0000000T P0(-Z80]80 R(:`PLЍ;@0@SI p@t`00 0 0f0 ^PYo (@[ 0 [P p;  )\[  R-Y %\^[\= @[0P0&0GS1v  0P (Y0 KrQ40E K/RS  [@ [l&,0  @ 00@,&,0  M p00 DTD0 0S)P Pm 0 i 0SZ v0 j 000  00 n0PB p (^801` Q  Q 0S00  p    D00 ?[}$v 0 S00P0@ P  0BP,  0  80o Y80! [0@B PT@@p' 0 000 0s0,P (a@p@tkp@t< ,0 Sg Q0S ` QF\RPeT` PP0 x|400 F((WP00fPp@t0n <00QL Q 0G R0 x S0 0WP680 M00 0S00 P   0pd0  < ` 00 00Pp P0~yyDxwv vuuXu8uP/$P00//u0@-MP0 P 0^\!1l!1"b2cNL 0@@0#@B!A@C0nPЍ0赁Ntug P0`0K?//tp@-MP0  0nPel b N00PEK 28@0#AB@C1d4PЍpkLt>$0P00?//tp@-M`0 P0el`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$C!d!b8A@C1PЍp-?Lt*S4sp@-0P0M`2@P 0Ѝp$\, 0 0S Q20ЍpG- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00褬l\@-@P \\\ \$\,\\,00!R  !< 001/ 001P/ P/ @--@O X@X0@0@0s H PJI HH @Lp@--(M C@3`0 @@PR  k{UF{{!00 (ЍpPm P 300 U  {kUk!00 PS ~P 0300 U 2 0"P  0cP0z200{kUk 0P PA  0cP0wʜ200U 0d"|2|2"P  0cP0P200U 0 0"P  0cP0200U 0 P  0cP0100^U ! 0"1"JP{  k0cP0Gd100U 0I B \0cP0f,100U 0V"0"dPS  I0cP0a000U 0Q"0"QPP  60cP0ʜ000U 0u"d0">P  # ??L`GǼp$ą<$؃0cP0Y,000U 0 0" P:  0cP0t00I? 00Ō0U"f P  0cP000E?{kUk 0] P  0cP0!t30A?{kUk 0t P&  0cP0,300U 0"3"P  0cP0o20t0U 0_"2"P  0cP0ʠ20l0U 0"|2"P  {0cP0iX2000U 0Y"`2"Ps  h0cP0:200y{U{ 0 qP+  V0cP010h{U{ 0  `P  E0cP0Aʌ10W?U 01"X1"MP  20cP02D100uU 0 ;P  0cP010S?U 0"0"(P  0cP0Mʸ00\0U 0="x0"PT  0cP0p00P0U 0"\0"P  4ǜPp,L`G~|~0cP0Z,00@0U 0J"D0"P  0cP0p00O? 00U"g P  0cP0ʸ00M? 00U"  P  0cP0%10I?*{kRF{U{ 0O P  0cP0D30l0U 0"`3"P  p0cP020d0U 0"3"xP  ]0cP0ʴ20\0U 0"2"eP  J0cP0xl20S?U 0h"T2"RPe  70cP0i(20Q? 00U" ?P  $0cP010d0 00U" ,P  0cP0ʘ10E?Xk{U{ 0 P  0cP0P10t0U 0"$1"P}  0cP 010 00U 0T P  0cP0ʼ00W?U 0s"0"P  0cP0t00P0U 0b P  $~}}@}G||\||{t{({`zzyty4y$yyxxx\x0cP0PP00\0 00U"& P  0cP0Wʘ00d0U 0G"0"P6  l0cP000l0 00U" tP  YnP  S,100 $101U""00 Ch100t10K?Q10G?c 1U" "00 -10|0100 1U"x"00 100i 2U""00 2080{kUk!00 30Y?300 x3U""00 X30T0L30N?? <3U"i!00 30p0Z 2U""00 20U?20R? 2U"!00 20`020= t2U"J!00 h20h0;\200P20C? 2U"o!00 20p0200: 1U"r]!00 10U?c 1U"O"00 s10H010K? T1U"=!00 ah10`0\10h0; 1U"+"00 O(10Y?z 0U"T!00 A00|0E00`000G?*00T0s00(0J \0U"!00 #00h0000 $xxwww\wLwwwvvvtvdv,vuuuudu,uu utttt{kUk!00 300 3U""00 300{kUk=!00 P300.D300= D3"ZI I  3"UM"00 2009{kUk!00 200x{kUkz!00 20p04q"00 l"00 P200D200A ]~ PI : S@ ~U"00 yP"00 tK!00 oF!00 jkk?!00 c:"00 ^5"00 Y0!00 T+"00 O&"00 J!"00 E!00 @kk!00 9"00 40Sj !00 ,0SE !00 $0S !00 0S !00 )P  0S !00 -DT! @ss|slssrrhrXr0S !00 0S "00 0S !00 0Sm "00 0S5 !00 0S  "00 0S !00 0S9 !00 0S !00 0S !00 0S {!00 0SI s!00 0S k!00 0S c!00 0S [!00 0S S!00 w0S K!00 o0S C!00 g0S ;"00 _0S 3"00 W0S +!00 O0S #!00 G0S !00 ?0S "00 70S !00 / 03H "}P !H H  3"0S#!00 0S !00 `300T300%"00 "00 "00 "00 "00 "00 "00 "00 "00 "00 "00 I I "X2"T2L0 02(0 0u|20 0z;T20 0k,20 0u20 01t0 0 1P0 01,0 0 d10 0@<100 %0!00 T10 0U00 0[0h0 0*?\lLl8kkjjjpjHj jiiipiHi iHh$hggggHggfffPf(ffeehe@e0 @@X l 0MH00 0Cp00 0900 0[/00 0 %00 0kJ1 @@ T 0 \H1 @@  010 02\10 0/1 @@  0Th!00 280 0D2\0 0l20 0e)2 @@  02 @@  03 0 0!,3,0 0  0>$ R'4000  0p@X>0U 0PEt@T$0Sp0  0@p>0U 0PEt@T$0Sw  '$   0   0s  0@$ pR~ph=0Uq 0PEt@T7p0pp@0=00S[ <0000CSU0S5 < 007s@ Q<0F(0 S0(0@< 03p|<0U0 0PEt@Tw0Sp D<000<0LQfD0*;<0\0T  0T :L0PEt 0@SBU 0P0,P0` 0U@@ 0070  Q 0SU 0PEt@T 0S 60> 00H70U 0PEt@T:0D10*D0 @D7qdh0l[ X0P#$U 0PEt@ 0S\7s@D0l0[$X6 R] ?0S50>00$60QD[I U10[![h 0 PE C0 ` 00D0 0CD00l`l Pv(T% UI 0PEt@00Rl @Dq0^ T 0 $ R40,0000 400U"  PEt@T   !R 840d0U 0PEt@ T:H00*H0; @D 07|;  0$ R D #  $ R D # $ R$# 0+R D U1![ $Q ^ LQ0Q 0 ! B040  0D PE B `D R000 R=0W U 0PEt@T20G?o20X$0S 0   $L2r '$B0#22cR0S 2000`20D10 PM;7sD@D10 Rp  B0 D  0h10)@pUc 0PEt@T$0DpSp  0 @Dp+kUJ F$0S  $P (D0 S2D57[U0  0 $ $ [PE`'0? 00??a\a6?7?8?=?>?N?P?5?^J?|M?\H?A?L?YTY0XWV:?;?0,( 粰*@D7p$R t!B0$ P0l00X0S>0p0P0?0X00 p0tP 40> <@v 50>050 7?R4@0p 0T 00p"p50800h505l 07^[PEt@TU*U~0 C00ST 0 0006Q0 0S @0p 07s0D@CqP$0(\$ PEt 0@\-U ؂<606L0 0s0P7s@Dl 0@D'qM0@ph0dlh70r؂7sP0D˂7{D @C 0` 00P00X⽿p0P0tp0 (0$P$(0, 80> 0080 0sE80>LSR: @3 0@|0-9@0F@ p \ p T d \ h P l90>(w0S90ALp@-@+PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  Z W0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P,04V0p0 p0 0 0 30 Ѝl0Spp l0@@@ }pS???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-`Vz@ 0!(3/PPw 8pWG  ( 0(3/pP00 f  @T 0  d!@P S>0R`*p  BS>00p0 (08#.8pPoRS B P T W B T p 0Bpp00  @T 0  d P S>0R`:oRpS. 0A pp $0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰX 0C00$P $p`0 sRpW-0p  p0 Ѝ0` Q`V00p;J\S10b60s0P0X 0 C∀0S 0X\!\ ! 10T2 0# T 0SЍ0W0T0S Ѝ0D?o 240%R00S0000020(0@0,000@(,04@080 00 0 00C$0 B U@\ q W3> BJ  p Wۄ2  B37RN q`36 B Lq`36 BC@g  @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  \X8@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\j \b$`\``$(@$$, V,(`@  $$(@$$, VpLF$(0$00W\(0`@]m8CQ???|B?LD, 0qR0C0s0\0@0qR0C0s0\0/O-,Pl0AOE@DS8@$M@AO<00x00@@D@^00S| Pt0`"!!^!@p4 0TT* RR 0 P^ ^ ^YY  0PU<PU=PU>PU?PU@PUAP0UAPR@oPP 0C  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0V00S8#  #800#"0 wbB 0 0 0 0 0 S0 S00ӈ R01q 00  R000 00%*W6: &R \ R80l0 C 0 B 0<L0DC0C t0S*l0\06x\0l S 8 B0 l0\000S10e\ R80l0 C  A-`pPTq@PB Q00V0SI0S: (0sT Q 1@0@!A00000 |0 `bp( 0S*t l00\ R$6S S L D0 BC 060@D0 0!1 0RppQQp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ !2) X  P "L  BT  A0`, `4 ( P6/ `,8(6/ `L@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0`(0 } Ѝ8 80  000&c-M 0 BЍA-PCUo 0`0@ 0S@  00 0h!(3/@PR P!@/ 0 ,(P3/ 0 ,8(3/ 0 L@(3/z 0D (3/080P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/PO-Q$M R0 t 0S!q"$!@P`p,ß  0+0* @$)z0(!y0qx0aq0t0@AP1:SuPQ "9SuPQp'8SuPQP`&P5S>3s0uP1+@$ 0(@0S 0P0Ÿ " rP"$!!! q !P!"  " " rP"$! ++{ !Q+" @$ $ rQ"$ S4@H QPQ paQ"$&P%uPQ@D"T% r  Q% "r Q Q T% "r  Q% "r a Q d& "r QQ&T% p!T%$"C0S |0!qS"$!$ЍL!Q1C1@`pvL `4 A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&X A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&| p@-@P Pt`t`@P  !1Ē   0" C  @pPp p@-@P Pt`t`@P  !1Ē   0" C  @pPp  0@-1@4P 0,C @$!0 RG- pph Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G.7&c2pG0N 1pW|GpG|1^NNPV=F10C=@  L 0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq(R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/U/0S0`0/ /?,3z56@-S k>@@0 #400k.06S0k. ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pp5 DMP[Q @!M080I j\PĖ PĆ0\@ CSP$ R(㨆 pPp 0Q= q[P$尐6H0C6RƆp 0€00@ jX0@PQ- 0ඟ0 pJ`{P09 `;ST`+0HAX{T4T+ pQ}Qp0Wq 20|~6{`0,Z`;p HT$@P;0>0 0 0pu0S01Y0嵏  0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00Q0 0S@\ R @02^02N00 R0@\DЍW@  xP 01LY 1R 6 G2#6pP^p N0j 0=C-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-M\PPRf!   `0  +M @Nk@^ᶰZ἖p S 1>@0ny SwpFP0N`ppP`p%TPVPeTEtp漖0@P0dy Swp @0`pp0`p#406@D@0cUSupNT~F0PDt@`@`@@0P#4``0F0d^~p@D[pF5 [0@Q p[ ` Q^kp徠἖0pj9Ys0pJ 0 00#4 0编0iQq0 `V0἖pW 0@S p`W0@T P`㶰[ Y0ʀ p ^C @0@Pc UYuP@ 0PpP0CPpP%TPV0PeTEt@ S6`F3@Ps0kp0p0@0P#4pp06[@cVd 0C`6A0@Qe pW `r 0@P9pd Ws0 @p0@D0p0#406@0cUSu0 TFP `FPDt@k>p@p@@P.pp[@nVd N` 0@Q# p[20@S P`㶰gtwp@ p@ 0T0 `W2 @p0@SЍ༖N~C[0k@6 N~4[@k0F| P`㶰00@S P`㶰%0@S P`㶰0T 0 i p@` 0 `aO-ʀ6MS 3003`003k^0 0300300! A@b9 Ts0@p000@p#406 B 0c^&6S0@ 编0$` pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಀAph>Ys0H000#4060cWsw0 p0@sW `D Br @g>Ts0=@000@#406pGp0cR#6 SvekN&0Pn2Rs0 P`0`00 @#4PP0&N0bQq0 k0&Ѝ 0&;p0v7 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I( , &&x+A-@ k΀`P s0! Qr p p "$  aS2s Ak> u 0  u0#Ġ  <##4U0 0 S000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ MJ, R 0Kp&]EP+(+;0N  q/ ! R7@P j   Q& R \3 "[k. Z0-q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦| qk>0#40缦0j\3s0 J Z㼦yzk>0#40缦0j J\3 Zs0漦@|qk>0#40缦0j\3s JXM⼦k> / ! Zq ! 缦jR!r J^ἦ b _ J  \ P+R +R ,RE R  Q ,Q3 "[Q6k S op3 s0000 #406 cPp 0Ck N.V6 0G. 0S0 0xS0   0LSZ=00IX  && Ѝ R3 "&][Pj 0 ЍO y: Zs0漦)@q:s::s0 r :s0q#r 0{ \  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  h 0S A-P p@0 C`0@=TUT @%P (%/@- MP`p)@P @啲   =p P - @P  Ѝĸ 0@0 Ѝ轸0@0길0@g-T  Ѝp@-P(@P @d@p袸 00p@-@(0P 0S000葸 00厸p@-MP`(@P @ @>0 0=p +-@Ѝps0@"-T l@Ѝp0p@-S P@0 C`10@S=TT 0 p,%0P@p$yara0p@-S P@0 C` 0@.=T/ 0 p%0P@pa$tcid0S p@-`@0 CP0@ =T @ pp/0S p@-P@0 C`0@<T $,0P@p&$p/yara0S p@-P@0 C`0@<T $,0P@Ʒp$p/tcid0@- M@ <p  P Ѝ0護 Ѝ0詷0 0 Ѝ00@- M@ <p  < P Ѝ0蓷 Ѝ0菷0 0 Ѝ0yara0@- M@ <p  < uP Ѝ0x Ѝ0t0 0 Ѝ0tcid- M Ѝ- M} Ѝtcidp@-@P8$0PPptcidp@-@P,$$0P p00ploobp@-P`@P  :0@s#p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@% @-@@B @-@@[ @-@@t @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@~@@-@x@,@-@r@C@-@l@Z@-@f@sp@-P`x @P  0@"pp@-P`f @P  0@"pp@-P`T @P  0@"pp@-P`B @P  z0@"pp@-P0`P. @P  f0@"pp@-P` @P  T0@"pp@-P` @P  B0@{"pp@-P` @P  00@i"pp@-P` @P  0@W"pp@-P0`P @P   0@C"pp@-P` @P  0@1"pp@-P` @P  0@"pp@-P` @P  0@ "pp@-P` @P  0@!pp@-P0`P @P  0@!pp@-P`| @P  0@!pp@-P`j @P  0@!pp@-P`X @P  x0@!pp@-P`F @P  f0@!pp@-P0`P2 @P  R0@!pp@-P@""(0P p 0P 0pgntsp@-P`@P  /0@h!pp@-P`@P  0@W!pp@-`P@!<P pP U patadp@-P`@P  0@-!pp@-P`@P  0@!pA-P@!X0P p,'`P  P `p)gntsp@-Pb@!(0P p0P 0pgntsp@-P` @P  0@ pp@-P`@P  0@ p@-@R 0@ p@-@PV!$0P p00ploobp@-P`@P  0@ pp@-P@P 0@ p@-@x@ @-@r@ @-@l@ @-@f@ @-@`@1 @-@Z@@ @-@T@] @-@N@v @-@H@ @-@B@ @-@<@ @-@6@ @-@0@ @-@*@ @-@$@ @-@@. @-@@G @-@@^ @-@ @u @-@@ p@-P`@P  0@ pp@-P@P P0@pp@-P`q@P  0@pp@-P`@P .0@pp@-P`O@P  0@pp@-P>@P  0@pp@-P`-@P  0@pp@-P@P 0@pp@-P0`P @P  0@zpp@-P0P@P 0@hpp@-P`@P  o0@Vpp@-P@P 0@Fpp@-P`@P  M0@4pp@-P@P 0@$pp@-P`@P  +0@pp@-P@P ^0@pp@-P`@P   0@pp@-Pn@P <0@pp@-P0`P[@P  0@pp@-P0PH@P 0@pp@-P`O@P  0@p p@-P=@P 0@pp@-P`,@P  0@p p@-P@P 0@tpp@-P` @P  {0@bp p@-P@P 0@Qpp@-P`@P  X0@?p p@-P@P 0@.pp@-P0`P@P  30@pp@-P0P@P d0@pp@-P`@P  0@p p@-P@P A0@pp@-P`z@P  0@p p@-Ph@P 0@pp@-P`W@P  0@p p@-PE@P 0@pp@-P`4@P  0@p p@-P"@P 0@|pp@-P0`P@P  0@hpp@-P0P@P 0@Vpp@-P@@(0P p0P 0pgntsp@-P`y@P  L0@3pp@-Pi@P 0@$pp@-P`_@P  ,0@pp@-PO@P `0@pp@-`P@<P pP U patadp@-P`C@P  0@pp@-P`R@P  0@pp@-P @P 0@pp@-P1@P 0@pA-P@?X0P 2p"`P  IP `$gntsp@-Pt@!(0P p0P 0pgntsp@-P`@P  0@gpp@-P@P 0@Xpp@-P`@P  `0@Gpp@-P@P 0@8p@-@Q 0@.@-@R =0@$p@-@0 P $$p@PPv!0S q!pj!0@-$@@Q!lxP 0R @-P Q ٪o// P Ūt0, @-HXh @-P Q @質0ft0 HGg0 H@  0S p@-\@`@@ PBPpP p@{ 8A-P`p! !@P  n`P pp ԩP` a U @# ##DTp@-P @`Pp2P p@(@- a!@P $ )0 0 0 A-pP N!@P  0 0 0 ᚨP=!`P  ٭` P((0 H⛬ @<p /@-@P {@ k0E/Hℬ }-A-M `V $P0 P~8@P!pP  0Pr8 EЍAЍ/ЍAЍ/>Q/HUX U4 @-@P 4@ $0E/H= }p@-@P x0 0 0R0 P 0P Q q" p@pp0X p@-@P `0 0 0R P 0P Q O" p@p P/0 0 0R /$P/<0 0 0R0/P///d 0P @-od  QP  QQ  "/ P/ 0 0 0R/@-@P \0 0 0R  . 0P Q !00( P/00 0 0RP///p A-PPM /o00 0"P R Ѝ R0 0 p`P 0 S  R L  Y/d7 P` &"  00( A-@PM 0 0 0R ЍQP 0  0p`P 0S `  PY/,7 pP` !(00 [?-H L   ; P -/o<0"0 0^ R  Rf/(P/D0 0 0R /@-P :o4 P/D0 0 0R /@-P #o| P /ol00 0"\ R RP Q  Q /d X fP 40 0 0RP / fA-(0`SM.P@U Ѝ P0P pP 00  0P+ S(P0S0"Q00+ @P \ 0 0 0 @Ѝ, gP !h P 00#0 0 P 0S S R/P/ R0/@-@ dhPp@-0(MS/ @{! S   P{ 5` `P $P *(ЍpX  (ЍpD P {  5$0\ x⼩D  $@-@ 4@-(@@l$ 00 S 0 P :\03#/S 0 P \0///A-P``%B@P :6(pP  )̥@P !* W@$$0 x5( M 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ |Ѝ00@- @PM  @ nЍ00@- @PM  @ `Ѝ0@-@P ,0 0 0R0 /P/0 0 0R / 00 !S R!* R0*/-  ^0 : 0P0*  R*/@@/ / P $0 0 0R //P $0 0 0R //pP $0 0 0R //8P $0 0 0R //P/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/LP/x0 0 0R / 00 !R0* /-  ^ :P/x0 0 0R / 00 !R0* /-  ^ :DP/@0 0 0R / 0 0 S /P/x0 0 0R / 00 !R0* /-  ^ :dP/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/\P/x0 0 0R / 00 !R0* /-  ^ :P/@0 0 0R / 0 0 S /TP/`0 0 0R / 00 ! R0* /  \ 5*/P/`0 0 0R / 00 !R0* / \ 1*/P/h0 0 0R / 00 0S00/ P %:/P/h0 0 0R / 00 0S00/ P %:/P/P0 0 0R / 00 R/! / P/h0 0 0R / 00 0S00/ P %:/P/`0 0 0R / 00 ! R0* /  \ 5*/@P/`0 0 0R / 00 !R0* / \ 1*/P/h0 0 0R / 00 0S00/ P %:/XP/P0 0 0R / 00 R/! / P -/o<0"0 0^ R  Rg/lP/L \ /  JQ\/P/L \ /  JQ\/P/P \ / Q/S/Q\/\P/P \ / Q/S/Q\/0C-M`000 00Sp pP Ѝ(@YP+ A) 0Q xRK  P p'*0 00 0S  P Ѝk P p:^0"SY0"SU qp  0 00 S B =0"S꼷 O-MM(@PlD1 p000$0`0$ 0 0[ Q` $ 0`;/0 `P Mߍ ƒP 03/P 00  $ 0:/P 000 WPMߍ舷 P0p@-P2s0AL7@LP@a`Lt0 0LWLV p@|0 T0s0^0ppO-3KM `0 0@R @@@$@@@(@0 0Cs0S50fSQ ="SE [Sl2 0 @3/P 0p0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 R,P0/S7 0(00>S: SA 0S p03  0Bs0SR 0 S S5 S3 .S 0 S S+/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 8 S =SB0"SQ0SN   0"R "R RAC$ >R<0@ G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Pm \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R4\ BR   ;R<@{  @d0 8("R /R 0oP 0 +r  R:Y Yy*     SP(0 Rh \Re  uRa AP [ +r PW6I0 r    0 # <  P,!*-"-  ƠP  * --  (  " "0  p < O-Ÿ M @ 0Ds0S<^QQ@`Q  0>S 0 T @P (0SP  R @ ЍT" T& @P0 S00sP  @P T gPy0S  0Sة ̧ HG--PMႄ`@PL ,&pC ,(pF 0F fppSp>0? =P P&u&  }0 `p r'Ѝ00 \0p``'`Ѝ &y`Ao/A-PP 3P`p @@P^@@ @P p40,p0P4080<09 @-@ . {@-(@@ ԕ᧝⤝@-@@O-4@T p`, ⑝P @@D¤@`T P礀Qㅑ8080 0PZ PZ P$  @-R 0P< P 4Q ,  4)`0 00 0t X p@-@M4 00R1SP,0S@R 1`V, P` 0 03P 40, 0C40P" +`ЍpS" RЍpЍphZ<.0⠟PPj?.0♟<co?.0⒟$$N?.0⋟H , y iA-P`,p+@P W 0 !᩠,@0`T,@0`C-`0@SPpMF  P: 00Ѝ!0 .P ,0SV |!0 v/P ,0S(0S00  0iP 0S?0S0"S`0:S W0}S "S000"S v]P  WP @X 0 @aP $$w?{/0 Р , \ 0p@-S X  Q P@)0@#p`0!.0Þ<ԟ 0S ,0 00@-?%. 0ⱞ 4 @-R 0, B4 P @ 00'>/0⚞o?/0ⓞ0  O-80M@ Ѝ@p` CPP @ ` @Ѝ娒  <ߚPP0 4004QY  4 ,R\ 牱Q1v  ᮛ P 0YIV  B B!᫆,0 P 04 `<0 04 <0 P,UM<U7U+Y& xx @y aP  ዚPP( o 0,S<SS8 vPh @ <0P0`<04 y<~ !W,0P ᳚YP  |,j\0\02.0НLW?/0ɝ4?/0Ts8L 2 Л p@-@PP 0S D  Q <0 0 p@`0/0❝됼< p@-@P 0`0V<PP d d0 0  0@S0<  pPp `0/0s,< O-0@SP MT p}`40SP p `iP@ ЍLP P 00S 0r  A> 00/PY 10Z/ @0R+ P$ [] P 09P 0S P( Hqpc0` ЍO J P 0  03/P  40R1# P P6>/0c 00C 0 P l`(@yTT?/0ɜ@+? 0L  H , З \@-@0,S<SS?/0❜\< PG-V Pp0`WSW@6 404 S @  S3 E000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P :  404 SS@  @<<-B> 06$$-F> 0.p ! 7G-PS @- Y`' T 0p 0R   004 00R$ vP r 0S 0 GXXG>I.00,0,S <2.0ߛH 1D KJG-PP' 0 0R"#4=P 40S @,0aᄑ1p !  ,0`p40@T:8 408  0P 0  Q@-P80080/hp@-@P80080p@p@-@P 80 0R@ pP4@pp@-@P \0 0R@ pP`00S@#:p@꠳p@-@P@pA-PP 0 0R4 p`40S @40S ,0P@ `A-@P 0`0VpPp0S P @T <+? 0@@VX A-PP /o0`0"Q@@T @0R p= @P @T 2@+? 0Κ먱 0P T@- ^ 400\@,/<2.0Ⳛ 0P o@-p@ T\ @\400\@/<2.0⎚뀰 @-PP M 81 0R Ѝ`@80  Ѝ@ 8P 4 0R S *,\$0 B!p@̂400C40<00<0``K.'> 0HHHK.M> 0@00N>K.0 07 u̍ v w P/?o0 2 R0S/0@ S/ꄮ0P -?o82 ^0S 0 S /4P/0 0@0R/P/0 0@0R/Ἥ P -/o<0"0@0^ R  R] /ᄭ A-`P @PBpP (0SpY0P  pAT-`Ĭ  `ꨬO-0S@9 0@S7  ` P. X6qPp@ P  P  P HXPU0UU !B< #1 0@?,B PO 0s0L deX% XP0@#r 1/tF0,Spy BAA-PP 0 0R44pP 40S @,0a, 40a@T:8 408 mp脓@-P80080p@-@P 80 0R@ pPR0@OpȒp@-@P 80 0R@ pP>4@;pxp@-@P \0 0R@ pP`)00S@#:#p@(p@-@PI@pp@-@P 80080p@p@-@P8@@@pp@-@P x0 0RP`40S ,0AT p@p@n?/t}$hv aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@m@44?/tC ?/t<눐u du p@-@P H0 0R@ pP`F@yp耏A-PP0 0R@`j4P%80,0!qW# P P ,0P < 0@ 40< GA]AA4?;.tn?;.tܑ t s 0P -?o82 ^0S 0 SD/p@-`P pP@P (0S p@ `  D0 //@-RP0p0 ␑v O-IMP  @T p `0 R 2/0RX P Y  9/0  p PP @TL0P _003/Y@ 9/T [RT T @T@" 000Q 1/0YR# P/0S% 03/P& Y 9/4R@TL0p d0P Iߍd0p h0p Y 9/Z 0 03/(0p u t t t dt t P0/O-@MM(p NT 000 0\0+`P$  T%0 `jP4 0@ 4/@P`P@003/0 `OPMߍT00 0 P 0 $ \00 Mߍ((0 ⇐ R00`r # 0/0/@-@@UA-pP`PM1 @T. T0@0W   WT 0 /R C 0CW /RW  W0 0 B/Q d!0C@T@! s0@ 0.0 0!  R0* 0 0bp@  U M0P=@EPۍ@?00@ۍ S0p ]P[H'p p #0P@r  p@-R 0@S PR:   Pp0P  , 0T90( DǏ<:p0( D$;0( D⹏ppp Tp 8p p@-@Q PPpQpC-0 MS~@; rbp`PAQ <Q$ >Q &Q ĐQ P ЍP Q Ѝ&㼐Q P&㴐Q xPPU a/U`U"0E'S0 rP\bP ]P PU /U\U fPnPtPbPUt 0  O/H PQQ 8P(0F/Do o o n n m 0S p@-P@ P@p 0Sp/p@-@QP Q  PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@>0Q/D⫎l #0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@>Q0Y/Drk 0p@-SG@`PU Q Q rP<mPp PU Q aP QPU Q TP QpPQ GP Q/?P p@>90-Di cA-PPa Qpp0` XpWW@PS  PL <V`p p0 8/PP`<`nQ P P 0S 0P P 0SPT T /P P 0 Pi X~`h ~p@-P@PP  1Pҏ0@͏@p yx011/A-\@`pP \1S 0 €  P 1 P1 `p P 0,0A0 4fB`0 4_8i i @-@^ P ^%QRS  T00%NQRS"  TŒ 00Z0 4%8h G-@R0(M0QP P 0 ` p Pl `0T?o20S00(Ѝp`0 th 0     Q /0     P /0 2/ / /    \ /0 2/ / /    \ /p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0V P0V00(Ѝp@ R 0S V00tf 0Q000 00/@-@Cp00T0007@-@T @-@T000 000S/@-4hp000 000S/@-$(p000 000S/@-p000 000S/@-訇p000 000S/@-hp000 000S/@-(p000 000S/@-ԍp000 000S/@-č訆p000 000S/@-㴍hp000 000S/@-㤍(p @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#,CBB 0 01/LB001/,B0 01 / B0S@-@1/00/p@-P0P0 0@0PS` PpYp.tp/r000 000S-/@--p@-5000 000S/@- 較pAo//0@-p@P M , P7 Ѝ00;0 vt`` @-p@M D #P pЍ 0;0 wt@<` 0@-pP@ M T T T  0 Ѝ0, @ Ѝ00:0 Պt_ p@-@ @ 080 Ê^t _ p@-@PP $P(Pp070 Ⲋ_ p@-@PP (Pp070 ⣊_ p@-@PP $Pp070 ┊_ @-@P  Y.<+ < 00;0 z_ @-@P (070 m(_ @-@P $070 _$_ R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@᧊ P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@PI80 0 @  0""048# /UUUU3333  M<p@-PQ@t : Sj E Sd0 a Sp0  S?0c0 r-w-!- R00K <Rx  -   r-w-L  Q5 $Qx-1r-@w- T" T T-x 00p Ss0  Sw0 S?0l0Q s! R0s  tTSS   S?0b0A0a0-0090 lZ O-0AP@:  cpP? P?  ᳃pP% 00e` 0@T% P0=S AP` AT BX ! o`A<0>0 ⪈ ꥊ00z|Y C-@X2M0 LD P @0H P@Lh p`XP \@`@d@h@l@Xhpk p ap` n{{n{ P  { p[ p0 0S04@R08@<@@00000+0++0+@1@00 0@0 00d+X  ">0S _lp@     Ѝ oЍ @0 0   lY $yHX O-PMp 0GW"S00`0v@‚P-TPg +T@`0@ ǿ 0  n 0 n P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`y00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 PUW p psW ꙙhT 00 0M0Ѝ6s3O-PMp 0GW"S00`0v@P-TPg +T@`0@ ǿ 0  m 0 m P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R ۈ "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`ꭈ00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 $℆UW p psW ꙙQ 00 0M0Ѝ6p3O-M8@t 0 `PT uL 0 `PT j nN xN pM PM L L L dL 8L @- M|d"{@{ @0S H @0 0 |0 30Ѝ  @.\j j`K -M{(,{ Ѝ 0 0 9/L mNA00/ G-@SP, pE`J /Q# /Q JLXP0 S0C0 PY 000 cJ O-I,MQ@p 0L R^ 0S 0) 09 P0S009`0S p) d)d  X)X    @}PT0+0CP I @p  q 0| 0  0C 0B0 0 S00Q?0 0X0-SQT0}P0-S 0 !000 ,Ѝ 8 H 0@00q p 70  ,Ѝ01 0 B0C0@嬧 :Q 3 0+ B RuP 0& WY :R 0S00007@0| | -Q000 6$  0 0R& 0 `=uPr A 0Z @P @` Pp@T ᒀP  P2M v `  Q Q 0@RTZAgv 0 Z Q! 500S 0:S   0Sl5 00+ C :S:Q ? ,Ѝ0JS0 S P0S,ЍA~TPX `0 W 0S 0 TPX` H0  0S dH0 ,400S 0:S (  M 30 h0X Ȃt;R0S00'X03 00S 0:S (W d30 0+ C~0|  0S /0:S  X 010300 0 0S000200S 0:S 20MQ 0O00P200S 0:S hRZ< 01 S0$0002100S 0:S I00C 00!S0 0 00+ C H0 . 0S lh0&|10 4 h080 88!0 00S 0:S |000+ CR@@q 0 ! 10T th0Hh(( $J J l 0 H 0 4  4|G |F <XE _E D D lD a$D |C $C B TB A A O-pQ ` V 20 R" P@T60崢 R01-[@P-T@PC T"hRPP sPA -@s0P  :R9 20 0S " 000PP@:T0S! 000100S 0:S ?1 0dM?@0Sp1 0 0@TQ 0:S  X 4 $1$Q0:RP@P 0S 0 0P00P0 0 R0 VWST0  OQl0l 0 ]X,@ 0dP@ ? x? <? (> > > @-@P @ 0/0 ـ> @-@P @ 0/0 ʀ@> @-u@-Q# Q Q!S3r0!# Q010! 0 SL^" 0r0!#   ^00<H0 S$00 M{T00= = G-P @p0#03w0q0W`@DT@!  c 0R ! 0 )P   G0@ pQP@-pp M P@P `P% .{0 @p{0 PP  Ѝ00P Ѝ0`P ` 0P`P 0 0 X("V-0   X4"|Vp@-@PP` /o"0p@ JI040 H; @-@P 0@ 9I0A0< ; p@-@PP /o"p@; %I060 : @-@PM 0 0XRPЍ000 : 0 p@-@PP U ڒu00QUPQup u00QUP~u00Q0/0 gh: 1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PT 0p@/pA-`Qp@P R}P0开D00p 00$`,@(P0R 0 A-P`pt@PB 0U0" V W- p`Pp`P\}P, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`PЀ00x`|Tp@-@PPM% U 0`1S ,0S $0S  pЍp4<80 ~0;0 ~T7 47 @-@P 0S# t0 P @0P ,0 000 01 1 00t,0<0 a~_ 0 6 p@-@PP$ U 0`1S ,0S L$0S E`Hqpp4980 1~080 *~D6 $6 p@-@P /t00CS00 P-tp:P070  ~5 --M  RGЍ Ѝ/ -- M0 0F ЍЍ/0@-0P$M R0 PS @'  S%y 0   B040!  D$Ѝ00y L0 000 0 PS@$  H\5 45 4 4 P 8000S(/00//l4 L`4 G-PRSQU 8M4p`2 YL\ U8   Q Q  2  j *yV @P  j .@yPV$!1 0 40 30=8Ѝ@@(4P 0H}Y) @P@ PU qzP 0 0  | 2   x @Pd@P@XX0( 4} X0}A' M0<@L3 H;x3 d3 43 $3 - M ЍA-tt1 0!M@P0<80P`J p4 41p4宂PP !1 0 <8 309!ݍ0 }  @ 0Pp[PP@T Cn` x0P8T偂PyP @T@'$,0,0 |&JhJD5 4 A-!1 0!M@P0<80`d QPP 14GPAp4t1 p;0P5P  0$0(0,0000@ 0ppPP"@T Cn` 0P8TPyP @T@0S  TP嶌| d0 0 <8 30!ݍT00奌D<0<0D %|O&8Ih 3 3 G2 O-ğFM MPQdč@`ᐤt嘄 T V Z XX ( 0K0;d 0P0S  0KPW  0 P(00CbP  $YPx TPs$Wj ,KPj({,y&bP $qW ,m _ #3 0 d4 30Fލ Ѝ|0P3Ԓ MxPxPi /1P@@W  QRC0Sk SIT" W?@Y/ 70 Z$0 IPB}0 M{TF0 D{V?0 ;{Z8x_0 2{0X!0 W/60/$0S㈀~ !P  0-6  W?@. 6 xK%pE(GE0 X0 0 / / / X/ 8/ y/ z. {. . X. (. - - - - @-PP1 0M`P000@P8  y{T p T0U0P @@P@ 0 0 0 30'Ѝ|/000U00000|P 0?s00H]?a/ z|0@5}|@$ B|A, @-@P @ ~]?f/ ez+ O-HHǟ M Mčĝ((ĝP "48 80S 0St $0S{ (0Sf IPaD@PHh0  <0@pI P`6&@06 0!>0t6@000}?, @p0 Ip!  Pj |00S# |0=SPX PUPVPU ?cP@`{0#S< v@T <k@00C@0{0 倀0 00 05P%{000 @0 00 4P 4 n*,0$zf00$zf40S@00C@0  0p@D0 T !6* xX @- ! 1 FM0 M@P0d40p/ `< PPd@"J+ P r0@r @R` T0 0 d4 30 Fލ Ѝ,NH0X pD0 @-0 0dM@P0\00p` P \P H0 0 \0 30 dЍ(hd0p pxp o8n8@-<@<M@ ]0  Ѝ 0P1Spp//0@- 0 0M@P000P' U  0 @  ""@@ 0S0(0h \0 0 0 30Ѝ0)PP(0F0 9pc | G- M砐 p@ U$ePH0S W0Ep +@P2  PUo0 ;u0 UB @P  U0PUo0q0@q@  r 0 0 4 30܍q0PqTP  0gQ}p xP|`d 0- M Ѝ@-0 0dM@P0\00p`    'P H0 0 \0 30 dЍ(T0` o8 O-/? 0M@Q000T 0SI X@@P 0\@?P `@ %   " P l%X!;d \p`D@lA @87lA$d @b 9 HnM aLP,hPpb!5_T`l`:b.͌6o+(d! P% PPbQ tP5_l & d!, p' )``d!" x` 6o* d|@n,4O-p'`pp%nQ $pPp pnQ%Pp !7( b n ]>a,$bA!(@bA$͌e!@M l 8+,`&'pbq p)7 +0).)&,o.e)8`` `e.d)` !6o) *"( 4*" *(((e8P*/+ $ ("*, " 8 0/" *p'*''`$pdq p dq' p, o& o&o&$ `n da(@} (a (,nA!@o͌`nA$g!@ oMnal ga,`ga&4`_?`/%/"(`!) `0!,`/"!! g1pd,)_%0 !_%:_%`PodQ `P%P ` n o],daa@n!o`,o po&po&   $M` oe!na  `4.+0`+(͌..`dA. pea$ `& `l$me.`_l P!_O%f _%)_% O$_%,$P_lQ_% ,,_%O$_%%Pnf._P*ᝉaQ.魊i P%쟃4f Poa ` )`o.o&.o& `(p..4p0p]j oaa.o&$p!!, o&o&坉o&eQ0`ja% `&pi%`mj n篃i.!_p /%,/"_%$p"0 _%p/% _8 f!.iQ " _p%4((p_%(_%p`%fQ 珃P%-a P] b./f!`a!( "/ "''?a1,p8!++4/"/"p/"< 0 !!!m@e(!&f1e1fqp?0 nfpn10}e$Pa1n1a?f1?8@`O#?#?#]?#O$(`0g1$a1gA@?n1@0 .0<`,,0 ,`.e.g ea` Mςa ``e `ςmg 4pd.` dςe Ϡ p_, p,_%p%

pmvmzNS3hˌe;# 0͠T0+>C3C7Cg; )0隠c{n 0  k{Pct0fˌa" a(f `hHekb,b(e P]@a[l&al( h4bf%bf! L+I pᕓI嫗Ik <ll`` +LLd e+(Ldˌ p'e+" p g|nˇ\pb)f+ *h! ph,f{`8 +LLLnˌ ꩠkˊ i p`Kfileka" a,eP @0e]h[ $bK&@hˌbK$ @dIDaKf%aˌf. n`be$bge( p苠8fd.  f+d,dlʠeˌn{( pe+n{'pXP`"{d{g ,k+T`h+, dh+" h+APfjAkkAkP%P4]+AAA`[`b*Ln+lK'@n )lK$@iMXhKg"hg.h 0ll;Xd.dˌ@nˌb$ b,l̠gˌ,04p (llphbb+Dpl0h{,p+>Cn{,p'3Ckp7Ca;}d{0lK(0@$@dJL0nKd;f0h;'0#0;l;ae <$ k+* g$.ꩠk n8hnˌ P+LLLkˌ ` f "( P`+(  ,`+ j+gd#, ͠gˌ\p +~GsGwGf{`k芠c{.e p' phhgyd{g H "+@@@e b,a+P``&dnK,`@$mjk @Hj )dMcKl 'c; ` <0n P`g;$0#09ll˃T00l[d; 0#a\0gda{`;,0# 0=d;$@cKhK@(@clK!@$ @H`K d b a+# " )l+c;$0#0:a;dK"b+  @$@0䊈i= 0tЍG-Pp 堑? 10@@i00T0Y?W@` @@@`VVT(@T(pG   Gc ` c`i=V0@-P@  M  1?0 @ cR c B T 0 E,̠P,ĠD 80 0 0 30` Ѝ0@cs  (Q- 00 R- xB@-d @4  R  *4 8/ x0 S\ R `0S Р@- d@ 4 *8/&0mxB /*(0"8 /:$& /--M  Ѝ Ѝ/0 ] 0c  R0 00//@-Mp @a`P`W P0D>S 0!3100 0aЍ>SD 0!3100a00a00/-p@-MaP@U@0 ` ` P|0| 08 R;0Ѝp@Ѝ/0 a0x, ,    A-@PP`p; =U( X0ES  S0 +0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0X0+00+0`0p@00(0]0 E_00 p@-PP@F 0a `0RuSpWS6X0CS0 p à 0R Q PSPQPQ  0    P0 0+S -Sp0 b40D ^ I@p O-0wSpTM 0@@ 0`004080<0Z R0(0` @(`@T%X7(P0p000000G @ @  0 a0GS00 `00`0@P`@PTЍ+W = W0 -S0000 0` X B R  = G/oS"!"   ( P:0,Pn` ,f` R, ("@P0 @(偑  ( 0S# (p W:,PK`p ,cC`0S,0"@(p剑pGPp(pW [0 0X I0 0p(ppW ,Wp`uS(`! Y0,P`` ,3` Rm, "@(`0`FP`(`   q`(=W +0G?o 2R0S$ Y,P_ ` ,_0SB,0(`""`FP` @(`傑V [0 0X I000 `(` 0 V:,P_ ` ,_0S,0(`""`FP` @(`傑0X0 0!0($ KR; I?I00 KR<I _0 @$s$0`0S_0"SB  V*(@ T:,P_ @,}_0S(0,@0CP@(@Ty (2-+ 00 ` 0TЍ'pC  001]0 R]1]0 K]oꔱ1FsC_00(0UpJ 0Xp+`-@ +B XR R  +B0 -R +R XR 0 -R  X@P`QpP0]0 \~80o0P \d0 B  h 0@-@PPM 0{ P@{p`Ѝ0 0:0 \  4 P 0 @-t]/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`NP+NU PU  0   P@P PPr_P `000p@8000>^0P7^P X p@-0P@`T @T0rS Ppp@P0+Spp@|0@-2$M000P0n 0Ss 0P 0N 1 00S$}Wp@2 P! W0rSB m0 P0p1 0  T1 P @00S5$Ѝ00oP0T X@\4]@_W0 00S  _a_]@PI*0 P0Op< 0P$Ѝ0T 0 [8@0 [p$hT dh0h d 0@-$M 00P0  d 0Si 0P0@ 1 00S<p@& P 0rS: 0 P0P10  41 P @00S-$Ѝ0Z0]0 @00S "]@P0 P0l0P$Ѝ0P 0d Z4@0d ZpPf@f f` @ @-TAPP@ MI D1p0S+41@T4 `0`S( @0SK0V0, 0S%P\0S   >p q Ѝl\0@T0S hR\00PKD  088l0x ZpHddldD G-`PPHM6 p 0 p@  p@ HЍ P 0 p p@ HЍW\0S @X@0>0 JZ=0P R@ O-P4M@P\px WnX0S1 `00 S 5/040 00!S5+0$0 00!WbW0^ Y\ X00Uh5Sd50 0 0 0 0@0` P(0`0s 5`0D0$0XU 0S30`jW ,A 0`fUVW@P ,(05#K 0P` X $ 2@0 8$*&  # #. B@T$0#"A $1?"!":  #  0 `V4Ѝ3+00 00!m|3/00 00!e`30$0H\.d0La#0L0|2pST0, P `@!TP 0`V ^ @P,v ^[X"$:600%$0<"%>!!!0C$"0TP%"1 #1O"QX00 0" 0$0 0?S%D P @ `1T101! T$?01>! R01"_0`A(0l10X00`d(00@t`dP(0 T  R.1@$Q5 0A`X0 0A$0PE `0P 0  `1`190T dXt8H0T dX~`갵 GzGԴ Q(\)\x D $  SQ @  O-PP@` Mo Tu V| p0 (T:R P- Ÿ P2 1L PPm@pQ @T*RP P 1L P R 0Q[ SQ Ѝ\ P @@0 <0\; \ @ p R@p\ p W R:\#Yp 00  XT80 XVllD0 Xzp,@ \?[*!]-t T 0 p@-@PP U p@GHHT0` WU((h0` Wp@3Hꌭ h EG-P@U T\ Pp ppq W00"1aP: P] 0S\ 0 R 0C ` PP0 X= V  0s0S0 0 Q 0  ! 00S-*_oRe`V:P" U  !4Xxxt0 sWT\\0 jWDG0 bW`Y00Pī   C-1 M0 M@P040`P$ Q? U5  0s0S0 0@ $03/!1 0 4 30<ۍ Ѝ,Qpp 0WV U G0 W0 Wtt0 V P0VD40 Vd C0  E D O-TTƟMM HMPč pTDe0] X@ 0SG VN 㰰XUZ0U@@ R R0 0C?o2 000RU$00 S0E0@b0S0000SgV $0+F0C 0@ 03/[o 0@ 0000,00G(0 03/P     0S00 * z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ P (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  00s0S0 P@T  0s0S0X04/P/ 0,0" $2 MލЍ  0.S0Sm 0.S|i0S  0@ 0J  2/0S0=  000.SP _ %P 0 @J~P? @ c  2/0G(100+$0 00 `P0XX0C/Ur0W R 0IE00 U0S0 yUV0 pU0 hU0$ 0QS]W0/ 0 0 @  03/0~ E E0ywT0*$ L / ܣ   O-\\ßKM MPčp`Pؔܤ; WB UI YP \U /\@ @ 0\/\0 V'"2 0 4 30KލЍRZ/\3/00P/\V\% p80G/TW0G/TU0G/TY0G/T@Pp PmP 0   R  O 0T/S 0: S+ S 0 0 0 0 PX! +0s0S0 0@ (03/0S0: STq*/00 Rr0xPxP 0I/oTG 0 jTgV/0 0R괫 p mL n( o SO-şM5$M 0`P000P 4 QD @0~S<   pH 0S/S;RL 0B0 4ZS 0H*0; P4S 0 0CPR- IR*0S0;R# 0X @H p S    hhh*S1 s00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+p@PU 8#$3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0n 0]S  s000-S]Q q0]S  0@< 0<20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 CY0 [0!^0  @E  p4` L0PG H *; P 6010Q@@Kp0 SU 0M/R0K/R0M/R 0lR0TM/R@7@5 ?**t[-]8 ! ԙ  O-`QM@pM R W T   DSI^ @P}\ @\ [\ {\PU PE0]\\ \8(<PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(B 0SV 0F0C  0GS0 0 @ ]RR ]RR xdd0R/)RX Wf@FU?R/R\$$0R/RR꜖ p P p@-@P`PM( V/ 0  0 S /0{S 0\ {\ P 0# Ѝp0}S0S Ѝp@T0.QV40.QS 0 ` < A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ| \R@ @R@ )\ L 0 R+ލЍ0[/wQ\@ԓ p@-`P Pp@0T1@D 0CPP @T*000p0]/SQD 0S$ -*S ?0Cs\S0 P0S Q 0S 0 0/ 0p@-0@ TpP"TC ^ (a`00 0DS'0 00@T7 "T- 0 P \T0"S0@T&0@00 CR S 00p@T "T P 0#00p P@.T \00p踓 @- ! a 1 `0 QM MR050  0 0 5 30-Qލ Ѝ ,p p@ P 0 p @EO0 {P@0, P 0l k5O-0$eP`M 500S E@ p#S"]R0 幭P$ 0S $%P @ 0SBR0SЍt `p  0@S 00 40  0Sy t匤匔匄p ,p<0fS0fS 00#3R0 4$ 0000@SS 0oS 0oS0nS 00#3R0 # 000  MP  00#3R0000 4LP 00#3R0 (# 000 LP( 00#3R04 " 000 0#S 20@ R@@AP00Ѝ0 S S DLP 00#3R0 (" 0@00u LLP  TLP3 00#3R0* ! 0 00V 00#3R0 ! 000GlPT 0@S0 @  \\LP =QtA 0P0 0 dILP=Q 0@0 0l≝VA 0P0 0ktkXkjxj A0$00 0p P2_P<000S[  OU_ `'T7 0 0 30Ѝ `s?0l0` Ⰸpp  PWpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #S R BqQ #S# I BqQ #S& H BqQ #S% G BqQ #S> L BqQ #SS M BqQ #SI N BqQ #S? O BqQ #S8 D BqQ #S E BqQ #S F BqQ #R 0S:U 0p0S8 Rh BD{tP `0000  00  X$   840000   $   30000S0 @  # 00   pW p[ pNO000@GO@W 0] @O000S 8O0 00OY 0 ![ 'O000@ O@00f@p00,(@ ((@(@00,0rX X}[  `Pk|0Sy[t+M_0 LGN00N  PSp~pc TIpt0`00U0`0 0SCN DqpLp 3Y*0p0Z0 N0SY00M pl0S0/ `00C0'  L p8pPpMpJ[= 3pCkp-pk@ꈑh   @d D Ȃ 0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF/pP P Ѝpd[ZA-P`? A@0S'A@Q0+pPpPP 3M@@P  p0 @BAQA p0 p0 $0<0 KZZZZ| p@-p`pP`P@T T0T0 R@@p5P00u)YYh)A-P@P`@pg0S |@@tG R"@`YL@ P00M0@F)YX(@- 00 \X@-B`@MPNEpP 0S|0A@@V ! @p `UpЍ J0P  R 0QTG B&R  8A@̙4əPęRS' Sp@ S'@z@ @S@u@@S 4⥙@q0@@@4⛙q6@q4㓙@0P@@4⋙q; @H  ~ WW`~ h~ H~ ~ } } } } d} 0O-HH% BM M $$ ,u,%,p     000 0000+0GP 4 @0 48P (`P,@\ P 0S x400#S \ P 0S @4@D0@8@\ P 0S 4 D0@8@\ P 0S 30   \ 0P 0S Ym30\ 0P 0S Lml30d3dS`F0\P+ 7 `< `P\ c@P 0S FPPU PU GP20P0xS~ "p2 0 $4 30Bލ ЍP@\ 5P{ 0S `200#SJ \ &P 0S (2(B0@@\ Pa 0S 100xS0xS0S& 10 0sSA0wS>0S;!  1A0@ @\ 0P 0S l\10\ 0P 0S l,10 1P0P!0 $ 0 D0xS}0S y00  00 0000@FPĂVT} U8} DUUX| T| TPTTTT{ #pSRR z RPRxy Rdy QQQ@Qx $QQQp@-`@@0S P Dp

02d Q@NS pP@J0V0  ! @T3 0 Pc/T @0 $ @@T S0T0g /870]Sf /Sj \S4z n xn @0P@-@ P H 0 Q 8Q?o2cpl Pl p@-p`@`PCP CP T00pT 00pLH 0 p l O-0Ÿ M pc P   ߼ ݼ10 230Zߍ ~PT 0 p H  pP 7 R @; 0`  0P ѻP& PP 0 opP 0 TP0@T*p@ F 0 RpP G - R  otoO-0Ÿ M pc P   W U10 230Zߍ PT 0 p H  P 7 R @; 0`  0P IP& PP 0 pP 0 P0@T*p@ YF 0 pP GG - R  h mTmO-0Ÿ M pc P   ϻ ͻ10 230Zߍ nPT 0 qp H  `P 7 R @; 0`  0P P& PP 0 YpP 0 >P0@T*p@ E 0 <pP F - R  k4kp@-\@0@`P@ [P0S SP 0p@e p@-\@0@`P@ P0S SP 0pd p@-\@0@`P@ 5P0S SP 0phd 0 00 @h-H- M 0 S 0  00\100M0 R0    R S8 00 0 0 30KH Ѝ/I hxg-H- M 0 S 0  00\100M0 R0    R  .8 00 0 0 30KH Ѝ/ gf -- M0 0'--M  --M  A-pPPp` V Q @Q PD@h0 0000Ayf@00 C(80 C0eDa (a 0P R   0//\O-D'D7 0pD 0 $p  D`  R D\ 0sq[@   1-)%! p     p  ( p  0@1q00p`I2#8ẘ"0\p  !@p0@0t@5T0A1@ 00嚸!0 0 40 30)<Ѝ  p @1!0  PDw>PX00X0hH0X A7d$<<;_ _ ;P_ (_ :_ :^ X:^ R:L^ 9^ 9] 9] \9x] ,9H] 8] 8\ 8\ l8\ <8X\ 8TPZ h66WEVd^5Y p@-@P? 0S0 6=0@0T;  T06 0R/Q T:\& 0 \/RT0C$0C/QT :0 BPU0P!T0x0pl@@@P` EB0D@@@0/S ,@@@ @@D5,5hZ 58Z Z Z A-M`P<,A0P@; !0C p0 00    0 b0C S'0 pC0 0`0@S` 0S 0SB0"S D6!@Ѝ T1r0:B00X[ Y ~@-@P1 0S* <@T. 0T)  /Q0C T !@# *0P@/S 0 B@T@!p0 0A  T D@8@0@/S6W W W 0{-DM  {000p 800S DЍp@-P`&p P@p U V p@pdVT pP UV V Q?o?o 0C-@c^?c^' ^./ "(0C0;: `pCc&Pc2680E270G2&1H010 /0 @- / ,00-+C@ P@ 7KE0 0/0E0E0C 400-+C@{$PG{6KE0{7 Q/ 0E0E0C /0P!Qoo G-@`^?`^) ^? 1?1>(@04!50;:@p@`&``4 3V4X4G1Y01000 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C J@ @-p A J@ @-p J@ @-p J@ @-pPP `@-:A00p@-@PP  p@010 '?R ?0/R//R/?0S/R/P/R/p@-PMP`V }@T 00?Ѝp{ : { ('p@`($ Z 43LQ 00 R \3,@-A00 0S@X| 30 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB` :@ 6P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍDPP @@ @0(@$0N3POTOO-pϟ 0 0XP(<Ѝ 0 P(000U00S  SG 0$`Ph08P p`C PM9 P5P p W R0 0$`0P 0p`C P19 P5P pW R0 (000@ 000@(X(P:(PzW0  GS(  +S{ -S 00 00$P P䅐ಐ/P:U X$P( 2c2c2,,S \0c$00P 0(0w 50 ,P(^U0W0,0i0pP80  P@5P7 p8P  65PP+ 0(P 0  R9,0X0!0 B 1X/0 00; 0  0P(10 ,0 c0,@ 0PS,0(111v>C 0C,0  !/"b!!A0,0 X0 0000 0 L: ,0 @:,,0 v>C 0CXP0( 000 50 ,P(0PX%S(P 0 ,, ,0 0CP0(000Xp 0  0P S(I 0 00X00 0090   0[P(X|X80   0IP( =0 P( X 0P( `8 ,, ,0 0CXP0(m000y 0 P(_000k 0, |,0#/A!b!b0C P0( G 0 Br0 S\0(0Q0X09@7 0 0P(@ c0 ,Q 0PS(, ; 0@0?2c11!, 0 0 0000X60   0P(X ;0 lP 0 0 S0 (0X(P0 0 P(%(P000 c0 ,P(00000  R 0s @`0PPv0 P@ `@ @a0Ka1c B  B0   0002 !/#b!!"A ğK/"bP 3 :bQ # 3,P b4p$ ,  Q000000&0@ 2?3c112B #K?###cR3:#cR#300#0010 !, 00C0 00@TP2 R0PR00D0PX$`p(P$0000PX$`p(P000,P !/#b!!0"A K/"bQ:2bS0#03|" 1 ,0 B00DRd , 40 00N(0~0 S!0r @WPO"  IPH 0 40N~ Q @(P0Pq 0(P00(PP @ ACLC|q \^JS S 0 0#3P0 z G/o"(PzW (PUSX ZSP  @ 0 P ( 0$0:0NXM QJ l',H G n$IE P)\(\ ף|C PC B DA Q-10PE0,P ( $P( Pd#/"b!C;R, a2ba12TQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @\ 0 @V~XP( 000 SeXP( 0000@>0S; 00@70S 0@0 H,0 0P P(00, 0C$0(w,^2000c^\0M0c$P   0P  P(00 , 0C$00(0P @   0P ,  p#P ( (0 b$ 900 0M0Ѝ`;A-1@0QPHP P MO Q&t10d0 P1$\Pp P@@ 8. R(!  v P`U! Ѝ0 P0  $ PBa @ ` U:T 0 Ѝh H  0!:00|; h; *(; : : : gfff: P: @-0M@ 0P {00Ѝ@-0M@0P n00Ѝ@-տP@bp@-@@1 00Mp0,00`@P< U2    P00Q Q Q q 0 0 ,0 30 0Ѝp b p]?: 0 P;@0 3840:0 ,8V8t, 8t,t,9 8 p@-@PP U 0DPp P @p8070  8U880 88 8 G-pP`' X- Y 3V @P0PES  R  D' 0PEV R  RS0@0D@ 80H0 7XI@0 77 7 R@- 0BAs @Q 0CR g8@O-錡PP p MT WC 2@PH 63PH  g2p`J J3(101S Y,3 Ѝ0520P@2P* 0 0P 10 0  g8= 0  `8`D<0 T71P900(0C0 F72l5h6 ,6 RQ@-M U@PЍTT /9@ЍЍ&9 00O--M⠁ Mpō@P`pG p1PP ᶼpH @\AIX0 ^00pt呪0 Oͪ00 T>4 q@Ѝ0,  (,@P * P |0 0 5 30ݍ Ѝ\0D0 6800@800L343 2d4 0   M Ѝ~x1--M  eЍ Ѝ/ -- M0 0 ЍЍ/O-鈒@P p`M X X00?,5*00P @ P 00 00 P! !  D1XPF  *VP WT V[XPVppPpW` B 0`f`0 ឪpP `PED8 0 +6W`!00 ! 1 006, Ѝ̬0XP C0PP00 !, Ѝ 0 5`^pPP V WpP `P00?0 5e0\X2 81 @-@ M+(0S2 )0 `0( `1/qpPp0)  0 0 PUR <0PU+ ЍPPTp 0S  0CP+700Pp+@-P M+(0S: M)0 "p0( p1/qp@`0/  0 0 @ToR <0@To+1`V ЍP@T` 0S  0C@oW7T00h+O700a+p@-PPD (A0S5 @Tp1 Rp00P0 P 0S P0ܫ 0c0(׫ 0P0 ҫ0 Sͫ,P ɫ4P ū8P p@辫HM@0 50Sp 0K0 4eE. - p@-@$PPᗨORp@萨 @- @@ቨLR@胨 p@-,PP| bS@up @-a@P`ME P 10p00S `  0 XR` ` 0@@S6  V8 CR 6!0A0 S0Q^(:ЍV   "Q @^ #R.S(@A a  00C0F0 w4 "^ #RN^^ N0 s0Q@)$, 4  R  *4 8/T  0X\S 040:8 R РS /RexB@-@`P6LpL0ppD尀 T  M  h'* @-P`@ 60 A-鈆pP`@P( T.  r0 SSS8v S00 S 00500000050 3T40 3%0 0  00`50000  = 70Ls0 20-V00 ^V00;\ 40000 0K/l R000C000LS 0100C0 0?V`000 00000 \ \ 00y ,40000  70Ls0 0 h", 3010CP;\ cP3`b0D001~dP0j R SXc\Q l301K00 M \; =\J \7 00C00 LR0e0 D100C07" 0 0  T 00Ls0a" 0W0Cs0Z2 F0nR  \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00Ls0! 0W0Cs0 0 #\ 0 0 00Pi 00L0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP>cP%dP:00Ls000Ls0 0<00sP00n&4* * * ( ( X( & O-`RM@p , [3 X PE 0 0H P@0 `D/PB V0F3 `  [ 0U( 00?7.2[?7.2 0@SS0T 0 0@D0 T0 E0 Ѝ300Ѝ S 300v$ # # 0  00  R, A-R@P0`Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@0081003/0P !p0 $@ u0V0 00 R (P000P3/0P! U  R  SV  0STצP000U />38X+ D=A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@H00810 03/0P !p0 $@ 0V0 00 R (NP00 0P3/0P! U   R  SV  0SEP00 0U D̾ph) `нA-@P| Pi,`Px rpPh  00^c<!"#b!0CaqV8 X p-PXU $001p00S \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(㬤P` p  0000St嵥P0000H0003/P 0D/>3<H=A-@P{ P+`Pw rp Pg  00^c<!#b!b0CaqV8 X p)-PXU $001p00S \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(P` p  000$0SP0 $000D0003/P 0@عH@SR: G-P0`00Sp 3/0Y @IOP  T 00 00 Y @IOP  T P00 D0D 0 p`P/@`,SR; G-P0`00Sp 3/00 Y @IP ӥ T 00 00  Y @IP T P00 D0D 0 p` P$/$D hO-PPM M Q \ /\E ၵP*P:p/\ p P/ `K`\n @ /RR.\)  B R}/0  D0/  I ⹵p c 0: S#  S/ L/o" R/\  @ DQ6 .PQ X0  [K/R_0W0[0娐 !uP-U  3*   RW  q/0/\0#p0 @/R0 X0/ ލ Ѝ @ ލ Ѝ.00B0 X 0/ ?    㗢PH.000 (0>00#0000000?00000A-@P Q P`\P֣p@P ᜴P`V /0"S ᤤ/00@p@-La P`M=  )00QP0=P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P R 800  / 0 @h8P8p@-@PP`2 U( 0Pp:P@ P0P \:V \0@Sp\ \@P :VP:Pp<80 V- 00 O- p$  00/ᠯp@-@PP" U( 0PER R:Q|Q00Q0SP0@|R  :RRp@0@0D -U(P0D -p(  O-ȟ M MDčpĝP$ 0x 0S 0S 0S t4!S S 0K0C04 8 0S:SYD H R0 0  Q!0A00M@04@@0( Ῥ0:S ) 00UePFaE40D P&F0 :SS008$ 0:SS004 0 X 8  L `   @-0 00 $-H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 N@ 00 0 0 30KH Ѝ/@p@-0@@G0PP0p O-@`$MllPX20PX 00 0@`QGP p W   P G d pGpPH0 S": @'$ U10 r 1$4S1!$6t@ 000H$ H0S "<100S (!1 0 0 307 $Ѝ U r pP Р ,P 5SX0(, VT00#    #PH H0Sso,tD D , ˠ@-(@M@@0CPЍ  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A A{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T 2'P0 0# 00Ѝ %'0Ѝ0-$M  00 0崪P$Ѝ0-$M  00 0太P$Ѝ0 -M 00 0 哪Ѝ 㾫 ū0㽫A-$$ rMPPp`, V2 @X0^00pAtA劘0OƘ `p00TAΌ 00`L PP岷0x @h0 0 1 30rߍL0F0 $V0G<0 $4 0   M Ѝ -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/8/C-<< sMPPp`/ V5 @X0^00pAtA 0OF2{ PP0P >TA{ 0 0$00 @2 t0 0 1 30sߍX0G0 F$V<H<0 =$g H(<  0   M ЍO-ϟp/  M # P 0_ We 000!R !X P  P4%X 00S)00 R .> 0 3 30 ߍ`. 0zS  000P0C0 pXP l@0 0 P 0C PSP =0 $#W H0 $#a`0`F p0p0S8@0 lP, 0P0CS0 0000偼0S0p0@0 0 PP0 0C P0 S]P 00 pj0p0SPP 0Se0 0b00S 0p000Sp000e  0 P_P\+PV  PR00SVp!p3`0 S` 0䈯P P` 00 000050p0S 00hʠ@0^T@pp,(0#TIQ 0', 0$ 0 0$`-QU ]QP0 ` Q; @$00!0SVp!p3@`0 0X:P0X00 =P& 0  B00  `#0 p PTPpG@0SW `P 0@0080偼0S P -00SA0p00p0S00 [P 08pG0W]p 8pFWp!> ᔈ m@(0H0p0+0AMS00 [m0H000CS0d000pWH R0XS 00 0 (G 0        0H 0 0(0 B0P0000F SK*N0 `p(@Θ0V'(0 `@C8@ 0p>(00S P V ,$00SHV`@ T@0  R  R=  0 BV0 5 RmP/0pH  R{ @0H  R'  `V B   H 00 0SGP HX A 0p0 0000P00p BH H HQF@T (   (   `pG00P0W0S`J 0000P T0$@p@00Lp0X0 0P00( s P5 0  B0 0    0&p P p/ $p 0S $0 PS0pS`F V = P0 0@00^P ($@X T 0@0 0c0SP [($@  0(v00 Eh00 @V1$  ]R Rt@Pp00@0 0P00r$  ($ n4X y@P0 0P 00p,004@iBP =P 8P 3P .Pd )P 0 $/000C,00W[ 0$@(k ` @vV @ ^(0R0BH0R 4P-@0 `%/V`p ,X@0Vp@H0 PH0 B   H `V  0SP H0 p H00CPR/H04 00 0M0ЍO-MD`PpZ@@Z T6 0US``$ZC 0S@ [= 0 `;/0S) @$lV 0S H[ 0 ;/@PЍt@Ѝ0$lV?%.Hd0Hh[y?/^Z0HJ>s/HQ0$}>[/^G @-$$@M Ѝ@-0P$L`T M 0S 8pW  07/@P Ѝ@ Ѝ ?/H08p 0 00M 0Ѝ@-@`pPxx0p尀 T   0 X῔$  Өԥ 0SO-ğ$M `H0  0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT   ^DQ #2!Q   "  R  R  \00t0!#300@ 00@00 @0`PU*$Ѝ@0 0M  0LP-0 S^^?0@0 0`0  IP 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `\00 00 00Cs0S ``0\  a  `0\  b  `0\  t  `y0\  n  `r0ۑP0U 0 Dr RQ0\  @`b4 qA- Q@Pp`# P=0D?o! D2]R0S =p0$!0@<  14 40 0 V V 0 P0 AX  A-P@p`fP.T T |0! D32 0 A_T %D0$!0@<  1x x0 (0D,TSI6d O-00ȟ SMDȟPP x`pt  ?o2V0S Y W w@0P0  ṏ0P0 [00 p1# 0 S@ PT- U T 0 1 #PP00? PPk@T`P @  TP 0@T0P00HC1S@1@! <`npPD 0 (00S V <0 G0CPap1  * 50_?  Rp1  ' 50>  Rp1 00p1 00p1 00p1 "00p1@\00p100Mp1 L IP@T`|P$> g@MI? ] P( PzS? N 3TPS~0 o0 gYdE? ^H T$ `p@T 0p 9/PK00#3 0 D1 30 Sߍ@@ܐ0`S$O 0S,0  VR U 0004p@p`00 0 (  @ `ɠ8ʌ `pPQ^_A (, ^\*  P2 0*A5)q @. 00 (0<:p ጐaP ~$0~s$@ 20 ,0T 0 0S0"700 0Ptrp{00, 0R 00$00S$0000P04p0S 0SV W``w? j4p00J81 `@`,P(ʏ(0 [PY4*(  $0@0S$0 EQ  ᯏP U@Id 00P0p0dD @  P 0  ̻4 L@-@ M(0|0x000000@  @ 80P @0 0 30 ЍH뼷x@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 ЍĶp@-@QM`P0 0 `sЍp0@-@RMP0 0( P]Ѝ0@-@M 0 00 LЍ-M $=Ѝ-M $(/Ѝ@-@ M00000l0} @ D 80P @0 0 30 Ѝ  @-@ M (0}/ 0 0  @ D <0P @0 0 30 Ѝh 80@-@QMP0 0  }ό Ѝ0, 0@-@RMP0 0( }PЍ0 0p@-@QMP0`0 0$ }ό`Ѝph -M00  }όyЍ -M, }gЍ -8M  $}όUЍ 0-$M  0S$Ѝ yA-`P@PB T% $0S:0@@T (00 E R ( p40S$?@04 $0S%*( p0S$ 004  L @-PP@`Mr ,0PXPI00ڜPX0: S Sc  SЍP P :꼜P 0p`P@0 ``\0@D`.S08H0< 0L R$0L R 8< \P@D V^0 0U D:0]0S \040. SЍyp $p, Ѝ0:0P j @ A-pP`P$ ,0⿉@P \0 00X0 V 0 (0P$00R `⦉@P0\X0@00\ 6p @-`Q@M Dpp.  8<0RP@D0RP 0P0V Ѝᮚpp #pP0@幚@ЍᱛPPЍO-`P4M(w ,00P0(0s S @COo, B0S 0 00P 0 .0 0PP0,0 00C /R 000,00$0 0 pHL00 0 ,P R 0$0 05000Wp00@@ P ,0  0.Sn P ,@P XG0 0, L000 0S5050S 0SK 0S 0E,0\00 00 $0 \ } R0@PS000B 02H00#0Q 000PPS0 0u P 0 0y0P0S , 0$000 0H,0 0\00 05~0S 0.S 00P 0/ 0 00$0T,P0Sr,0B 0 S; Y 0$ U0; (0YS7L0S,00 S." t P&  ,0%<,0@p唊W @,0%<,0p4Ѝ0 00P 000$ 0BUYe (0SY 4ЍO~0@h 0 [5P0500,0 00C /R| 0P00S  \R   B  0SL0S0y \R   B   R00L Ri0)0h rS05l0$0$0UC L0S,00S (0S05S P dQ0$0SV T ` O-`PPp M U0㼈@Px PV(p,P X PUP1QP UfP[R PPPP 0L0[ PP P[!  PP P\03 L, 0  PWU P0pP[WX EvP ,P0%K X ႉ P~U zxv@ ЍPwUP1X0000x0 `Kx0 e \ P*P ,P0%|  p,00,0 P ,0 0  0  p@-PP6 0S %$L R30@T@L0S@T @TP ,0 @p(0p@ L0L0 %@!0`ԗΈV `, A-PP @TP ,0,MQ Q% R ``@T L0S 5S0T 0  BQR@( @D Q\! 5`V `冈V`05,0 $ t P ,0<,0@`V   <,0`cV`P@,0   hP@ 5 0$ 5@T 0   0S00/,0 C /P00 \ @Q20 kX}@L0s ,0 `L0SS 5 ,0(Pv(I,0P0 \p,  /P W@ ` ` r0`00 0@kS 8P0 05 .PX,0 U@10⬖p(8 505I,0 $0S005@?@p(寖0S 姗P -,0 00⅖p( 505ᐇ``0(@勖@ 0%$0 0%$0D  D Uȴ , Pp@-@P T UUp 0 p4"0 00 0  A-PP`G L'p@,0 $5 S: S@T @6T V,0`<,0L0`S00/S , @ xk00 pp@ d00 P   0 0 H 1p@-P@PP 0P0S 0`0e0Sp@(у(΃(̃(Ն0B0 Зp A-10 0PS`@(M @Ppp 00 @0' P% 0 0CS%0  p0 0 0 4 5;1:(Ѝ 0@0<0"0 0(Ѝ0$ 0 00M 0Ѝp@-@PP P PpPp0*0 ꘰ p@-@PP U p@ D0B0 U(C<0 p@ ꈰ h p@-@PP U p@ D0B0 uU(C<0 lp@  O-PMp 0GW"S00`0v@( P-TPg +T@`0@ ǿ 0   0  P p  ! @00Ds \a0DSW0DA0DS"70DUr X : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`00 R0  Ѝ p pᘀ嘐 XR A B0A PR @ 0`P0?0 $UW p psW ꙙX 00 0M0Ѝ6`3@-@0LM`Pp@0 WP LЍ`0 崆LЍC-1 M0M`00<0pPԂt@P U d1 0S ƂP(0  P( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nS.P0S  ۄل%@P!PP(Á(̄CPȐpnfsuniop@-`T@᧓p@  P@P p0P寓Pp`@-@P @$F 0 ( @x @-M @p 0: S  p  JЍ00ЍO--3$@,M00 p@T+P"+R%1``kX00Sw00v e0$0P@P0 U 0 * k@P 0 Hw P@ 0Y >p P@PEz0S7 PUS0  Z*0P` R   U T 0F UAᶁPP @Xi 00D0@0 p$0@,Ѝ0 00 0$00S$0`0十P P 0!Ւ 庒pp  ` @ 10 0w01[  `/00 0 0 S 0S[ ) P ` 0S  [ ᘃP00 $ >PP @ ` ȍ p@-P | @T @vT0 0pp@-@PP U   p@ 80:0  U;<0   /O-pP M@`0& X, @T Pf W P5@1 P1 5* P  8/P  00[W@D:P PU Ѝ8080 j X @0 a \ r< sO-PLMP@< [ TUC <000D $0婀P [ <0S 0pD0U00p000E< 0 0 00 p ;/P ```Y`* 0 ᄀ h @( p RPpp,004PZp ;/P  R ,0WB^P5P1@1*pIp ;/P  R <0 @I 0 @V@ 0Y:V0@  Y: p I0;/P0  <0 0I 00 `& R p0 S <`0 P00 Up `@ppP 000 C Sx 00`  F \0#03\0SU (, 0p4P8`p p ;/ P0 p0RP `pP ;/ PZ V 0W$0 S 0 X 0 H BX 3  S0 0 SQ1: (,0p4P8`0S$*$Q R0B0C0 0Y00|P@pD 0 S, 0Pe 0 <s00 `<0<S! ὁLЍ p@}_4Xh0T $0W0T $n xn p@-PP@" T( Pp ^P 0S S']P p@!]p0p@/80w0t $_Tx0t $Vm m p@-@PP U p@ ^80g0 $BUh0 $9Dm $m 0@-PP@ M T \P Ѝ0{^P 0SX00 _<00 $T 0 $>|l \l p@-PP@! T' 0 0S p\P D^P \P  \P p@\800 $T0 $k xk G-PP@H T  R! R `V" V  0LXqXp$, 0 R R2 0 00 0 `V000 0`V 0.0 F0R#  0 0I0,$w 0\K/ `p 00 00 0000 0Lk %Lj j  @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0 0:0 8i i C- MpPÍ`@PL TB A< [VP8 Y` 0S `!X1 0 3 30Mߍ(#@+ R> R/ ! T Ꮗ p0S % 0p 0 D0 00  T h  RP , R0꒥`FElh h g g O-hIMdğ4M IM,J͍,@@P p`WP W0  $4 I0, 0 30Iݍ4Ѝ0 SJ=00SX30"l ? J-  p y x#J T 0 ?s0 J- 0S EVU0  SU S RMJ= 000:02'0 0d$000H0 40QP @,VU  W3 0S^0S  0S0s S0S RJ= 0 J= 00WWG O<  EUP[ r0SF ig03?Q #< p0<0J8 0UJ= 000$ X\0Pq HJ- 0SJ=  0tS SyJ͍ 0 *&$ 00SdLP P P J= 00W0  TPJ͍ ^P m8DCtf 8f e O-,,ğ M@pQ `@#0 0CPS0 #3 0 0 30Ѝ#3 0 0 300 HD@pЍOWX`` 0? s0 pPT0S0SI ? /r "s0 D̅PT8VT00QWX00 R0SY 0Sf S4YP00SP"0 T ⠅T@@O 00QWX00VT<!  0T ᄅ SX: pYp  0PȠpY 0@D    aT00? ,!0  TpiT 1i #Y:pܐP 0PȐp   8P030#?pW 0@D D(P^T[pEL   xY?\b P?$?a da ` H` _ _ 0_ ^ G-p 0 FM& P@`Mp P  RW  3P Wr`ov` 0@Sp0 0 0 1 302Fߍ000 00?1 00  0bP Z /r RX 0S vP 0 ڢH;x:A-@P`p 0 | 0P p@-MP`VP@@P@T 0S  R0S Pr@PЍpPjPЍpp@-@P npPpPqp0@0 Q[ 0S/. AA0Cq.S .R Q P-S Q P_S /@-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M."@0' P  0R0 0S  R la  haR 0Sd .P 00 Ѝp  0S S0S,  R R R  R/@-D/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP0 P%D@0S0S 0S  Ѝ00n0 V @-pQM @Q`P Q Ѝ0SSp P*pV0S# S!  0`S Ѝ Ѝ00S SD<0 ?P 00@6U U p@-@PP` U V 0pPp``D0P UDD`0P V((l0P }(U U T O-ŸM2 H 1 #C 01p $0p8 ` P0 0 000000 8 P [0 0$104030.؍<Ѝ  0?sQ , s0,0 0(0PU,(Q Z Z ZZ ``x0 eZ00Z00Z000XT @.R  @-00AM M@P čP`p1 U P P0 ∁ P,@  0 0 4 30#AލЍD0SP 0@ .Rd P @ bHHx0 o~Z00ꔟ-hQ $-P P @-t!t1 0$M0000S`@ S2  0 V& p,0< S:* @\ 0S PU S  S0S \Rp`Vp h0 0 0 30$Ѝ0@ 0 100 00 ,H,<+G-@P`p W"  ojPP   @ @ !<<D0 W 0 `C @80 0XP00  03/P 0@&<00&,SS00 40R0ST X@`$`w R? p:00(,P Tp*0 C 0XPPf00  03/P] P3Y@0Y-Y[` M40S?&<00S !T? Y YY`5`z_0D0 ZX@P200   P@) Sh`P% $'0 D0R4  4 Sw[ 4Sr 000`0 T &<00Sc 0D'TS@pW0(pY,PD Zu H0H0P08p`h@ 0 gjZ3 { 0{{ % %  0E {000000JP qP0qP R R 0   pR 3jZWy 80LE0S5 X00X00 30 0&<00S3@/}P@V 0 8(5$%0 5s (0SP #0S iUX00@ $0R TA TThT @|P@V_(0S <0`PC80D\K Y<0 C,0PB 0P,0(00(070@XOt00S000e@01z_0 0 JW@P"00  03/P Y 00`S @@80PRCPG.@&<00@$0@%/k)))4*xF PE (E E D $$0,$0SDDC?,0SddD0,80PRCPG.@%@0/kP.U0@ DVPp0000S 0R $ R[ $R 0`|O-@ğ SMDP0f`P fpP $0  08X0`00pS0  PO 000 UPK @@PX 0  DPhh@|#t3 0 D1 30SߍY 00W00 Q0 0 .Q0Q RS% d! St*+ 0 Phh @S Rd! Sf*.[ 0 P< D Pdo 0 DDQ0000 0000 Pxʜ0=S V0S# S S Q 0 Pc0s70SQ0S V000000  Q000S0000 P=rV00 0 P3hV0.[0 0 0sx ]V00tx0/BI0 PKV000 DDQ@V00WWg9V00T ? O-`@VpPM 3 0 S_ )`PL 0(H0L0P0T0X0\0`0(000 00000HSC S$ S0 0% 0#(,pLp0  0Phh0000 0000 d1S Ѝ 0,p#ᄀ=넀XU00UP P P 0,p#pP h08 H0^  D X0 S㮟7 $10T0  0P  0 p P0{0(,0(0  {&0P&gZ 0 Sd1SdXN  00S !P=  = O-Ÿ @00@$0` pY i:92 I520Y0 0 S   S  R  R Q\  ^ \/oQ" S R0S  0PQ ,0 0S Q0S %0P 0 P>  0 B   (KP(FY 0( P p0`8P<p`P,@4Y 0S@TJ 0S] 0S S 00S Pi(0 0v;a RDP RA R>0S0S ;0S'\ ,;3< P 0 0PU `V  :00\ Q  P U V  R R  p Y ` P 0S   0?S C" 0c6#PY > ^h \S㔐Q^ @ pTp0S 0`@ p$p T d:42 D52H 0SE0 S > S PR  PL 0@P0 0`P`&0(0 e?0 @?/YP\(0@ S0 `P@T $PP@P (0$0e0PpU 0@Yᠰ @|Ht대`pPUp`K|`0B l`t 0 4 0(TP`ph !rP YqPK0K D Dp,0xrP`KA,:H|,20[ Sh S0 \`( d@p1 81 \0 / D, f+ x* |Ii R` 003 Q  R0R`U`7 qq$@0Pp0 00 a"0S0$0aH@P P0U 0PaP0U a0`$p(,P  Kb_.> f⓾ h-rP1x00x0 ar.`@H`0V00L0`aP]`O-PTMb Zi @` 1q0=>p0=~  PP` 0PE `0S S S T@P `0S 0 0 0 0=P0 0 U  Y [ 00  [ YU,@TЍTDD?/~Z((D0/uL& D& $ k $ l G-XMp@P `P@ 00  0 P 40S0. XЍ UP ` 0 P `8 8<3P 4PP)O 0 ,$ # O-ŸM2M 0`Q<000 Z 0Sq p@ lr < p A.=~ *X8PPh 0#S( 0P$  =0P  @ PRP R R UPP sP4 @ R0 @PsP $K(0K$ K$ 5P0(X PPU 00   P 0@PvP0 x0 0< 0 30ݍЍTTD0/ji<<x0/b_ꌓ" "   t  0A-(M@ p`pPQv .P @PP $0S0(Ѝ @-@ ^P t0  @0O-Ÿ 0 M* `@p1Mp! P 8PX  1PPQ 'P Q+p!1 0 2 30`ߍ0@SPX 0@SZp00 0P 00 0 J P ZY0 Y  0aP 0 Y:[ 0 0 X  R  XR DP 0 wꨒHhA-pP`P@ 0 I 0P 00 $Z" -0AL. R@O-0LMp  D@00`P840 <0T8 0 0'00# 0(<  .  " |b*. ,`Hǂ@# @!P(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 08 884  0$00 ꉫ#EgܺvT2 G-PPp`4 W* 0!ᣑ000? 0"@@i>V0: B0iS@I"p ` *90V@@p`F Gy4\0P n00P g   p@- ! 1 0MPP0 00@( T/ `  !? 7R8 bx b   x0 0 0 30X Ѝp@Lh0t (T,00t  JX   C-0"02 0 M0002"00 @00$ p P`0R   0XS 00 Q !. 0N `!P1 0 0 30 ЍQ  Aa 0s00C 80BS.R ^U* 00RP 0ES0 S S^*0W >y000@^0 8< 4^*0 8<(H- MgP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0DS4<  A- rM`PpP: U@ @X0^00pAtAW0OW$1 000TAΌ L_XP2  0 vpP# 0@YP 0 0 1 30rߍx0<0 U\=@0 P xZ00 0P0PB`x X 0   M Ѝ -- M0 0 ЍЍ/--0 M0( 0 oЍ Ѝ/4p@- MP@C0x x` 0 l0  `@P@X@0@T  Ѝpx @-HH1 0M` !000Cjp @P   ajp h@ 0 0 0 30'ЍhPpW @@T PU 0STP@\TW00@:Ti 0p@-P0@ 0 p0Y(0PY(P,PYt` 0`0PP 0P 00 0poP 00 0ppD 0@-@ 0 0 0 0 0 ; 0 00@- 0 MP @0gY 00P 0  @?o20c Ѝ01 00 0p@-@P 0U0 0pp@-@P>Y0PP:Y(0P7Y(P,PpO-p0Pl `,FPd 0@00 S S0 S S x04PR 000PpUp 7 0P, @P! 0P0,0S S S@ 0AS A@PQ% 0 PS0Q0000WP  WPP0@@PPP  G-@ 0`pM,0(Sy: (T] TppU 00SQ 0 RK@D@T0PF   RB 0@D@D0P0S+ T0V  0 1  @D@TPH 00S#0A S0偠0  Ɋ0S000  ⸊0S% 0p@@X0pp1 0 00LЍ 00!00 0 0@-S@ 3/@Tp@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$EA! BB  D B &"AA!@@  B B!"AA!@@ pQ Q@#`  P`PE@F$NN. B B&"@D@D"F$NN. B B""@D@DA$NNU. B L B \'"\  \ \ , ($P@\ \0 \, \. P@^ ^ N@N P@\ \ \ \D@u4P@d\XTLHy7h p @-@P @ I0/0  p@-1!00 P@0 00D@1011.T 0@\0 S@ P pp0  00C1000L  00t@< ʚ;P 0  0@-lPP B1!1 M@@D0 $2 AD ( @h  Ѝ0 Q@-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2S p 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`it O-``!P@@R@@hǟ IMMčLǟT ด`D407>P0P@0 0 4p 0A&6 0x PT < 0P00U0<06080H060`0X06 0` 8 x@,0, 04P<0, R00S D0`1  P0 R 0 0 0R P Th00S2x0S䕟 458 0/Hp岀0p 0W9 X%U80 P?Ⱀ-?2crlqqHT01NਂhL΅Re`\ X0PP QNDv~ @r~  00pp@ pp_p  /=_Pc$ЍL C-@P@P p` MO0P?͍0,0= 0080=͍p000\ @P48@LpHDp 0 `PW )0@S2 P_P0⯭<0H0 0 0Ep 0(00H=`0= <<0Y@PV *0,. 0> 0;/0H=0`F$`` 0m x`d0 Z 0  p ( 0$p Y3 Y@ H= I0R#  P0⯭<0H0 0 0p  R 0S .S 0S 0S00S.S=L@0@=00Sༀ@tL 0@d/ @@SZ 0 p 0 D;S0f*2墏$0#8(08$0( 000@ C0 `CBZ 00P<0p0dd +ZU@ 80 pU Z8@P@0 Z}pI 0 0@pA 8;0 02,0#80B; B00a0.0 .0 V0$ V@ A80 Pp <0 0S 0D;:04H+B 0?R0S d d?/00<*: 0  0 30  ݍЍP0⯭<0H00 0 p@  0.p(ꠉ฀> P0⯭<0H0 0 0p0< 0@08 BP0H4 0R0IY0S ?/=00S2(@ 0dR/ pD{^YP 0 p < 0@8 BUPH=00S{20<pd^/D{ 6Y 0 pd =00`C 7? @P T T㐀 Pp` 0U0 0 FzpF 00e0T0PEo  0 lp7<0P@p8`@C 0PP( 0 Sp 0  P`=00S2@`20@DKx0df/ `X 0 'p 0P*=00CF@@LFd@R_ 0 X 0 p  0D;d 0 X 0 p 1 0d X 0 p `0pVD{ -8P8 zO d0 tX 0  p 0SD[ =8803Y t 0p p 0DK`VD @0TF1!PDQp  ` 0  PPr DD0p@D{ 0pe =00YU  0 PX=00@C+Y =00SCD`@R_d 0 Xp 0 mp9  d0 W 0 ap- 0PU0D[q* p`zOUD[h  d0 W 0  GpD@ Pe @0TDKV:UP 0 fP=+L0T 10"3d" 01;L0==1;L020 201;L000301;L0<=1;L0L10 1;L 0  p 0D 0 S @10k`V! P  @$`U 0S @` 0V4 b 0d lW 0 p @T +A0T 10"3  01;A0==1;A020 1;A0;괓 P  p  YD  . D * x   x , L x 8 ====== D  VUUU  $  ̵ H P T d t  =+L0T 10"3  01;L0==1;L020 201;L0L00 1 ;L>L CC+A0T !1 0014!;A>A C@1;3@ r 0 +p@ 0 < @8 BP0Dk 0PCU.ȁ@pQk@T# 1 W2  0d V 0 p=00S#/@/P/p"PP0p@ 2U/D{xV` 0 p < @0@8 BoPH=00S/@/S0p@P2S/D{DpNV` 0 p{  @ ` 0Pr Pp 0 DpD{pf 0 P_ 0D0D;P 0pS 0 0PL $0D; 0tp@ < 0@8 B P66/@3/ 0D  0 p6 0 Bcp/ 3-pP 0 DVp" =H{` 0o PPV *0,, 0< 09/=`F``pH{ 00 Qp } 0p E%p , P 0 D p =H`  02 PPV *0,- 0 08/=`F``H00 p ~ 0p p ,P 0 Dp =H`  0PPV *0,. 0 08/p`F=P`H0 0p n 0` Kpy },@DK@ 0 pm =H{P 0@PcU *0,/ 0 08/=PEP_`P0 0pNH{ypE 0 p= 0 OjpT5=00S /0 S00 =00S ?d0RO 0 RP 0 Fp `0 dD; 0R 0 7p  d0 R 0 +p > @0DKR  .d $0w/ R 0 p'`< 0@8` BPd^ 0P p pDK+ 0@++d0v/ R 0 p H 0 PM=@0@=00S  d0]/ aR 0 p PUpDD7 1R@0`` $0@@@@[=0Hp 0 Pl W` *, <0@@ 04/D0$ pG0- p UD0HD; 0D S\ @ 0 upA 0~- <!?C0 S 0 o_pt*=00SK 0D @C@=00S 0 < @8 BP 0DK 0SQ`+C1#00 SrD 0 o+p@0Hk=P0 0W P U@ *0,* 0: 08/0-`PE@ HkDKP 0 p0Hk=P0 0& P SU@ *0,) 0: 08/0-`PE@ HkDKPI=@0@9Y =00S.I=@0@=0@lI 0D @C@TI 0D @C@$P 0PU0D[:=0{` GpPWW @P` 0U0 0 FpN 00e0W0PE 0 tp?dh0`d/ Q 0 ep1 X $PzoXDK  d0 P 0  Np` @PT.TU wppP` 0U0 0 F0p 00e0T0PEV 0 "p0H=P0 0NP {U@ *60 ,P x 5/0H=P0 0/P \U@*h60 0 p@ 0 p 0CF@@$F 0@ p  0DP uPP 0 p E0@ `@pT 0 Np "0 db/ O 0   p 0 p @RWT@ 0 p LT 2@$` 0`@T0DK: 0@ C` nPP@U3U qpp@` 0T0 0 Fps 00d0U0@D 0 pd 0 p] p_TUp 0p |pH pD@OmȀ=0@帀 <    VUUU< l  t X h d 4   *h | ԟ x P +E T0T! ##,00 !+E T--!+E TT" !" !+E TT  # !+E T,-!+E TT! " !+E T 01 ;E 0p `VDK@H@- R  MAP  ,@0@(@@; Ĝ0P Ѝx MM$000 1 2Ѝ/t A-PS`+p@ @W0 V :0?s00@PU &P`(0@0T0T0@DT0S$0l0 (LP@Ȟ G-0PU!/:@0`?T0(p0 ?0 0@T0T?00S X0T0 "$ P0@(00A-QMxp$0PS@` 0! $, (0v(`Vg0Sc(0S0! , $P, (0V-ʀ100?&PT, 0 ^,0O /  , U/ ,T(0P0T(0 S0P$00Q (0, Ѝ 0F7P&, (` , \ :0,0?0s0\, :$( ,00(0 SPU$P 0"00(00A-QM|`$0PS@p 0! $, (0w(pWk0Sg(0S0! , $P, (0W0<0000)PV, 0\,0Q U/r ! , /r !,(0 Q0QQ(0 S0P$00Q (0, Ѝ 0GP', (p , Q!:0 ,0?s010Q, :!( ,00(0 SPU$P 0"00(00G-PP@`pe V[ Th HH0H 4H 8<T0YY200 Y,2 < "Ì!? P P@D0  PT T00  #2<0 W 0"!:T@  H 0 = H0H 00 =00P*0PP00 h80 L00 TW P@ꌙ H (  O-RPP@p Tv 0S7 t" `lRPHP [B T Wa@ Z 0 00@=ZB ᔲPM [ [T WE 0@0 0Z 0[9Y^ T W0 0@ 1 0Yp 7:P$T W 0@ 2 0Yp 7:P[0% [ S 0S 00@ 80 00 wT W 0S S0S @=S0,,0 ͿXp ZP 00/|X00P @/4/,/ //ጕ t d X H @-`MP@lTp@X ( L0 < 0,wLY8 $$U  A-lQ`PP@pO TE 00S>00XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQs 00000  0C Q700C20@?D0 $0>0 T  ` A-Pp@GU`, T @ W0``W0 .pPEVp P7000 2000 S70Q00 V00gD0T վ0x\ /[o/ͿZ///\@-` @0 0DM p0<00 02J0 RP400000C0< 00 0 <0 30DЍhQ     0SPtЍ P EXH  0 p 000Dm0T00XS<@ 00DA Bs QR ap >` S0T1 W  0pt pp 0@`> p PPD1?0 0p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pg0p 0> 0W 0@ p p0@ p 4333333b 00 0M0ЍD | 0 Q?0S @-[-- Mo ЍЍ/G-PP`P VV 00 !PER !U6@  PG0 ]PU pWW@`u@-@P ڦ 0`00@٦060 ⻰^ - M ? Ѝp@-PP@ T 0 0 00 p8080 ✰T D0 ⓰x^ MX^ NA-pP@`& T- V4 0S 0S 0P Q0 00 R` FQ`00`6P0\ [T@@p0\ RV$$|0\ Ix] T] a0] bO-ß OM4`dPP `p@dh V Vt Z.` lP 30 00 [ .Q Q\.Q _ :!J!PX [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V ) P00 0 ` `冫0 0C SA: Ű0  `0  (+00峱/00H!81 0 41 30EOߍ:[ 000$0( @,V0 0 0 `0P P00 ZZ00倱000 vE<4 ⫾PPK U.R}  :ᮡP qY PZ `Y BO-`PM@  0X0 X0_( 0#P? % 000 00 P @ p P 0 "00zP > R  R 0 @`V  pWI1:pG`W:\pG`S C0  ` Z`pGA R % 0 0 00@ߍ R R0 S S  ⦜ P} ` Q PD P@ !T: p$ P@D X0P@- #[0i0 fZ  ᧯[` pG Ka  ᚯ pG  Va HXV P 0$P 䠊` `p R R R RR T * 9P  RPB(3$P@D PT p@`V0  八P% T ::`P tP !T014@1:q0 .0 0$@ 0 @ 0 @0`pP`$, 0@ 0@ 0  PP P 0 `@X \W U T ^@-pp10LMpP0D00@I LP0`S. @.0 gP) V) QPP0 0卩 0  -CP 0 u$  0 0 0 D0 30LЍBPpPPP O@ V$T88C?F/ ☭WTS  R lR C-`P@M: pPU, Y @@NO004 0 BP0 $  0 Ѝ|@@JO @ $T ЍBP P$$C?R/ FQ Q $Q O-ʟ UMMLōpZ|ŝPPpxe刕( 0 (0S 0 S00 :0 0(!0P,0 0p P?s0WS#@``O ,#0)09 0 L5 30VUލЍ5 00SP0  03/P PW: 0B?o2\0R0S<0e ᘨP0``P`0,t欠\ 00 H05 00 0T0R?@0 0 pDL48X U^*``0 C 0 @PS0  03/PK @ Z'P U$0P0S5<0S0 S  R0L6P0$ 0S!0S H0S0`+`$ 0`V`*X0L0Q*@ `H0``0L@H0X48HQ 0, d0L P0U\ Q  RO ZO[ p P p H `BP0 0 0PX ! R soQ \ V Spp0XP 50 0W  H0S B@Gq 0SPSPڰP^!P"@Tp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @۬"L0 C0 0CS`: ͬ0S?0 @0 @Pe0 w $0S?@oY 00@TW @@0P`@(`L S  C'SRF0@t0`p0%P `a$2V?Z/ ⃫(0SX]?Z/ yP(0P04D0,0b?R0 0  PP0 ; $0ST D0,1Q<*,0`0P @ `@ 0` CR00V048,0@@PPp0`P@ CR00T@hP`@: 03/P `2,0D(@C 0T0 0Pw  , D00D0D!  0(4PI0  WPP0 F $0S|H0S0` T D0,1Q=*,0`,0ᝦ0SL@P`} 0% #y p  0 Nύ00N@1sKi 0`@0P``,0^0%P #V5PT T,0D(@C 0T0w 0P , D04    @J J I XG F A-@PPMD 0 S`04 S/0p 0PP? P: 80 0P"P"  0 !0P!ᇬU 00S S Ѝ0p sЍ00C?. > 0 E O-3BM0MPP040@ 0 00S00 S  0 "2 0 4 30BލЍ @pA~ `⍟ p0v#" 0 G5P@T*X "2P0!  /5B@PH `PC 8 0 0@ԷPH` 0 00 00000 00@s T> 0 p pIP Ც00S 0  0pW-   0 ƫ 0 {G 0 tC?/ ≩_9 ᯫ 0 dᨫ 00S S[ YឫS 4 D C 0B G-M0`pw@P0P0 V 0   0 p PvЍ 0 PP 0/ 8@ A-M`pPE@P , 0 (   P0@IЍ0, 0ЍA-@P MPp@`P UX&0S8 0S0S8 P(1(!0800<0  P00? p` P 00 ЍU U* ު/ 0 0 Ѝ0S Ӫ 0 00S000s S 04 P @,,?/ ⵨0 ? > O-<<ğ DM<h@P 0 (PP `sppE0 `P XP 0,0 P0ß RR RR 0 R R $0 S S 4 2@P  0p 00S S S@ 1U g*@ @P 0S0 0 0R 0@B PE @ Y8:I S@@3 $. @ I@ޣ Y#:   U@Iq E1P@GP `p   I  U>pἣ` V `p 0  0`!L1 0 <0 30GDЍ(PPE pP *P@ P0 0 0 0 0Jp `pP0 00nl 0 `0 000妩00pQp`| P> = p= p@-M`@P ),0,0   0kЍp@-M@ $$ 9 ЍXh@-MP`w @{pP0P0 ɠ@0@ 0   @0PzЍ0@-P MP@T 0t  P00 000J P 9 @ Ѝ0@T8 00lC-a@P`PMT UZ !0 `   p 0S  >  0C ^0 .SDW 0  @Ѝ0 XR   9S '@ pG W0 QU 4 8<03?0T0m0 ⿦U8n<0 ⶦ @S L 9 |9 O-ß3 0,MPQ0$00@` RM Pg PU0@:T000 0j Tl 0#P P` `@0H ƘP [ `VV @ ZpW` @$pTH氐0S T0D@ S0 s\b 0 rJp<0p GT TQ B/00!1 0 $0 30i ,Ѝ!1 0 $0 30],ЍO@:TP \p cP :Z:V0 0S 0$ S氐`PqIp0p V T T0| WU0| <0| H0S g@$pr @.T`@$pTPdOTqx 8 7 6 06 @- 1 0,M@P0$00P`' U- 0p0H 00000001P* ڒ 0 0 $0 30,Ѝ萧 0 L0h0 ⅥU0i<0 |O 5 < <5 5 O-HHş tMQl@p 0 R P P* ^/ 0 $4 0 l0 300tЍTIP`<0T GTu T 0S0` ;x<0` 4 0$40(,04801@ R@0`S U P Q 0S0@S Pu0Su00 Y0S @\T<0000j:000@T `0> Zg 0Sg* 0CR00`:t"2 0 l0 30 tЍOP@PUF*0: T00S DX"H 0l 0[P3@T` 0Z00S RZ  @T0`zu YPr S 0 S P0@n Pa0SC:q 0 Y Y Y@,!0Q 0  HP x8 @R0PHP`0T HW Tt T0` =uC0< P@0 j0~ : L0@

0[' + ភP#p 0;/qp 00P @ P ~00 0 00 ֙Ѝp p*P 0 Q+ L WY pp 0*P 00 0 SM  00 0;/qp 00PPßQ <PU;:0 {p0 ;/qpP0 r 00 0PUßR <0PUß`X0p\ Ri00dX0P\NS  00Q[ <P800CPU0&Z   "  RNPL0i?  P;/qp@ 0P000P @ P 00 0 PZ 00 _P)0S&: I y ?J0C0;PPT 0S  0CPß01G0 APU0 Z 0CJ P&JPP @0P }0000 00٘P0 ⹢0̘겤 0 Ę480 ⤢0 0+ * ,* O-P,MPp@P` T 000S000Z00变$0 0PP`W0 00@P $ 0R00SQR+X` P  80P 0_0  VP`Pg [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pd z 'P 0S   00S S0S S ^ S@@T000S00ri0\#00& ^@ [ @@ S@ U80h0 ◡0媗C0D`& p@-@PP` U 00F Gi p 00pt060 sUX7<0 j0 0@pa0TS]00 & %  -M0 3/Ѝ/0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04P0  00 % $ 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04h0\ 00\ 4$ $ p@-@PP U 0S S S 0p@0/p0p@0/p40t ⻠00t ⴠ|# \# p@-@PP U 0S S S 0p@0/p0p@0/p40 ⍠00 ↠" " 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 V00 O! ! 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 00 ! & %0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0440 00 ݟ F E0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044>,⫟0Y0,⤟< e 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044K?G/s0a0G/l\ < 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ04iS?O/;00O/4| \ 0@-PP@ M T 00P00 Ѝ08080.T q[?.  0@-PP@ M T 00P00 Ѝ08080^/T [?^/X 8 0@-@PP M, U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ044>a/ⴞ00a/⭞` @ 0@-@PP M( U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ044j?g/{00g/t| \ A-PP`@7 T- V: 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0t A0/Co<0<0m/-(#[?m/% @ *$ A-PPp@`M2 W8 T& P R P P P @ЍPX 00@R X ЍA|&w?q/00q/ߝW>q/֝ PP` Y0@SPv$q{v(  ^ _| p@-@PP U  ;p@8080,⣝U ?,⚝  A-PPp@`, X2 W9 T P  R 0 R 0\A/V 0A/|| =/bd0d0/[XLL?/RW0?/I    0A-@PMP` 0J U@ 0pS S  P R`V V V ЍW ט 0SP00Ѝ W` 0SPVll>%.T0/0%. bPp %{L ,  p@-@PP U p@@ <0<0/ĜU$ >/⻜(# ?| 0@-@PP M0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ08080/zU ?/qt WT 0@-@PP M0 U6 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ08080/1U ?/(P {0 p@-@PP U p@cD00/U((?/ p@P  p@-@PP U p@D0D0/U,,?/p@y\ < p@-@PP U p@"D00/ӛU((?/ʛp@  p@-@PP U p@KD0D0/ⳛU,,?/⪛p@8X 8 @-M@P0.S00Ѝ!@-M@Rp  B0?R0S Ѝ 00 0{0CЍ` 0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 / H0 00/d 4p/0/ 40/0/O-p MR @ܳ Q5 0S Z0.000\* @\/  Z%@QAR0S<hsJp 0&PPX`VpX V}H 0z&P`FP(00@ ЍAS0S010! 0 Z@Q \p!SŸ" Cr <"I  Z 0@P& 0;S@S \S ! C]R6 Z"R#!! Cr  P "!!1Cs0#‹1 0 0@ RqQ^ T*000Q0@DT0St$0@ P!Z0@_SpV pV)!0  H%P|PXyUw @R90S`` p0 `f  H6 %P_PX[ p0 `f6"2d H %PLכ00K Q@1.0304:B T QP 4 O-@pğp$M W0P Hd``XV @ppW \W* .W 0E0CH XF0 R S.R? pWP 0E0C 5 X3S0 X ń- PEU*0S0P(pW [W$ ᾋP @Qq ᳋P @Qp ᨋP @pWX(00$Ѝ] ᙋPX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00   0]R' @R " XWQQ   Y I b"r RyA  PRA .R pW@Ne@@00Q    Y t " ^  @WX  P0R XW(@Qp59:fX0  0…1^S X ńY PEUV0SPUWXԽ H 0G-LA Q@I*`0S$ R@ @RpP00- 0Y70  Ԡ 000 P00`S`00@NT00X0Spp$0]/P]AS 0SPQP!00P0YN(0@0@  @ RO-P3P#RP3 M0U 0p`\ @U @RF R R2 %(00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[V[ a?.P  Y*@T*0P 0A\ R!ɑ" 40S04 0 - M ЍO-pSP$M Y p 0 pS 0S0^@w @^` \rS0  H Y B `@p p@TW @0S @S] pZM ᇘTP @`T00 S Sn*p 0A>Sc B P_^p0Q ^ QC _(00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 003(00@$ЍATw0S"@@A@pZ "@0Ġ?  0^q0A>Sp0pS000^ 0AA^ AN[ ^& SQ0SP5 Zp? 0.$ @C /Q Rv?}/P͖Ƙ00@G0?Q0Shv?}/Pⴖ Vw*p/Y P LP m?.P⡖B P p@- M P0 `00Gp @ !p < 40 0 1 30ލp@@< ذ A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލw@넰 ( Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ (000 R!  Q 0 ARL ?R@- RQ0A  RL ?R00C(00/C/A-@P`TP% UVT P @TP 0?Sp 00蹗(00QSp@-`@P ܍P@`VP  0R p/pA-PAUQ?UU@A`pp W ڀ1APv(00q00m?00Q @-A?SSRB 0@S AR00M(00/-- M ЍЍ/@-M@ p TЍR/0S0 \ R 0S0000/O-P MPp 0EU"S} `@׏P-TR +T} Y m?p ]`00D" [*SP# K@00Ds P a0Ds0SW0DA0Ds0S70DS| Y[SP;+꽖긖0S \0J0 ЍY@0Te UGp Pa 0A0C0B QSlUPP\`?pa00Dꇖ0 0R0   ЍY @~0T+ U# Pp0a00D~0T00XS"@ 00DAAs PQ0Pp>cj p>cP0?0 OBPp>c00DZ00XS UPpb 0N00XS UpbPPp>c 0?U0@PP0@ p>cP433  00 0M0ЍL O-@SM \ YX` 0pS000!R !01 PP E`#3`7P*Q30A 0#1#2#4#8  P 6   ٔ U 0C  pSPP0 0@pQ 0S  Ѝ踕T 0 @0000@0 ⫓꩕ 0 0 A-@`Pp㨉0 0@㨉$0$ 0 M Ѝ Pp@-0 000St@@@pdddPP@P@P 0000 0Ȥ pOdp@-P@Q p@G-@`P&tpt0plp 2 T  l50 ⤅   G X  A-pP@`  F T{000@P p@-@P5Ppp@O- 0@@00]N Qx00p@@ЍTЍ0<0 0 P0 `|BލЍAP (@@P  4/P Q Q 0 00 00P $0 0  @ P 0S 3/ H000P <( X \ L0L0@-@PP$M U! 0 P% 0 0   0P $Ѝ0XX<0H X⨑U<<|0H X⟑@\ ~ O-@PU  RM `100Xqp0S@ @@@ P ఀ $)A0PS,00a000S 000  000 000 000 OI@00044<0 X3 ` X L X D A-pP8  0S@P$ 0 @S 0`PP0S PU @P @U000 =y 0P@@ P ((<0B/XT O-(ğlMR  0 S X 3`000Sa# 0S00 #3  04 4 0P YP|3|s|0@p 0V^ p p @QS  QN `P0 Sh @p $ 3/0  0PY@r@RP00SS" 00C0T@lЍxB0@@@ d20\ 000SN  R0200(   @(,0 @p 0TTP 0S 0 @00D00@00qP 0 S PW @@(0XS,  , @0 R1 1S@X 1 0(   @(,06&>I/X0S XQ?I/X@lЍE?I/X܏@^(  (,0{@ pPGh`,FE@EDTDD  b aC-LLŸ DMpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W@!1 0 0 30^ЍU00ì?dPER ?\00S T?*N>?#c!!"N .  "bQl.5:bQX. 1d.#c!!2N 0  ]0@ S 0!Yw0`0S00p S `l0 @ pE``0 S00C  B2=0Q/,0A!b0dP  @HYF0`0S00? S 0  B2<0Q/,0A!b0dP  @'Y%0`0S00 S0 p@`; 0Q,00dP  @Y0`0S00 S0 p@`H; 0Q,00dP  @Y0`0S00 S[0Q#/ b !S : 0,00dP @Y0`0S00 S;p: 0Q,00dP  @Y0`0S00 Y" 0 p @e``p0 |@`u9 0Q,00 dP  @gYe0`0S00^ S()Q1?0c01Q 009 00dP @0@GYE0`0S00> S8 Q00dP  @0@.Y,0`0S00% Sd8 Q00 dP  T0@Y0`0S00 SU3PU/P7 Q00dP  @0@Y0`0S00 Sx7 0Q,00dP  @Y0`0S00 S_0 <008@0 0@D00dPH00L0080 0X0&  Y0 `0S00 S8 0@90@ S0 Ř Y0`0S00 S!Y@0&  `0S00 S00(&@1?2c 1 R11Aãd0Sâ/c1S0c05dP0 0\YZ0`0S00S S 08  @8  p&80 S0R`05;4 0dP  0@0Y.0`0S00' S0 p@`0dPS00D4 0 0@ Y0`0S00 SY@0#  `0S00 S0 p@` 0@S 8 @ $qp  pqp 0@Sn R-Q Ry0c"Q312"0"b0A Yh0 ^ YP ` R  dP Y0`0S00 Y0 p|@W`r0@S 1Yj I` R  a S`]UPs 0@SUU P 0P  Y   R ` R  @P=0`p p@y`20@ S 1h Y)0`0S00" Y<  t lP)\(\ ףm P L  *| L ` t  d  d  d 0 8  t n T D 4 $IQX  T 0@S 1 Y0`0S00 Yj 8  0@ P  0$ (P, VR\ gR 0` p`! 810 0A! ~0L,, ?A1c$ (P0T?"dN2c 1 11N @0?2cQ  111@/ d0 S  á/c1S0c01dP0 0pYn0`0S00g S082Q0,00dP YYW0`0S00P S ` `o 0P i4 d76C-MP@`,p<0@000 08 @pT `ppFЍ"00Ѝ@-$$@M Ѝ~ O- M`p@Pm뀠P 0 X0X 0 0p0 @d Ѝً@ Ѝ~ O- M`p@P>|P 0 T000p 0~@6 Ѝ請@ Ѝ} @-0N~ \0N~@ T \ڒT00\艋00p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-10#Lc\3j*0Sn SW @Q BW@122e3cPBz :E.€Q_uk9"mnףp= ף Sc$IųQ\(\ h Q(\)\˜  c 00 (: 600+$0+>! 0(a`  o`!!!0C0Xÿ0+" ?00 #2>`T[ c 0Ђ (: 600+$0+>! 0!Â!!!0C0(AX Oÿ@1+" ?00 #2>[?W'`FPGp1#1 :#0! a,V"! / 25:$" 0"4#2><"Q0 3 #L201d0U\`25? B4sppp0/S[0 is c 0f"(: 600+$0+.2(a1110BX2 o;#0(``T[`o@t c 0>0#$: 600*$0*.P3$1110B@Tl3 I:#$B0Nt3`0 `cR`@ V0#T Ba!kYC(1 ? c 000$$(: 600)$0!)>P$ 0Â!!!0C0p$Xxß)" ?00 #2>r/E B 2?A1c1c0R@ 0B 05P!@ 502c(%2c2A@" "b1C S/  0@ p0\X%X:#包  00u!ό#1 W?0}:5$  *4Ϡ! 5*111A T 1#0 0! C2 ! 02">"@T0@000|&  0@00U``PE0S0@P P$ 0Ѝ& t)1?c 0 0H0 '):60 0($0,'(>!!!0CD'0YL("1 #2>L<0`0@<' 0 @<0`0@ꊇT 0 O-`@PM 0S*  U 0%? [P>psŸ !" 0<0  0 S 0 P00_T00<0 S" 01P0 U 0< UPŀp1 !"3p ~0U 0  R!yh&0P l6m&NSp@0GSH0P0 0Z0b 0S0ƒ!100 0[;hhPx@2[ O\1X00 1@T$ <T=0 S0S >S@ <S*S0S -S0 C Rp@0G100H 0 b9@h&lFpFtF0N  0h@1 0 0*T@T -T00D S0@0JSn0S,S  ;S  RiH .BL S` ,S;S\d00PU 0,SRx@PL 0SI  H L bh& lp&g.tl68$(,P0` ؠP`şDw6p%cR0#03 1d002c2c# b?0ppcW"Z  ^  R P`N |4|$cR*p$lpLP 0(,P0`p 04(p0,$p 00P#cR0#03 1d002c2c3?0  cRP c sP  RP0t#3>#!BcR*x3t3(p01c00,^00P00D#4p 8 00N  0h✃@0@ ╃ @t 004p80!/Z0S |Ϡl a^ZQ `S@ʟ@ < VP@@% z .X )  W.y 5:IP % ^, Ό3# qdO0 QS@dyWEVPP$ `@E`E`ȟ(ȟ K,(aoZ.h 11:h@h$ ^, Ό3# d S 0 @W `PLH@ 1S\` VPE_ 0(!:60 0 $0Ϡ! ' >0!!!0Cइ 0Q ?##. 0Ϡ 0,όក(~C1  ቂᢍ  Dǟ 0 Q0 pǟ0 ' ^, Όp3p#p q\ ` V PE    U&0 0cP:S8;Q$0(080` Pp@`PL40#XT YW W0#Qp? 00?0S 8@<W 80<8p< 0 5/P `0Z\ QX Q~T QzP QvL Qr p0`S P Q$% Q!S, Rl0S pWg 0 SdJ1F Pe,Px` BrIX 0S@`TJ#M @A 0S7 0N080+ 0+P0P0姾`@EOo [*[:[$4[4*[\4$*[B@#[1 "*[$![[$ ! *[[ *[ [$Č*[[ *[$[*[ *[$ [*[W Z2\T}QR [ *[$ [$ RI SG` VD  ` ,^6TF 0 FC:  0PS.`Z00æ0@T )9 F0 0 30\Fۍߍ0/S 90BQ 0R/S  5P DI@@H00`X0@ TR ZSZPQ J `@p 3N$ (,004U= 0\ 4 Q"<$1Vp+ ⁡ZF` R@!X0,`$ (004@T@M`^v  \`0\ \0$0\4 \$!?8:[ Sa0J08*S R\ R\P 8ZC7PO L| 0Wp@0P 0@E+.C E0a S`Nph@@W yP0W0 @0PY a0共`LVPyP  yP0/SR0/SOP&0/Sr F`Fh QPQP Q Q@Q@QDQ PR9 像AN h(0$ Z}$ (0Nh   Q)`z@ P$ hp(0,P0 0^  4Q"<$ 1 VZ $ Q\  Zp@`$0^ ^04 ^$0^$!? $L\ Z Ao pd i0S PW"@0W_0 00S -@=0- @0 R s Q t̔<\07 0 A+- h@0PbTb``0SZ0@?`cX0SPⅡQPZP }SPPA@QM0`0 RW@ 0# C !p|@pP(0,PF̉S n"1 R 0oS0" !0S  0H0B 0410S01 R  0S !0S RNh0@|00 000PW @0E a0`ᅱpl@1 \像B<02hC% p+P ȡ @ 0L Ğ ě hhNA-pQ@X 0Sd! N,00 01h6l6h`P`P 0:S  DP `VpFPU N hg0PPT`VNLg@_ `S T 0:S*S+0Cs013ZS@Sa0CSR`P D p@-4P4@P@ DPp p@,ȓ 0 00P/A p,0, 000S  /@ p P/ | @-\F ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2YP2SU P\U Ѝ\00P2S `@T 0400P2S"|"X"L" "!h!!   A-`0P0Q0PP MS@P1 V7 T=p`0 80xq|q8O<T@D @@`@p8P1TA`NPP%0@ 0 0 1 30ލd0P0 (0 r" 0v @-@P h 0#C@h0;0 rv RZ@-p@-@QPI 00!R ! 00! \ uP 0B RQ`' Q0AP R 0 U00SpfP DfP `>fP0 PW40 ?r 00B(0<0 5r3t 00u Tu A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!pP  w0S< 0[1!pqP  w0S p w0SB 0[1!pS w0S, 0[1!pD[O[Mw0S 0[1!p3 P>   w0S pT 0[1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% [1 0!p0 *R# 0B Q@ 00B SP i  w0S  qp q  w0S `p  ;  w0SV 0[1!pw0S Cp  0[1!pwX0S 0[1!pw0S 0[1!p}wM0S 0[1!ppw0S  pw/0S 0[1!pWw0S 0[1!pJ pu pn pgs R  0p 0Z  [@ 1, pJ pC  w0S p6  0[1!p  w0S 0[1!p I w0S p J w0S 0[1!p npD gpp T  [p$ Tp MpI Fp)_ w0S 0[1!p] w0S 0[1!p , wt0S p 0[1!pnE w0S p$R_0@' p7 w10S py  0[1!p?w0Sj 0[1!p2w0S pXw[0S pL@ w>0S p?  0[1!p  w 0S p*  0[1!p p P  pC {p tpD mp P  0B Q^@ 0B 0B P$R8 w" R 0Kp0 [1@ P  P  P  P  P  P  P  P q0 S p  0[1@!r P z$R@00 P o P j P e} Pz `x Pu [s Pp Vn Pk Qi Pf Ld Pa G_ P\ BZ PW =U PR 8P PM 3K PH .F PC )A P> $< P9 7 P4 2 P/ -4r ~r  P( & P# !w0S p  0[1!p P  P  P  P  P O-@ϟM M0Pƍ0TH P@ H0S 0T00!R !000h00 Q 0SN   RT p H 0  0 L ,/찍 4 K/@(嘰d 00080l0`0$00@T$ `%T @T0PFU$0pJ!(0PQPw00$pT 0 @P `~0-1,0`4 0EZS00 P`P   R00s H0S P`p>+h1RR1hOmh>TQ.`CFmˠ0MPQPDH T,TdD@|8HLI`P$`a`P`$`0@ 0@004p00EPqp00E S$U, ,pS2 U zUP ^0P00(00{0$080S 80匠0@0S$00$00ZZ ,< 0 6 30T$܍ЍUX 0D \l@U`X QP @n~@\X<D-$0\, Q00S@00儰0AXP\ 0,0\K0|@DT!L\0`P0Q ,pAW#S@0$000(000@T0Sv \^raU` P X0$ D -1 00 S0 00 SP0100 P000p0 `P 0BL00?V0X{ r -!S 80S 20P80 0p0S-0~00s<0 PpGW0x*0 Pp0 S@0$0Xڼz堠pt@ @ᘐpHX   R ^ X P  HX( 0t@t0\0~Q-Q3BS(-0d0V~I 0 @\0U X0  <0D0S  XP @@U S(0^L0(0CP0)0A00QP  h00Q@TG L 8P~@\0`0S  VXP @@h0l0>00(S0  @X0P 00Q(0S0  /X0P 00@~0Sy 0~Q00t X0P*( - t QS t X0P(  t T800NS `U~#?0(`0 @P0\@X@<@D0S<0SP 0PS@@Z(p_`P(pP@FJZ   0RP0 S W0P00JZ0  0\0 < 0   SP00 P0Ϡ 0S-0q~0 0@S࠳   @o R 00P1s 0P0WX\  Ď@X  D@ 0sI L0 0-1S; 00,0QK0(S0&(0D 00 ER0 nn2!  00Bl00?R0S_ 0l S~P@@P8`/\@X@<@ mT 0P ( <0SPL0PS 0@`L0 0^(0RT0P009 c HT0P 00{ XR 0P ^ 0Sp~`[ @倀;> ^% 00~  0S Ϡ^-Pp  R  00PSH 0 0pp0\^[ 0Sp~`@SP001P$0 c^<  00 S~  %p S0P 00k  SD0P 00 00 0H00 `D H D 8 > > 3t> X ; x7 7 6 2 0  , 0/ - D, 8,  * ) >@H  %L`Q0#"002(c`38# SD0P 00 S  P000 P000p 0 lS0P 00 |0-10l0XDpdP0pPE<S 1,0P`>p x0D RPPS 00C? 0@E S(0N0<0@8`\0X0/XP000 P0t@d}4R堀P(PpH@DT$   0RP0 S  S0P00 0S  R0P 00   0\@0g@mD? P4a T0p@E  $0@00P0PP0@9P 0p0P P0 00~RP0 00倀P000 0P P0P00P0sTP0 00~RP0 S0  R0P 00(0u0D \_00CL0B P0 R~ P0 ,,0A/\s_SW 0 0p1i^V 0R! ~0WpF^ 00~` 0S@ RN 0P1^N 0R! ~0/_^ 00~` 0S @l>00(OQ@d@P00ppP00P0 R ~P03P0 R ~P0)P0 R~pP0@bP0PP0pZP0 \^CP0PpP0P0 R~pP0@?  )S(@00D \^ B0?V0L 2@ SP00P0$00 00H 01p 0SP0 , P0P0 R~P0@ ;P0 R~pP0@P0 R~ ϠP0xP0 R~P0@'P00ppP00m @P0 R~pP0@P0PpP0{P0 R~ ϠP0Iy8 &P0PϠP0 @l< P0P( @ < f 0@000S0 P0pi0\0X0P`00E SOpqp00A S$Q0#S/ 1 0P`O O SP00P0$00 0_ 0 0$ 0H 0zp@S0P0`1 ` 000 P0$0H 0cp* 0SP0  P0 0pp4@-@`P MDpS@0p0 000@S Ѝ A-@P`pS0 x0@SO--@/ pj0H30P  (  O{(j3):0!**R7 0P000$0110@00S@(@P p0 0[0S0SS I00S Y Y R H0P0 4[4 0090 0pG04a^ pn0G040S  @(@9U Z$01P00P0 0009 0 00400A-@P`XUTp 0S*P @Xp@{@Xp$S XT@pX@:L #*460/Q /*460/P@-@00 R@P@Rp@-P`0@0R@*0Pp@ R 0 R Vp@ 0@!O-0@ MSX@DPa`101 0RYq`":0 6  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ-`@0UM0@,P.0L10V{{{ {q0.      WWԮ  @-Kl @-T @-p@-`P@ TP P0F R @P  V00pP P 0?0 UP< p@-@P UQ`PP  Vp0:0 U -M Ѝp@-@ P` !LNR !@Ap- M ЍP/D -0")2b3c1@2`M1 ЍC0@-@PPM {  0{ Ppp`Ѝ0 0;0 2U    p@-0@Q r P p0 S P1 pj PP   ! V @0O-`MpD.@0D0QP0+5X! @0S Sj @ 0 1 bP  P T@@  0  WT`r ЍW Qz@0 Q AX0P @0   P 0`00QB@`VRTQ`p0 0"!` b  V0 XT@P@0Q=W 0000! @TQ- 0P0@20f  000TV" 0 @000 @O 0Se0T0 2aPPlv"! 0#000 @ 0 l`@Pr 0Q/ R  B / 0RA-@P'`Bp1W@* R0C@C   TV X@@pp0 `f360@p1W@:b : PPO- -4M@0  O0l0x0 0&P t0p-P 000P0 0 00@ S040w ` 0@t`00@ SVV!Ђ0 @ 0SЍ 0S0 EP 0l0 00S $`,(@S\ ?o280$0Q0$0吊g{V VGڐ*5 f01k5UV(0 S (0SG( %0fSt(0| FY!0 S (%Y 1  @ pyPxL |0p0LY|0 ; |0pP0|0 A R< Q0 tCY x YpOyk0p000400 S|  <00S00<00 00 $003 (0,@S A,8$PQ۟䫟˟滟P?@0 0HPL0X@H@C 0P0  L ! Sx07 P x   !Sp@|4 0PDp0 W,0@0$ 0 @p`C0D,p@`@Q0C @D@`@T00S0S@D`FpG,0SDQO(0SVW 0P0 7 `P 0S0S @  @ PpPppW0 80  R P" ZN<00 S0l0 $@x T0 @DTQ [ Z0MNpT0 0p$ 0#[00S|0D0I hd @PZ dQrtWx  ! x PxI 0Sh p UbD0p |0Z0 0C?o20S )K{8Ik{_Zɋd 0S     &?@V瞯<? \ X?N00XS ptp0P P0 0<x Qt000Sl00l0R  x lЍ ,$t0t00+S -S( 0C ^0St t00S 1C\@Z $ R4iS* %IS' NS-dt` > P% 0l00 00t00(S6 000x P PB \ ,$ EQ0 0,0x tl0)2S$"8{PP*"* /B B*  *0CS'ʐ: # 0:II0H   {0 0tV0r0St00S n1CQ 0ESI 0 At@pH  i  h3Y01{ @ )2S#{*"* /B B*  *0CS'ʐ:# 0:II0H 7 {0 < PJ Z000t0PO p-000(00t00@ `t00C ^}^t,t00C ^^0 ,S0,0 V`∀V!Ђ PP`TV! 0Ct00C [dt00N0C [L\Xڼ@(Q@a@nS  x Px p0 0p0js% 6@08  ,  B1kl00{0 G GiPv|0 00*$&%&*&! IH I `xP  PZ/ 0IPT0 tPxG  B\ 0S< p $0 0R0p 0 0P01  P-  pa 0P0s"@ 0P0jxS Px <0| 0C B<0|  x>0P 0꧋{ ZNj Z{相80吪SI8! 80S0T00T0␪相T000cT0Pxa @P B\Z<00 Sp  Bp 0{j{I{7{l0T$P0X@l0 0S |0 0XVTHRP |0R! 00SA S; SP xB0x00 l0000 "aQ!*6P00  0c230 0x S 40S-l0Q000l0x @0l0bQ"00q @Bx Pxi |0p0C|0EYA??N0 00 l0x0 :Q"000 000S0 EP Rv :!0'l0 0IpT00(0>0080q_ pZW000 0tx0Pl 0x S 0t0,0a$`8(0@0}x<0| 0 <0|  U $PX@ppEW0 xs$ Px |00C|0&Z{相80吪SI8 80pS 0T0 {Nj0l0 0@,0AS$`( `400c8050 080H 0l000 P8 $@T s@DP.$PX@x <0pP0C|0|Pxctp`P t00Ct0Pt0 0t00000x l0~ !\ \ \ \Q'tp`0C0,0㈀ 0ES0$0,r0x000 0P 0l U00XS Q0X j00Q )Q  0Ѝ{;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:ip O-M<0p 5HJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0SpP [ FU 0  UE\ PN Q UP   U 0CC10B1P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0L"00IZP0D^0[ @S0 QL 0S@00S P3 4^E *@C #`P `D21 2 Q\` U00 00S@0T@DUQV`Db  218 PE 9 @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E GP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq KP@"00ЍSn Sh S4 `Pb@00@0 00V@ !kJT 0 PeS5 0 0@0saF PeP\  0 S S HK@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@J0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S 0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P X  /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPV 0 BP @` pT  0 BPp0U`98@-- M` p@KU0  B00C2S*ސ* Q6cZKE A Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ H0"S1 1  !2R / 3RS/0 00 c Ra `` 0 ` RA 880 ` R/qtpDpA-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q @ЍA-(a(1`pP0MS3 U10AT !0S 000+ @T  0S0 00Ѝ  @00D1S@0000S 000@u poD" 0p@-@P0p R pPQ`00App@D `ۺ80 0QApp@Ϻs pnDpn0  +0#10/sQ#8sQ#4  00/sQ #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P$pP   ! Gl`hP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  $G  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p1ⷹ @P4 P1 p@T `P@T10SfP@$ 000S 0⍹0∹@T 0C  pP@h0uiV0S <0j ,0R0i o `jpqjDhG-`0b@TP塢ڃ0TP$ Zp  QF p0   a!  \2)R0L`0C\0030 `.pG \ `$-0P!1^$23\ *G-0@`@DTP  !1QF*32\ H*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@ H 00P0S 3 # Q0 A B  02NS cP 0!0P` A-P@Q`pE: 0` P0T @ *\ l10E T56 501 P56 +C0T `6<#511<?@--` M@P@P : #z:S W 0  C.G B 50c 0 Ѝ v0P c2# RW C>C0C01` Ѝ0S0/0 R /@-Xap`@PMA @1P4PP2  pP,0S  Q3 jp 0: S,BP 0uPP0@ 0$  0,  0( 0 0Ѝ2F00Ѝ\PL0E0 #D!F00FO00h 0p@-@P :00CS00 P:pP0=0 C|@-@P 00CS00 @0I04 Cp@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`SE 0 p`0>0 C0p@-@P8 0S< 9 P00P! !' 0S 3/PP೼000P @ P 00 00`00aap9\0`` 0p7P,080 ECCE 0P0X@-@P 00!R !#P 0C 0;0 %C@-@P 0 0 S @60;0 Cp@-Q@PPR 100S4 0 US 5000S: 0#$0 3/0P:s004p00P @ P 00< R 800pA0PH6P00s07`0J08 B  0@000 pD 0 @00c pt-Ѝ/@-^@S S S  `0@  D0@ c|D 0  0@ 6@00 00 0000/<P@- 0At @XD41S O- P`c`EM  A 4/p17/9? !0(l (|  p;o7@p:/ `;o$ 7:/(p,$`;o0(, 7:/4p80`;o<48 7:/<`@D L;HL@̀FGpE`JK t (`DI | HpŐp$ ǰĐp@`Xư`0`pA/`epd APpMOĀmX@Q 0piPSQ 0piPHQ 0piP> Q 0piP4Q 0piP*Q 0piP Q 0pviP@Q 0pkiP YEߍCO|C,Eߍ/aQ@-P @41S  P  P0[CA-4!@ pPP/1S 0L1 @P!PPPUQPMoP PQp ַW Cp_oRCpCpp@-@P 0@ί@A-@`~P] VapPqPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V B0@BB@SSO-P M1 Sw$aVp$(q SSp A`TO X`A (0Pʀ R `(q^ 0P@  Ѝ Co$B/0S (xp \ Q @pT`xP0TC G(VJ ( 1$! AT$$(0 [ `(0 A^% S :0  @PB@@,A \$O(!r5 V(* T$1$$H0 ?([$:((~ Q  0 $? $ @(!$AY 0 $?0(S 0 4oPb ,0^0{$X@O-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 mPPu2  $`mP$`  0 `P% 0@SP㲀0C  P\ \1 \"  eP  0 hP@0`00,Ѝ 0 hP0 0 †Ằ[ PಐU I  eP(A0DS V(Qp  0pmP 0 @-@ ! \ @$@,@00,1S@-@0@ @00,1R@-@1  @0@,@ ,!O-`ᰙ0S ]M= pPw@P Uq  @| @P 0 Up3 < pɟ00 8p4  D!?@ ?Z PXP }V P0pS40X W!3^ TH ^^@4:P3] uD H 0$ fP 02 KA<,0(5 = Q PV\^ P  0p pt 0} V( 0S% A/ 1++< *0)4 p)<(0<( '4 '<.0<. ,4 ,<0 4< < 0 4< $0 #<$* <($0 4< (, 4< ,0 4< 04 4< 804#<8 <80< 4<< < <080  80    0   8|  4p p ̇$  x $ (p < ,Ġ( 0$8 ,  p0̇(,044 4x 8 8<0 @ 4<|8*8p | *̇ <0@)t )  p' pK0  | 嶀S(tpN ) ) x 岰+, t, SZ,CC r AZ2X pG^Բ  9/@P OPኳ>P]ߍ|Ÿ 0( P p1DN90  !NVq QU0 aPP$4Q$Pc @Aq!弡Q0 0 ` 0! `]ߍ> >Qt|> R2 < p 800p4  D=@ =\>{ Z Q>N>@PqJ>PnE>PB>Pd0a:>p5>p]LQ Tah`hO-(P`P10p5fS@(Pp5 Rؑ吱P- () ,0[ D D S 1"1 Ofꂡ UP ر .$ J< ᙲؑ@-@ 13/, (Q0@-@Q -00 2= 0 O-fMS` $ [pW  "0!0 @& %@P< Vi V1 Ve (0aV@ )&TA  %@P# 10CS`*0Fs @崒 0S 0S 0M@T  @崒(0QaVU @b,  1% h%@P 0VSa V0F %@ % % @ ⴒ[ @Iy洒 U(01ḑ0CS㣠y'*z0YV) ` %V )%@P 긑0(0 @崒 /`FvVv @: 0 b3 @1b0 $3 @崒, 1% $@P 1ᴐV0CSy`!*v0Ya V0F1ᴐቐ  10@! h% $@Pc ` ` A0b0 $B30Cs 0 4 0Fs/0!10@崐 <% $@P8 10CS`:D0b0 $3,0b0 $3<hlp@-@`PP 0 00(0`00Q(0pO-@ ƟP LMQDp` $00 2[V  400%5 0 D0 30\LЍ0w R*R* p 0$00 <000S0 P8080 0Vk 1S6 ,$P䑄/  00 0!0{Ⱐ0 BR张:1S 0ZS000 P 0 00000S !$  P 0崐V` S0! 1 BR,*0 F P 20 2r(k i0w Qx #`P_ 0 p ?$R0CS㣰*{0Y* C00C \1! 0Cs0 ! 11 0 I0D(0  0RK 1S RQ  RYF  # 20 2A0Q0i*10CZh PbJ0V㰐`0 2 i Sf # p 0,00 4000S0(p0000(01 S0"1!{/010CSP*u00C S {?尐!0b0 $1c0y漐`尐0300D0b0 $x1,0b0 $q1" $" }}p}O-(0pM I @aP0`f0PP P FP1uP0y1JZqa@0 R 0 1Q@@10CS㣰N* 0Ks0S0Cs00 VqS10C1(0  0R/ Ѝ@ Q! R b0 `(0p) 0  PQ  p 0 0 p1 S0C1ȁ3b0 $0T> Y3 0I 1pP(00(0U QPEUP*0EY*0 p1Ps YQEQPEUP|*uP0EY Vp崑 (00(0D10CS0I*S ```@0 `p崑^P Q "PP @ PAPV(00 (0"0!0!0 !PPo 1P0CS㣠7*0J 1P(00  j"0b0 $O00 1pP(00(00b0 $<0u00C StQPEUP:P0b0 $-0{80b0 $&0 5"sh{0yxxxp@-@PQQp !P 0 0"Q !P 0 0 "ppO-P,a V0Fh  1r!@P! `Vp0ഀ0 0 po 10CS0s0*S0SS PP 1b0 $/  H 1zp0FV㴠q1p 0 R 0 1Spp10CS㣰4*0Ks0S  Cr 0 S00s060W10C1 ! R bP  0! 0 XP! y!0b0 $^/vluO-Pp@Q$M d!00 2uT T F100$Ѝ(  @f T0 0$00 } `PN  R Lt@Y* bP 0PeA 2@D @dT㴐: 0 bt@ /Y:Aᴐ@DT@* 0t@ @DOoS0CB0  0p= 0S0C@0  'P 10CS0N*s0SQP@ [ pP 10CS0*s0SC 1 X1@0CS0*s0S!P  m  hTp*t@TsP^ 20 2$Ѝ4b0 $.T  4b0 $. T`  0 0 P1  RA @44`0 0R7 `V t q, W@ t@@DXE e q Wl 0G 1P AᴀW@DT@: b$;.d3b0 $4. D ? pP]+P{ 2b0 $.02b0 $.G@W1 @t@ @01p 1 0@1@p01  P@ Iy0   oP v@T 7T1/00`   P~ ,` 0R @T 뼁VpB 뼁0V" p0H 1.P] XR  B1r W 崠0pG1 #!0IpGsw0崠1 加1 0  P5 10CS㣐:\0b0 $o-  ~ PtPrrqpTp4pm@-@PM 0 0 P Ѝ050 F-TmO-ŸJM M@Pč`pPg VW00?2$0S 0SNIPIT/ hP /00H"<2 0 4 30Jލ Ѝ >@0X0 0UXS 00; Is0, T:)[' P0K/S  0ܳ0P00: S .000S0I S.?00 1X0 ,QP@PV# 4- Zp!.0SY  \0 RK Y P.00W ᗳp z△P .@oo G0 lkkR Q0P:Q0Q:x-@-@-@@ $ @[ @ p@-@P#)P$ H p@M 0@-@T M 000 @lP 0S  Ѝj֟@ 0O-TM Pp`0H0 @D8  $(4PD 0,0`< @@pLp PP  좟쒟肟 `p  @$ "dXb`%0#  `!,l(a `& `zcna'b(*abf` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah猈b,)` &`dL(bdl+`|.plXp`<%cjgpl& ```ga*aldH(d` &b()`b`j+g .pl\c:%pWpl̠ 000 0 p. R+. X ( - h   0 0  < 40 0 0 30Ѝ\ d @-pQpP`MD f0S7  @P PAUЍ Ѝf0S"  p #'p 0 00  0p@  fp ΞTp@@ePU  @ P忞H帞$ *@  0O-llŸdM \000 00A0PEZ!0 B"3+S+s`@? W: Re:0GZ0#Z(WG @`p @ `@`@P W0@P[ Z]!|1 0 \0 30VdЍ\\0 <)@  *W; @ A S@ 0 ` *@ [ 0`@h0 <) T:0GZ0Z tt0 <)0GZ0ZW[`0@ ``_ O-$Ÿ$2 M0p@`000 刀 ;* P!0  S P Z  @ 㔑?P N^艐     @PF E*Z3 Z0  D 0F P  wP 00e @@SP0 f0`00d X (0 0 0 30Ѝ4 ^^^\ ة  0@- 04M 0P0,00M @T d 0T T H0 0 ,0 304Ѝ0$ z \ A-$!$1 0HM Q0D00@P ` @qT( 0TX  ` aV p 0V  ] h X0 0 D0 30 HЍ$ |$ w* T  , C- 0 04MP`0,00%`@ pW:T p 0T %T H0 0 ,0 304Ѝ$ :o ( 0@- 0 ,M0 0$00 @ P-T ` 0T P D0 0 $0 30,Ѝ0$  꿛A 0 l @- 0 0,MPQ0$00` a p@ T 0T p d0 0 $0 30,ЍHV?Z/<'$ ꆛ l XA-@P` Aq08q0P00P 0p0S   L| P00  000 0S$1  @p  P 0  P 0 0 0XO-رK[@pm*{0 80 Pa{`FP 0` 0 VF*vP P  C{沱ᶱ PaP`F ` V>*vP P00 000 0 O]Vv`4*V 0 rPP:Vv` *V 0 0sPP:1bL0d p#'|bL0d p'1\bL0d p'@bL0d p '$0$0 $'W`W&01 P0P P P r01P0 P0P h\P   r` @pW0v`@Vt@@TB*t0  Y !0s00 s014Ѝ   r   rpGwp@@T,PL:0 $%D00 $%hbL0d p%L0 $%`@p'%WLVUHT\R4RRQC-Mp`@P%  PP 0!0 000 0`r 0@@!! 0 040000 00@PЍЍO-M@ p8kPPN 01 0 0 0رR 0ⲱ 0 1ᰰ0CS`G*v0[: ر ՚`PF 01 00 00Q00岱000 P 0 0P<0 007!p3&Vpޛ@PЍכpЍ 0p!0@P,bL0d p% 0OO-\M`0儀pS>D0@ P(0$  t@T X&*1#0Cs0 11 " r S 0 0 0@SD@ a,^p  $8 008,000F 1APR `V 0`0 v`0CcS00 p㰑1 0CS*0S 00p"@ `V@ 00 0 00CS00 1!R p0p  0  00 0VS00 IY㩐*y扐1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 0#S1 0Cs01 1   00000 u 0@00DpS, 0S 2  0  / +a0S @ R3@p00 ,F 0 S@Dp      \Ѝ3@S00 01040封HX㨀*004 1xpC0wp0qqᰁpHX㨀*0x03@S00 01040封H⨀Xx*X 0 0 sP:400 H x0 岁ᴁqpGpWwp*W 0 0 sP:0 0]  IY㩐`*y0V* C``F  001`01pL  | x@ r ne`V@Dp  0 00Q00 0 P} 0 0 0L각HX㨀b*x戀1040F각HX㨀O*x戀1040`bL0d p# 2  0+ A]@ \ 0 0,bL0d p"/bL0d p"=bL0d p"SbL0d p" pbL0d p" 0!jbL0d p"hbL0d p"Lq0 $"DpQ'TMM\GFFFF`F4FFEO-@`şM ,p00 q p )PG A@D@Tt@7*T/ p @Ѥ@spT PuP P 뤰P@D0t@ "  !P0 @ 0W 0GsP 0k P b$Z"0  0Ѝ 2P  pUQZP10CS@*t0UQ 0 0PЍ P  ᴡh @P 50㼡 W0  {00CR #뼡@ W 0J 1P 0ZK[0嫰:2b0 $! 2 p P tP 10CS@c*0D@ 1 PPE 0㼡 W0 D@ZTj 뼡0 W P0J 1DP `1b0 $!1@DPEt@ up@! @10p  $P 10CS@: E(1b0 $!D  A0b0 $x!0p@Dt0' 1 01p01y P0 1 @Dt@ @U0PE10Z!0s00 !pFCBAAR0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P L  0 0@ (! 0"@O-@T2M0\0(P 00$` p @ ` pP03?0% 0g#"," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00Ѝ?> 0G-1?p@P` @g(XS G! 0@0 0$0@`F0($0`Gp& ?V:@F?@( 0@  @T 0 , 0< 0$00T$0?`@p?V @?V@F?@ 0$ <@@ T 0$ ?@@@?`V ( 0$ a0 0$ A-@PP! $ap:?`V7 ) `0(0 0`0$0d0W 03?R0Ah v  08R(@R )@ bi (`8 a )8 b[ (`R @-I/ @-@-@P P Ό 0 0@ (8 0"L:R @-"/ @-p@-@P X00m]\`  0 P 0$$p9O-$6LM0^_~?800@( ,0  0 ( 48pH`D  ,$p h@ P0H A-p D ? 0=@0S,p0Ġ@ bR2221<00//|/.t.T. i,, , 0Ġ@ B꽡{G-p8M(`P {{6G@W@V@U@T4 0S !Q4 0S3 Q!-VL W`0b U p p P\K  0 020  @ 8Ѝ0SZ  Qp 0{ 0h2{`"P 0w ! r R  #m:VW$ Upm P`10    0 0UU0  P R & U  Pp\ P0 0VwW0 UpN 1 P0  `  } z00 R y000 P0SQ q0Sy Yb @aU^ PTd0P0  T pp o o lo Ln n Tn n m m d)l l 0 P0  7p@->0@T 03/@TXPP T00@T 03/@T\"pEH00@T 03/@T$pLl \l l k k k @-@M@P Ѝ{  0{ ~p P(0A0 A <('H-M< 0ЍO-p@R M ഁУP  `B80 S! 0SK: Z 0 Z 0"80S8  0Q@0 E 0 0 Ѝ 2  Z  00  00 0 P 00  P00 2  ᢎP   ꛎP  000@-0 P R@MP Q( ! 0  0 Q   0 13/Ѝ0s?0r? <P100@-@P0U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpG-`P @P0Sp:ؑI Y `1`! { I PU p @PpP pPO-Mq0 P0 pG 0  PU @P U`1`!   8[ 0PU0  ЍЍ0A- P@g P 0 a`F [ P@D pT ОP/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:)080pO-Ÿ2 0|M@R0t00`P] 00S80S ph"`2 0 t0 30|Ѝ4P  宊P8 01\ $`0P  8 0 0d pX; P&8Z? 1` 81! 004 4^ 0P8  R8P84P@PXP`0:A@8嶌0 801248 Q :0 S 08P堌P8JP 8 ` 0pP 80008P偌P8k00pf따 D 4<^ O-ɟ M@@D,\($ 0} pWw 0H"4SnSl90Wo 4000hh00c0P.  e00d S  S h`I dPP& EX 0 0h0r000 @h0S000 R @P :SY 0S c/ d[ c/W0 U 0 X@  0 S   0S$ R0200H2S708 R400W 4p0p\ r400p4`400刀u` 0  <pA 0PW:: w` 57's0_UPP6048 W00S  0 \' YPPU PEWY0– 2\8 Q(( Q 8PS 0 SR7@T v00$0S  00@8Q 4Y  [` TpJ 0S8 0 5 P 0到SqT2 c/00< SG 0 SR@T 700$0S ,0S !s$0(0S (0@Tp 9 0到S c/ dh R   P 0 SRPU 00$0S  @?00 0 SR@T 00$ R 00,"00#3 0 2 30ߍc/ d' p 8Qc 0 SR@T 00$0S  00@Jc/d@0h@ +rX *㈀2 `0 R(S Uᅀ00*PFY`l2 08`0p4p倊Trp/{p0 S ((Wࠓࠃ\^` `0\d\440 0 8 \R8 \P0` @ eP 0 SR@TF hF00A@ @ h3`ڇ(0PP ` s8@P@@ ` W x@  0 SR @T  00$0S  @ n 꼭 \ Z Z p hU PU A-P`pX@M@`@҆00 0,00(000a0@ÆЍR @- A0@ @ €1p@-P@Q 0P ! "0 2pp@dp@-@P` VP$p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/R00x B-ptx` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/@-$!$1 0MQ020# 0S0* /!PR*  R @ 1@r0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@/ 넟 /O-p?o2P00#R00,MSP JW@  0R0 000$00 0000SU 0SS0哨(g 0 00(S@C0 $P#  7/P 7/P` 0S 0 0P`0`cV0= F B R Q @E"PBPEUP!U Y*0SF* Sc:P 0C0 0000S0  RR㢀@(@ 0 P   `7/ 0P 0B  P @V, 7/PX X  00R0X 0 00 @`0#!0 R0 0X   S X 0 0 00  "! R0 0 S*S:  X  QX F ^ @E"PBPEUP!U @  B*7/P  7/Px 0 S 0SN 0#10S0S0壀S0哨( 0 0 X BuPS 0 1 0 07/`P  7/P0H 07/`P w7/Pڅ0`DP 7/P ]7/P 7/P]P$0@ "! R0 C  7/P P0P0Sy,Ѝ! ^ @E"PBPEUP!U  B%QPU P 0 'P 0 C07/PK 7/PPC7/P 7/P7/Pm  7/P e@S@8 ) 7/Pg  7/PP0 0 0@哢)YP `c⃰Z~* P  Uu@P 7/PmY Y   0 T0 0#0Q0 4mL0 (0l0 (|tT-0 M0 ЍPR Q0P:Q0Q:@-钹A- 4PS@M  $3/0dp  QP00 ǂ4P4S  $3/000Ѝ200A- 4dpV:@T@T 0P0 S  00 S  0∄@P0`0dp@A A-`M p@P0: StcPP ˅P@ P 0 a tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0?̑  0@-SN 00AS 0*O-4 MS|@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0     Ѝ P@ 0 QP300 嬁$R P1)00@000dS0  pq0Vp 0  $6/ Ѝ 00 Ѝ00O000Q 000A/0@-S@  R   0 劄0Sᅄp@-@PT @T 0 `pp@TeP`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP//@-P0Sp@M:Q !SV@Ѝ0A 0`~ P F @{Ѝ_T 0 @00O-PP X 0SL K 0SH p@ap-[0T B,B R`  0S7*V5* 1000P<0@D0CS0 T0@p@pT T 1 ! ,03/P00CS@D0(PQQ  /  D R ! ,03/`Pʼ@00 "R( T`1 `! 00PVQlRO ,03/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C0   BR @pZT `@ 0`V:b0P 00``F0``G  0Y0C00 00dP  n 0 0C0 ` d 000NP nX0G0 R X<H<0 I G00]C 00Y, p@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0Z0  d0p@-PP0 @`v p@ 0@0, P @p pR0 q R/ S/p@-Q@PP: 100S 0  R 0   p,  0R0y0  0 0c0 0 P @P S0 0 $0s0 $0<0  p @- aPP`p@M) W/ T6 p p插P0:*C/o" R  S L 0( 0R  ; 0 Ѝ;0d00 P WH<0 G T(L0 > A-"2 R0hM@PP0d00< 0 C 00  X"L2 0 d0 30hЍ 0`0S# pk0PO ! WP00\0pS pp6PP0001|0`  0St$p@l ȖPA L10F L<10/R  0 p6{ {5{ 00{ 0SP ` 000p p00` ppl0`  xZP꽴  P tL8p@-@0MP"~00Ta$V( 50T1S Os~0T1S'0` 00UTX!\!R Ѝp@}\!00Ѝp@}00UX\! X\!0 000S/ pp@-0 00PUp@0}00TQ~U0` TQUP }pX1P0X1~0T0`X1 ph0h 000S/@-@0}0X10CSX1 @}T1O}0@} p0 000S/g~ p0 000S/p@-P@0}U0 \AQ\ X10CSX1 p@r}`~0T1O}0p@g}h~ p-X X0 04M 0,008 00 0 ,0 304Ѝг} } p@-@QP  p@崐090  t,@O-M8@0 p 000Dm0T00XS<@ 00DA Bs QR ap >` S0T1 W  0pt pp 0@`> p PPD1?0 $60p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pg0p 0> 0W 0@ p p0@ p 4333333h00 0M0Ѝlr 0@-PPM @0  @P 8 ,0 0 0 30Ѝ0 88r q H0 S8 0 / 00 @-q 0 S 0,/00(@-H0 S8 0 / 004@-p <0 S 0,/00<@-H0 S8 0  / 00H@-oDp 0 S 0, /00P@-[HH0 S8 0 / 00\@-Fo 0 S 0,/00d@-2H0 S8 0 / 00p@-n P0 S 0,/00x@- H0 S8 0 / 00@-Xn 0 S 0,/00@-\H0 S8 0 / 00@-m 0 S 0,/00@-H0 S8 0  / 00@-m d0 S 0, /00@-H0 S8 0 / 00@-yll 0 S 0, /00@-epH0 S8 0 @/ 00@-Pk 0 S 0,@/00@-<H0 S8 0 / 00@-'$k x0 S 0,/00@-(H0 S8 0  / 00@-j 0 S 0, /00B@-D0 S4 0 / 00E@-i 40 S 0,/00G@-D0 S4 0 / 00J@-@i 0 S 0,/00@-L @/ /H-M 0ЍA-`@pP@8#pW0PpP@-M/"O R ?#0!PO$P P!Ѝ  0S RP/0?c0 3??oP/p@- MP 0 0000`@`0@PP  7P< (0 0 0 30 Ѝp*tg @g f A-QPp@` S V '"RSQ P_ 0Cj ?o/o0CS 00cÎ10VS& /o?o BR Z 0b0Î01pϠT\ ^ R0V0 BV  T$ 0d0?oc008/ooAq!  R! b0r8·V pV000e0?o0c80@b>08Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000  / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @% TS 0 C0 P @D^TPPU0N QP Q  00S @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@R`P R U  V  R 0 p00 (QRp@-`P@ 0S0 0 0R0  0pP0l ((R S 0Q00S0 0/0 0/0 // Q#/Q- S# PQ P P0C S00UPP-Q S0S P 0000S0@-M | @00hh00b d4 ,0 0 0 30Ѝ]$X W - BMMRč d X @ P   P㊅y1   W T@0@- @-||Ÿxr M Mp$ȍP|`@M TE <" `0b0R @`$@  P0u!1 0 $8 30kލ ЍB~p0\ @p ] 40 xQBnP`.d0a/xH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL00DU0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@N@N0 00/LO -$0$0 0M 0CЍ(O -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/N p@-@p@-0@ ,ppPb0PpxSdS//////h //1O-0pPW`,M 02 00000"00  ( 05/,ЍM@PL 0S LLL S0 S0S3*$! 00S S( S000S  0S S * RpC 0QW 00+ 00 0 0 00hT0 0S0H00 0K@TT4T0TTS|ShSTS///O-̟ M 00P0Q0S Y [00t0dU00`0d?* 000D@D 0P 0 `prpo@pl  0  `, P ,@ 0q *XH 00H S V ! 00H S /L|H P@T R ^0P  0CR P0bP 0`BC p-x $0p RPRP` p@ 0 0P00Q0= Z"* 00[ʅ Q00CS0C0 [ʄ0S* 0G @   0lX pp| 0000 Rp&\{0S P`@0 0P00Q0 Z0504py< 0 0Rz @0000d0SP0LS0B 0? T0SPA`B 0Sd 0000  +00hpe0S 00_{\<} 0 ) ' R ǣp @#2>!d00_< 0 a 0R00 0000S P   pDP`  @00CS0C0S(0S- Z 04 0D Tu00CS0C  [ʄ0S*0S[ [0S000SS0S j  0000 x00CS0C8` P @ 0 Z0J0#2 0 0 30Ѝ    000D0@A0 3  0     [000{ 00 Sx*< P B C 0 @~ 0    0 @ s0  0 !@ s0pp-DA@ 0000 h 0 @s0}|0D T)(0D T!-@+  * $ 0 0/ p$ T0 0 Hp\-K A t@ A-|@P@ `l0pP@PU J0S 8/`PEuX@pW0:0 > t 0SS S  0R @-{o/ 0R0@o/O-((@CM Mp4čP`0@  0 @0 44 30+Cލ Ѝ 0p `0pCP Wrx0 h 0pfL+  o 0o/ꌣx= @= (= T4G-0pS+ S'QU$ X!`@0S  0 0#S0S 0S0S0S(  P# `VP@ Q@0 R!R  "R0 R R QO- BM 紀ḏxMXčH1 0!p P` X' 0  pD]P@P U^]0 ZP*;PH <0 0 4 30BލЍ: : O-LLAM P MU@čO2 0Y-:0px0(S`4 0t@?s0T!T/ 0 0PU ]]  0 P @T t   0\PP D0 0 4 30Aލ Ѝ0x0(Sꔢ9 8 O-M Mtϟ0 p X0T [ !R & R# ` 0  0 ?p@X@0  0p t:  0 H   R: R20P တuo@ pR EP p ᰐKP R!Rs 0P PZ@ 0Sz 00 0[ p@`u_``0S 0@Sʰ00 9 S 0S%< d 8, [g0 @0040Xv?D0\4 0` S1S @ 300S S00T01@ 021QU[0H0St0(0p0<0400SyATv @0CPu D0PPPxs 0;b<@ ( P w@u0 P oP @0 40@ 040D00D0 0S \0S H0S!80S P<00p  R  H RY *0ㄋ00ppt`0|@ 0 @5/P |4+$; 0 6 30Sݍ Ѝ00S0 Q 4@PD0Px !}D0P0 y  0 : X0p jD0q4000SB0T0C@0`S\0c  `@V  0p`G0?`&0 0$P 9`0>P090Z?L0/ 00 ,   F  B|PP. U<(0 0R0K `1  0 l90 X0L80 Z   800803$ 00 0 SL@0b0!0t刀?A9c! |P l0S h@f0 P ;o0`ȟ-  ,80P80I Q"  (<  0 0P _R`1  0 70PX0 800 00}   1 01 080<`0 @({P& I 0 P[ `1 p 0 60X0 ^80]0 M 00 TX6PL0&08@ 0 XԂ@1Q 00U0pI} M 0W 0@`vQ@  ˆ20W000QP M  0 0vp1000P w 0 H5@X0 M0HP80 :{P 0D }@{0 P Pn|0ğR/0  (0d0080=n00lğK/0d @M0W 0ʤL0 +S .0CSDCPA0 @^;@5@30Pa.P AQPRi `1SC 0    R 0H080n |P8R6`!!! Q2   30 @| X0X  0H R; 9 qW *`pR|@P 0p t@7/P 0 80k`V~ q0 <2@X0 ~=0`!02 @XUⲁP S0 \01S@ 3`0`00S S````P1, '`0 {P00 `@zP101@PDYhP p0< (00 y<00PK00 P 㸠D,H8 88 tt3 lCĵxгL0İLPP tܨX TP Br R D yP00d0-P+0@&@ d06SV `v :YXpT0H0x D0 P TP Br R D yP0d0@0P lp0L 0S\(0 0RS 0`1 x 0 10XP 0HX0   el0 0d @ⷀ PD 0 (2 X@`0r#Z0   2H0Sn=00fyl00  d≀j0|p 0 Gr 0R0 D P T Br R D  R,#yPʊuX Aa0@ 0zP`P 1011S1 T000 30 X030 3@X@" 0cZ0   ?<0d01d000 \4 X0 "00`u0d0@0P k0 08 (0d0`0d0 ` `0 xH 0+S .0CS&@0P k0X k%00 d05 @XP0 @ k&00$X dr/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@'yP$Ѝ0 2yP͡0ıġ0"c110$Ѝ00@-$MP@yP$Ѝ0 yP͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/MbO-@$$ß CMM,čßS1 PXd ,p0$P0000 0  (~ 0p r P<QP0p\400[ PJ0D0= !8 S000 $0<\40 ;  P0 0000 ; PPP P00 V t\10,430NCލЍS# V 0?s0S0Q1 Q+ Q% wV     `  h0?s0 00|/?r s0}QVMVJV[ @<$@ @ ؤC-XXPAM M č@`p04$ R6 X}!0 @` | P-8ĝ0  0 0 4 30"AލЍR PP 0@ .Rd @ @H |D }U\ ģ O-AM⨑ M  čRwpPLpA@pPF }PPB t @+0 ?P7 0S4 `  0S+ 00@ p2P00@S 0S0S 00@ @K @ f @ެ ڬ@ ,0 0 4 30AލЍ耚  DP O-ß CMM`,čPp@X\<@QU0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P 0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!  T00 0 00P00S !  @D DR0$0 0s<  T80 tP0 1 00S|z0000   Rl@00S}0000 u 0s0S0S Tv{Tꌙ  O-p0Ÿ\M P@`dT V p"!3 0!100UϿ@ 0U 0 P 0FSX0 0 0 FSP0swpAT>T0SUPPj   B RX00 0 BlSP $T!T"T PHTUTѺ4<10 0  ({0 `F 0S0 s SwS S0sS0S   <PHUT0XU `$0@ P\Ѝ<P0\ЍPHUT, D@C-@0 Mp`P(-@D T@?)S0XpS뵐0 % S  @S U 0@D?0s0?0T00S  Ѝ\x LL$0 PR Ѝ, @G-@P` p崒Ḃ- F0S@`=0WV!9 SS@OS @,%0G?o`D2V0S ?V0*vG`D:S0?U0S Xx HH$0 P,,0 P`ꤘAh=O-0 MP䑐 0S2 @s胟p$` S S0  P$  <P- XPC  tP-0V , 0  SR 0  SRS Ѝ{Pd1 00d1 ,ylP0 Hy P P060 PP0 dy P  P090  |y000yt0:0 zP tP090090x dP010{  [P020r  BR0P0Yi @?P1?# b0 2Z E:0P0YQ @?P1?# b0 (3B "P< @ KP0102  MP010)x@-@HMsxs% 0{ P  |- 0 x{ 0jrxHЍ @-AMT  s0000 00sЍ@@0@- 0 A0tMT0l00  s 0P0#0 "@ 80 0 l0 30tЍ0@@꣖X  A-@P$r 1!01n0SPpuOp rp0PSp@-Q@U x3s|p b01P b01000pqc[sVxqP //8P /W/G-P@`>V$0QV@0\!R p Âp QVp "@p O-@@;_MM04+ 0,; 0P050P0XU 0 5`01'`, 05p d!  d!. 0`1q1110/aPP  Lʟ ~0ʏ Wό d10 d1u YWP& `P /a`0DPS_H [ p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000009cxP >000{o0p+09P 1#S;S 0(S$ 0(So 0(S@ 0(S 0|(S p8 R00sS1 S SD(0 n/,(8 R1 S S0S00 S S SS@@ `0 `_A_0P@00Q"0A'A+S}? |7R1 S S00R00S 0P0 S S00 $ e@j@0S S| 0p @ @@@@@800sOg/0050v 0GBPd,P R`P 0,P 0R@z@L0d!S 0 0 2d1p' Q8p|1|qp @ όp0`0S W`0`SHPDHp .Sp0SWP`.pGWV0 0(UPP /]0%004 0 5 30 _ލЍ4 Rq W W Zʨ$  k?00$` `ᄴ k V V` VV00;V0SJ`V @4 @0p ;V  00@`V  IPP  P 0 Qh!9P ``V;V # 0 00@`V;V  P 0 Zl` $`|3 R1 S S0Sq00 S S SS@@f `P R_ _AP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ000004'{_+P.P `_0!x3!|3paDP` DQ }ouQ\z`,3P 0 Qh!h!2/R1!RiP;h1QbQ]` P@+pL 2 7NP~G| h (ԏ domasearnamesortoptioninperȌȊ list8ch܆ p@-!1 P@hlHM QP T 000HЍpp Qx#r coV p 0 xT00mnPT $000HЍp@-@ RP0` PU ` 0P\\PpP pP sP pP O-0PSMp0  dd40Hu0P0 `\0P0 0@0$ (    ?P  rPX" RN M 0!#X㼠`Fd 0PP P rP R X@ PU& 0  0" `F@YP) (,$@  Q PX `F #Z Yt 0 ^00`Sߍ @,(0P PEQ*(20 $^  N  `0  S : 0C S : P CI⼰ R0 P XPJ( e X   TPPJ, 0p  0 H Q T P pHZp  X   0 +^v 0 {0 0 ^tޣ 0 mꌅ@ $@-@0@ 0@P @6$$00HZtD  @-$0$ 0@P00 00/< @-@P @[600H3tP @-@P00p@-@PP  P  0 p|L0X $p@-@PPM1  0`   00HsPP0 P 2>PT  0 ЍpLЍp  0 Ѝp L0h $t( ~@-dA`P@ MI T!T1 PQ0 Pp 0 RpGS( `Tp; ЍA@D@hpP 0bpP 0S@ R TpP@0 DL _ Ѝp0 L `_ ЍH00 i00 @~T~(~}}0A-0PU" 0U"0PUP!q@@ ``F\P  (\P 0!E`1(,`P$02~Pd'',0O-F帖@ MR 00408 6P0( ,0xfxvx`{np`S8 X&Q !GT@ d,!@ ,&0C S00  60@ ,  A0dP@A <8 @P, 8@0 P,0P{ PQE@80Sf0S h 8 0Sm87S H% 8 0S4E@40S S508 RT 8 0000040S4ğ0 @, 4TA4*02P10S P1p1 S^ h40, \40$0Sp @4@$0 T ,< 1P,6VqP0880^ 30,P PЍpAR $0Q*# 0T@!6# 84,P< @@P,4&1pRv4"0# @*Ȝ1\ \0X $0T:p @, 2@0 1P6,P_8*20,  20@ ,  l20@ ,  X20@ , D20@ , 0204 , 20<  , 0 0,0 ,  10 , ̡ ,0, 10, 0Q0001刡0 0 0 0p10wSp , 8PЍ>p M9p  u p\TmpP/ 0. S 00KL `]L `|x|t|X||{0pzz`Xyxd8lx|d@@dvHvO-01M0 X B* 1 a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y $00 ЍP<~ ~,~~4@-(0 $0 pm }A-@@`V 0 CQPqYP pG P@YP 0`0 H|@-@00 R \\  $0!0D0 0@ ($ T @-@PL  0S  T0S@*Z(Z@%ZdP/0-` 00 0Q,000 P0($0 p@-@PL0`D P 0(S  1T  0"006`p`p@-`0PW@P PWP 00p C*y A- 0@S  P p00  ( $ 8PP(p`P0x8+O- ,0弻S 4Ms 0 +夫   / +~` P @h+0\{p^/  H[@P^_@@ T@ } @Q0 :Q , @T  :R^@Z :0 Z:P00<0 0Pt` `@ 00H4S   !d$R; PSt0 0,0Q090( RC 900 RB ) 0S  Q )0 0($kIk@(p` 0X90 4 R B8ɟ  B QR90  P`0N( ( ( X 0 80P ` I [4Ѝ8 0b`P P @d8p0 00  D( 00D0DS: 8B0`800H@004  P`F0 0 0H0C 0 1 ,Pp$p$p(,(\x*ppQp(pW pA$pW P G@Y@`A$ppW0@  ^(0 1,P0 @P(@ @(`P, P  BWP P  BR \`A Ng0@(`P,  P1#0S0 0 PPp`@(( *p( Pr $0 0@SA @`p  1P$  pW+00^00$p ^P; 0000 @`000%4000C?00s( $0V$00( P A ,P$ppT (0$0 1000@`p $P1(P$@ nP@` p$0 V$000\JW 30$1,k, 0, 02B0@ (mP v R-rP( 01 (0lPP$ 0 1(P$@<0 (P$@$10$*QPSKKG 0ppP10<0S  p|! ^O0}ς00P +.000P4! /(1:Q0@ Q10 `|@ @0`0Vl xxxpxwwlxH0 u\ \P0rhtHxpn\nHnnmmlPm@-@P  0Q ^  00$0000 0@ ($ <p@-l@@`VpPPp0U1pPE1PSp ( 0$ 0pQA-pA@PT`QV0S@P  0P"P` pp``@ YbjA-p`@SPP T  H000P    E _ADj0j@-@@0/ 00(/000/004/00/00/ᘄ 00(/t000/`008/L008/8A-``PU 0AP p_pO0APU404 0 ,(0 ̃ 0ST~U/-@@ <0 Mb00a.W Ѝ`hhX @-@P 0`00@050 8n@-@Q 00 2  0 G-psPp@M 0Pp T 0S0{00 0  0 0$ -0{PP 0` 2$ "Z &= " 29 Q 0 0 0qp} X X @00=0@ cj <R 2"/00,@Z 2: 2 (;eP0 0] 2< 210 010010 010 0100100100P 0 R00   0T 0 2 13/p ЍTg0-00PP 0`2 2x00@Z@P0S}X 2: 2p FPx 2 @0 2D001800 48,jC-@`pQP M 000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH aP (0 $( p 2 P7 ЍP ЍO00P("- $X000X "R0#03(0 $X "X002S13/p 0 ЍR j@-@`pQP M 00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ  Ѝ00PO-1PSM3:00 X'*q`I`[ 姘p@ p W i0 PtZ 2< 2ЍЍЍkRP O-MXr=*`00A̱PmpP W [K DGR@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 p Pu 0SЍЍC-1`S M.:rWB R* U"R  R00U00SR 0 9 PpXB Ѝ 2< 2 ЍQP ЍG-pZ RbM* U0U @ RD0  P XЍ@ 2< 2ЍЍG-P഑p 0@E `` I`\1Q1v`01 @Q=zQAq @0 R 0 1Q@10CS㣐/*y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2pT00 (v<00 (o$bP0h tgaaap@- @VP P 0@P dp ^@p@-P`@Q R00T T 700p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-P`@Q4M 00 Vu 2+ RI 13/p)  0! 2$  00 3 p`0 9/P 0 9/P  H`0P 4Ѝp$  0qp 0 壖P 2: 24Ѝ?p`(0 0,9/P 0 s DD>I/j,,I/D0b JqJ}Ju 0A-s %!@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!ApPQ?U/)IW0O- @ştMTP @`冝0P(0f 0 ~ P0 ^ (t@0 000 00P0 R= @ H $ p 0\ D@x -  H ᲀ@ pRڴ R  D@D H P|  BHL  10@ r00(00@P @r P p4 X $ 0 00CS0s00 R(< @ @r 08pS0Q Ⴠ:8 0@00 00P R 40rS 4"08<04 RrP\P0p0,Q0 00 R@P P 000pwpP;0s00 ᳠Z100S B CX TP\]0S$0Q0 00 R 0P 0P 0 $0 000 PP,h40S 460 0`00 00  0P(d0S 0$ `@0T$0 hPY 4v0 Br 0X @.: 0H00( Pഀ0000 000tЍ( 084<0Y40StJl04800<0NLU]/Y? ",.= CC O-X\p0`S0P @L$P IJ IP' Y  0z S40 Ż 0(10S0 1$10$10 0S0ܛP 0 P0S 0̛P  00S 1$10$1T00O-MYP@000X00 ``FV(:S 1 !r `p pGwp n 0 F pF000H00 B 00p0@000 ``FV=*Yv`E V `!0p pGwp F0I`v`0s0抠G0Zp01`*0ಠ0`0p00PP{ Y```0S0`0Fyp0 ,0dp0 ,Y0v`0``FVk*Xv`V p0 0 00000``FVM*Xv`? Vp1p!w 0S Br p0 0`H`Fv` ׺0pwp0s0扐F0Y`01p *0ಐ0X0`0p0 00PP @00S;0`0FPЍЍ 0 ,`0p0 ,Xp0 ,PheT0 ,H0Dkp`40b0 ,:AA|AxA???|?G-p`P@ S  R0 ቚU@ T6 P X0SH0SQ 0R0Ӳ00ô00 00As0R0 BY001*r 00 000UU800C80t 剐BY001*\ vHHp0 , 0R0ಐ0CS=O- R P0@ Br( R(,W a0P P I# @P 0R  Br( Z`pV Z@  =P@@p@-P@ 0^\ ^ P0Qș Pp\ p pG-@` 0PS 0S  0 Q᧙@PS"  00S p\: 0 BS P= 0 \ዙP   00(!S$! 10$1P0 wP @0弐p 0Tp 0 S 710 B\r ἐVP  $1 0$1(!00 O-\0`0CS0P@Lp M P vG >FP& 0 0  eP 0z S0  Ѝ0 0S0 P 0 0P000@- M@ P p10 Ѝ0O-@pM 0 0p`Hp` ጔ P PK0SRD0Z 00 @ @ 0 pWK0@r s pGW0F*0@p 0@000S p0Cps0W㲀Ḱ07*0p00ᴀPP D0ZPPЍ0 ~P0 ,t0 ,0 pHHp0 ,00p0 ,06f6`6}@6G-Ÿw?`0 0MR,@pl2SL:0JSI Pz P崐2Sk1! BRE:0CS㣠j*z0Y* C00C 101@0p扐0pַ  20 20!(1 0 ,0 30A0Ѝ rP0 ZP崐 Z y0 p]P202 >p 000 p$  ` 0 {p [$0b0 $?iyD t4A-@pPQ`M A00 2   Q Y:1Q|_0" B1"0001 0 VA0 0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " vЍ00Ѝ0PU Q:(0 $P0PU`PCP  ^ wDP 21 zKE3@-0 -M  Tl lP 0PS @P000S 3/O SFU 8 80 $0Q/ $0S/B d H1<<0 0R/$ 0S/A  P<1A-@T 0Sqp`/XP0P@QD 0 <[YP 0A/PꈕDx&O-@$MpHnFT|$FLpp4pD0q$4SO 0! 0  0SpC(BP b0@S3S10 393 3$$ 3$ $ 3  3$$ 3$ x3($ h3$,$`N D3$D @Z$Ѝ $40$0($0,$0$0 S3000`V" P  2RCZPP2&C@80 p00ShP\R0 p0 00CS0z -p`  RF(4S VZ  4S8 0V0$R0S  AZ6@) 0@ 7000`006@FU0`00 ᫉ 4S ! D!Z6@ 4S $pp ` V V ,4S ^pp Ipp4S VMpp -pp `000 ^pp V?@0`oj1q&&ٙP-hx&x&x&&֙O-@PMp`PmHD @@00,3,#aHp: RPGP P sp f0@3 hP>  2H@ P PxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  埈PPXPPqT! {m`P "  PP* @PR0SQ t{YPdqPq0 0013/s So S>oXP\`0O ( (0, PU`00 XP\`> ;QӢԢq&('P%' L8'L('Sȕ'T X 8'kxTxO-MMh?g]Gw 'Fp 0 Q 0  xH0(0h7G@-Pn 0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S X㕃PU R8nR oR0P<0,㣹`P  <P8|`P,㏹PPP{  3T4QRN , 05 PzPpla4 1SzH0S?80S<@0S9 P0SP zP4PD0S 0$, +Bp P44X(D`尠XV 0PU 0040D0S qލЍS ,0SX sP 娠=`0@0S0H0S 0  FsP P 3R㓵( F P3m W` ᦡ0Z pP t3  dI&<P \T 0D40`FP MPP sPPT0SH10: SsPPP4 01!oP4L  0R p 0P0 T0S|H R 0 T0SP psP4T0S 04YX 8SU # WpVJ    !   !  $ ! ( , ! 0 4   8<  @ D  H L  3]P   pP40SP8`ꇤ@'P-קY;`px&q&j CǨ@-04e~P000U00SOr0C?ou21@ Cp0 1000C00S9 000-S40 2R)0pP EP SP ol hROsP xPqD84 4" 4" 4" 3!00000C0z㨻P&c@P |S!ȅTXcQLxPN<32S L#L04R@dt 3 0S 000S 0P 0wPbPH000!S 0 O0S XRd000S DPvDGQ@#A1S bVqQ`"_&P2S 1"Q:Ua`0:EslQ100S S C!0`00~017{@P. Po 8zPj @)Pg 2S 0"r r r2S`A " ҺPG2Sl p0"PƺP, H0"`(rQ0 0mQ`'q&<x&P-dT8c' '|LЙ'~hx&x&@-@MP`/P@P@PH"3 0@B@r0 Bp= 2Q=0 q E - PW RZ R\ R3 0!BSQX 2KPS0: SO&00 O ZBpd10 ER!IpD;wPePLP PP0 FP f0@ S0 0000 0 0 0 0  Q |؉M J@P0: SpGP ‰@`'q&O-`M@c;IqpP!Ap 10a1S 000`F0PmP pP zQdP x`JdP9:[A Lp@,0Z 0mJPk0 0_JPc 00.0 * R W0Z /0 0 U:VIp @T=MZ=JP U:@Ip!q&P-%'O-JM M@[c %;`R!XAp1 @DTS0 aS T  `LiP fP hP vP00`0` 0QDIpP0: S ! PP ~P 0Y/S / J>00$CP@T }0p/SX/\Pm0 S:L#p` p'q&A-`P@MbD4 0Y IP  H IP  H ~IP  H tIP  HPh$d3P0\3P P$P@3( 05P+( /P3( )P7( #P;( P?P ( PP( P IP8$@Ѝ(P (PP"^(0S (P(0S (P(0S (P(0S (Pq0S GP|!0S0S p T嗻`PLa @1R`ᅽPU 0E /R #6P(PU  00,0/00o,;0 0CS0 &P0$0v00S t}뛞0s00(?ꕜ(J(x&AP 0@>K;<q&hx&x&?O-MPqad;9`pXFP&m?p D6@X/,60S ЍfP WP! PP p `RP dP vP iP0p0 `rPxP pp0p0p$ppq [,1@ES +V8e  0P0SP$0`S 0S@ ㇭pP܄ ᶮPP40S | |@[*0/S /ZP0.S0S .S0SZ< 4 0 R  @ 50C SN0 0$S P Pa9 00$ @W9 0|0S $ ?RR00R0SV1 $ A9  0SX  ,P ᖯ 0!0 0C0~ FP 0S' *0S 5S 0S 0S'GP0 0] 0 0XX  PQE0SJQP D0S 0S= 0?S9 0S᛭IS 8 p00PU FP$0 S`0S;D*0: S RQ  S/o" R 0: SEP0S 6 P S F 0SF P 0S 0?S 0Sw K(q& F !*G-P@_07`p!=p 1 R1 p0C@P kIpP vP0p`EP*p0S VP /P 0S 0S EP0)p0S \]q&HK(`0@-TM 70 $ DFEPFE@GFU0E0T000D 0DP00qCS7͸P3 \P 30S S S" 30S!  R `#6 R H#!SRD30F 3! $3 003 3  26#20S! ( 2 20S 0S(002PU%B;2P@ 0@k%hB00CS00 Z 0 , <0S60016 R0S 10S<0PR<?0 01 10SO 10SK( h1T1PLD10S @10S T1 H1 t0S 060S j@ 1 jE01f"(0S0F0S 00r0S0S 00J@pP@lTo'Q(%(L(dL( U(xL(0L(,L(%%NX(l%h$L(2TC-@MP 5^52b@@0 S rp ᧹W"#<pC 0 L1 0:Pl7h DPT(Px DP<(88 DP${(T7 0DS 00S8 @0xL*0QD0@0 0Q%@0SV L &PQy!a0@S0 @q1CP `y@@L' )P 'P )P 0@0 00 =@L2L20@0 00 0 儺PL' -D0S lx eDPX'pd$0 y dUQ 'RU2 SU> QU040,   ,utPcPSP PPʲ;d @" nP tP0 aPP pU] [1lUT  ;  $h$ ?pX dЍ $4$ ?p3!t 88 ?p2/( 8g 8Y  HT@D-PP`p tg`TE`8 ?pP}P{<"X0BX!v C 0! &X 0  1 ?P Q !}t0P0{tTKE 0@SdD\D.&p08b08 p0PU 8  ' P P P0ZS B;.`V $ >% ttD0P`\\QP-Nq&NO~DND{DN|D(NO}DZOmOONOOx&yaratcidO--0`pOaM␯吏22242222322$ X/ 6pjL?"42`FS 20000b2_S R2SVV10 dbV% ``L0/p L+pP  ``L0/ppd2S P>PX0: S0d2232d2o``Sn}0 =gPpni0S f  zPRP3P/P@\ @WCTaߍ02.202*02(;`-&:P CGPh >rWw 3023,2 3(2U\2S(",2Q\2X" !14!8!teOehf(]fx&Ue7:P ⋟팃``00"l8,00!`0,"8? 0,! 0 `0("-8(7E9P s0$    0q?2S3 bV02@tS7@2S9P# ?| 0 0 0?\8@H9P D2!` V!0Tp2<<23Sa :2AS``b2S UB8$)0 }9PO }<{<0s r @Tm 04P(`CQښ. . a0C2,S!R. !$RU>"0m렭(xDwq&ȸ6xx&,w(P-(x&x%hwQw(GwJwxx(zd@p(xxedAxy>yzG-p@`㠁Q!/p$V】 0S 0S h``10pWA ȲP 8ò0S  彲pW$ZЍyPmPPP fP zE n0@ S0  0 0000000000`RV 0SPPEPEP 6XP-H(;~D~q&}]~O-H4MD$` 7P! 7P?60pD00PPP#.p4W00S 0S 0S )Pp3 a X( 0S006P h10S T+L(WPY430S ЍzPOPBP FPL ki"P0@*S 002 ᥭP2 埭P200㘒"0 0b Qi <00P2` ᅭP00 @~P00 0 c 5iPx s000o00l00i!0 mi1 P :1Fl100000P000L00I`!000D000@1p=0000070003P10S~PZP~U 0yP&`IF~hZ 5hZl(@h(՗q&\p(^P--0^agx%( O-@Mp@@O놱,ڬP5WpG101"vPlP+HP1 TPH 6p0` 0& D D0`Z ~  Sqp` s0S k5m@ P   $-p R 0S00!S0  4 00Q40 yP000S \ 0, PHPHjO00-S 0`0@0( 0P@`PЍ@}0 0<(P@000 R0Sk3<0 @ p#  hG B R-  0<0 @Q0<T #40 R   kQ Q@v0DKT$0p R" 1:E%KU0<0 iR BR0<0 BR0<00SU  R\" :J%FZ R  :O%A_$U@*DP Q@:IP1/-@xp $0S% T0@ [ 2 00S0UA$0St0S (00(0@`4P@ `$`(`$0S (,4TUT[D$$ DR @Ph 0 4#(,4 03/p V `p PO( &q&2F&&??P-La%@-44,$0$00 Ѝ%H(DO-@p8M -P`,@寮hF8 0⪮\`^ PpH Dp 8j,6 R, 0P T4p80P0\80pH X7EUIH吅d5|uuBhH%+p0)\5O005SO 15. , 0(0,00(00 0  ERPPP$VBAizS `SNS7 AS( CSt 0p0RtaC Q WS84$  A$ 4RD +K L J sO 05N W W3pM H $0%0!0 0 xs $0@S \EiI (3Wpph zS dkSLS`#m0C S[00 rTrRXmPH0SI0SO005SO LPK ( p (0S  0C#P ݿ@PD L@wp``p/<P 24P!< 0S!0L BB@{3/ 0\@ PpEPP 6P<PD1D+ C HR #0 p02l P 0" B @m00 0S0 pu%X(%^%(`%8%q&%% P-%:x%  *@:iniui m@-P \h@(`@-HH@<<,0400 Ѝ%((@-HH@<<,0400 Ѝ%( $(@-t@t h0(, (0H8@@04008Ѝ@4(%L G-`M2P~(`PxD2P1 p* P42X52@PH32@PR0 0 K0@O@ф 2 Hp HQ L2P C @  p1a 00 @ p 0 p@ `080<0@0D00P0 0 080$@P 7 80 HL@P@T@X@\@HP* H&000 0400,0@@,0( 00P_#p*PPUPT0PP 0/`ЍQ2i2n202:222(%T'('d&x&|(O-`pPH6MDF(` 0 0&;)p$6U K V0S`@@0VoP 0SЍuPfPFP RPZ 5g@P P0P 0 hf0#S P` $$0`0S  $$0`0SKP f0#S (yP $o$0(0S x $c$0(0S|00y0P ᫧P6q 6q 6 o6` @s0KSq00P0 C@Q 0cR pR bRJ nfJK[g0Y`[0J^00I?oP2000 U.Ux U,P 88 0,3/8 RPSX J@@00S_ /P| 0 0C?oR20SV X_00 0$ ,0$00S 0U00S 0 0S0P000010S1 0S 0P0 0  Q00s  h1000T,0 0080P0S& SR 0@0@0 #  R S /P(0s  /p=v00S X/ 0/-P-H4q&(234424T4W4k44{44&44O-@`'M M⨆V$@@@ &'p㌦/6p0PKlU00S 0C0 1U0 U!q SPPy YDP㬀H= .p`*"0S   eAP* a@P5P 00@50S $q@Y d%eXun@000@0000p P P P4 5P/  QP*pP P( d}p qRPXq/d00 000#0 00$00 0ZPP_`P'ݍ Ѝ( P(I@TPY 2y1 PP(!hP( ];_`PP p8ᡥ0PP 0(`p` q6RP 00 00$0 00PP_P ^P_P ^P PdqP PlP DgP!@jP0_PZ qP( ]Pp` fP( +L /ⰫPm``V":r0 0-p` d!d/P-0SH00 000$0 00 0P0@(p .p--ኣ0Pa0SJ(S'- 29S!S1X/0S (w[`P@\pc6(95q&d:5P-96r69X9:9C:(zd@P(edA p@-P@Gp@-P@Gp@-P@G$@-p@-P@Gp@-P@Gpp@-P@Gp0O-nM M800㌎`4P5P 0h~0 P TPL 0D~S$0Gp000,>,$00 000 r%p@9=> 0S=D$R$r R  $mBt $JЧ<$.}p|0A: x0@ <$0t(0J`-p T" <4 4*8< I30`PEB@D4T@@ 0 0<@P < $P  P <  p<$$r $|L P 8<$0 00 X 0 ?=}0(00 L0, 1;0@m b; ;$d0 00 0  h;V0!00 p0  0; H0(00 80*T :$:0!00 0  :(,0!00 0  :,0(00 0  P:0l:@<:0S zP00x: 000 ` !00 8 0 :0!00 0  :0!00 0  L940c 00 T0  ,: 0!00 0 ` u888̨@0S C.0, ;OP b,O P0@4 P@ 0 =a`8Ȩ@ PD40 PD40D4y  H 0P$0n P800 1 1 ($8C]7@TP00U7 000  UHL7 G: P×P/ ᾗP a0S 0T4000-00* PEU UY~ V  0. PpS 4S<4Y1 H4L$0 V:,pUm?HL4P80S $EnF?ỠFHdLV0.= 0 $?ᬠ`5VLHd04SH$L4R0 &*pP # V,p  4S@  N`P  =a  UPP;%UPPp%p aV+p (:: SD%H/ $R(m*@P%$4XpP%  e  P0H 0(0pWZc>$R $0@0p!$Tk = (,0ȡP,0 r0 4̡P ǡP$$@03m`Tk 40S0X44S.=0@+R$)SR- (8 # *~墡Pb0T40S嗡P `#00ST4Sd31↡P L3 50s (8`"" R H$L4\* pX```0 L4H$Ϡ2#!0 `p<2 C  G` 0- ;pn\j i0P0 8!  㸤dL$H?("f4S 0:0?V `0$$4RT SQ  V  0O)p0x `VS  S!0$Q\ +S0$0 Q$ Qg*0c(\ ]\Zq&s___P-]]x&]T]X]_]k]]]]]]]&^^'^D^T^a^%r^}^^^^^^(__G_a___(_`,`?`D`(h`T`````3avaaaabWb%bbbb]bccHL$ P,} P+P *+0$PsS0] 4S$ekP 44娀S04144 0S @4S 0 $L0@4,4S $4R#1ѣ1,40 000$0Uu (t (0S +xp@& PQ' 0 d|.;]P`E}M+ }P9X+-Q :$43041$4+fT4S, *d0 |.)(((\)\4$8: H4l4: x0<$+0@ 0!)pŤ|P Z +PP  <׆p  T<  ~$0+- 4)O-0pMI Mi4, ( pP_8`4pGs04WZ h2  .YaB 4S<44S $$4R0\X('p H hr)p 0 4 SP,0S x0$՝ t$W0 0M 0$ɝpW$ t1SD $$4P=*`N^ZU CUQh7DPEUPP bPEUUPP 6 ( 'p00( R0C0s0So p !^044s04d0 00 p0 6V0(00 8V0,`0@G H0 00  0 o70*00 +0c +0*00 +0W0!00  0K0c 00 |0 ?D50!00 L 02,00 1 1 &40(40S]00; `$Q0P0H$]hx(p 4S &PP$p$U`P#X  L(@pP@4(0(00`V Z<0 00np"#7$p = 0UP0 r0 4YP TP$#0?]3}p$p4S80S4l 1S !1B0"H 0S 8c0P "0b1p1   $$!0#\pX2   ]$ {p HP lb $ t$4嗂s'4S 0<-?X  e $tR $4'S  4%JX0; 4 $$ X  0&p0\X.X0:S Q4S  0  &&0S Z &^*!X0⫱X+H(nP-Xsq&ussh(uttn%nrrrrrrrrss%s6sssssM(sstt8ttt u&uouO-GM MP`h ؠ0t@$$Wp40PEPEUqi@@5P 3D0403003 3(3 _p0,0p0T3000D30804<3<#L  3D@ 3!.t8@|1Z 1@2TȌp Tpp̌ ňppPt  TY 0@ @ 1 0@T`Pb 0C S_0400000,00(00$00 0000000000 0000000 0Uf0p R= @@6)ĂW> (s8;p 00 L0#p8; 00 L0#pD8; 00 ,L0#pq8; 00 dL0}#pc 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;p+,,@⊝p L0P#PX;"0#10@00 0`K`QHD  `   ` 0+#PqK0S `` K0#Pd 0  00 45#P@Wd +0 TT(``\5d%\#P`|5|%|"㹝!2`(10kkkk,a0a4aU 0P````㠝<;SU">@˟ \z{ A k:L:۟S"@ o\Vz{ A k9I:`"2Rgd@' { d30S 0 ' L N@^IN2 X0弅A!pV00 妏@+P@0W0 00Dh'@X2 ppW T p (2^"PL0"0:CS0LU"`\pjL1堋{8 {'NjCAZAGޚ@8țINT{({*X PU7 W0S3 <i0xT0T000p+t pP B0S , "t;<000[ W0 0 |* m'd2"SS% 0 " $@-C6?8~A@@)l)hx&-))7w)x&Ó`)0%< `G1 PS& 2R`嶐@pMYTT0R?L0 d0 0 d20 !  s  `000hl0+?ph{{7{{{|3{{ {  M@ )*3h2 00h232@0d@Wp | *<0 0H 0@02 0BS= (SE; ? 0;&p@0S<h2!0@0Css0S0 0 0@ s04r & 0 @m 2币  0h 0S h ;    0;& 0W |)<0 0H 0@0p0V 01 JxP<0[9W 0 0RZW |s)d<0 0H 0@0T 0 0D lH>&p0WpH5&@2&p `)0%c>)hx&)Δє ֔0M$ 0CS0 0 P \0Q.0 p& x|%0䋟p@0|xtplhd`\0 Pb <0 PY 3Q0 %!%0 kP;  %0 [P* %0 QPd 0 HP Q Q ,(x$v 0 6P x0 ,P 0 #P 0 P 0 P 0 Pd 0 P @0 P 1% 09 50Sj CS^ S W |>(/<0 0H 0@0p%Hrѕ8Rd,ۖ)D\uŗ)>Qck)y~SIZ0KWI7L$DD[D0J0ZD0 0I) 0K J0KX " QJY0KWD01ʸ+Y wP WD0 $D0J C <帛MWT$pDDD0I0YD0  0J#1 KJ{$ Ws$O-M`P@0-S@LP- @3 pȣ#Fp*30SP a`F0P[:Z PQ9 JKP9 H T8P@ 3 C d0@S  Lp@20S_K@HGG 0w 0$!X dSY'K`PP`8b2 R  0 S ~ yU+ 0 !0!00W p4 ,pP0S㏀W㊀` p>0S4P p00@@ 0xLS Vhb`* q&!.@mSz͙֙O-PAM Mʦ@`6P&0P0V00-S' @M P ᢒG 0P0 S@0p0I\[00 `F0S0`@DDA@Du%p ,0S@bLpP53 Q # b P -00  `@[-00  D0B5S0  b00S RPR0 0꼄 4P R0000x4 |4 0S d|R L4 00 8S#P   300S Pm0$0h0(0e0,0bt0C?o#2p R0S0$0P㨗t㥗P㠗X=iy0Hz! a @DT43a00@`FrS= RS iS1 tS xS 㨢в+ 0p 0@00@00S  0Y}0S X 8< Q (0 B b/S CD$ B(0S  0`ERL0S (0S |1 00tX S @ (0S ( 0`\v  sAh Pp+ 0 p<PUU*ܙP- 8+ZP%wʜq&@x&@\%rXhx&J\-(O-PLM'P0N0n(.Yp>8,# PER a0:  @@0SC4QvPcPSP TP LP d0@S0 0D003030800H00 30$30(30,30<00",00@)0,0p  qW3S(G )P @ P< P /P LЍOJ3S C00 p, 0 4  8 < @  0RWS[Z0DSPQp! 100gS @-{D EY0`,  aR @L0Z S jP0-S0 @ 3R:  "0 0: ` P0 0|:0 0h:43043{0830<3@30@3ppzzyyx||{U ,0U ,0U ,0U ,0U ,0 0 0U ,0xL00L0U ,U S S0X0X(0CS0 0 PD#8 D#<#  P Q0P0083 00b0,X0$X 0X@0X0 X0X0,0  ),0 !=9P嘐PdH0S7 009@PH0SX'B0- ,0SSX p43 S80P3/aUF cU2 gU0BP%03S_0Sa 00gS# H0S |&Z` 0  d[0Sa PUpWpUpWX 0S00j"F , 0 4 8 < @ D ULЍ0000H3P0P xH30娐PړD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0T ,0 R  B   0z< Q $0Q P0 00 R  B   0z< Q $0Q P0 40 R  B   0z< Q $0Q P0 80 R  B   0z< Q $0Qp P0 @0 R  B   0}z< Q $0Q^ P0  <0 R  B   0ez< Q $0QL P<0PESZ $3S0S FD0S] @p907S  q00&c;sr<  R  d  v      Ul=P0S 0S 0S  Q 0   ypqPU 8 30(#0<  { H'+q&",%'+'+'+'+'+'+'+'+98o'+R[h'+`(+F '8EdnG-PXMp1PHh 6  ~MDP b0@SS0 t80 6d(pX80U 20$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R 4&R <&R 06lShyQaD PA07=CP  P W0S  fP 0000哌P6T&0 IXDPP061 (VU wpX0+Sp@(86 000w<00 0/15T& P 0p00 :XIP00G00Xp6 h5@P 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#05qp(4 0P 0PQT3HLۋJZp=V Wx`2o`F#P0 0SU030#:U 5%$Pm+P pB=* XP&T6K/r0h43PvTS0 0 S6# G@ y SPEX!EK/r0QPy 0 0<6Sr46Sr 06rS 0GpT2R01 x"6S 4P W0`W  0)P x,6S m/X,`P b=`Q0Q j"fxD<6S46S^E`^E`@6D&SH1 0 00R8!P H& R$!$Q $&R! 8&R0&@PR  Q   @6 ; @ E5@-+vP-q&p3+.+.+u&x&%U@P83+ >>A-P`pI䁟HM!; p10PEU HP h0@ S S HHIIp1岱h1X1 T1 pa 8P (1`   adPP J L`$@@Ԁ`(` `C 1VP P0S PxW $NP XJ0 0000 Nq&P-@%94+yt Ct 0G-pHM`0.BR" p 2B1 pGS 1S 0$  !RS@# P+PTP<$xJxP`PAP MP !a0@S0 00 04044041P100101@30@3101101101101ДY 000 0$HЍP PP  #J0S  '0 J`PZJPW a W 'pGW R $Sw ,0< sW p\4+q&H%P-]`4+hx&C-Mp`ᒏPPEUy% p5U@U`F V/@T xΊP hɊP ,aP tP,5 R ,0%  PV 0S A@D t,Pk`VD _ [tP@PA@3P zP0S<0S000S00S00S00S00S 000#l pPU 3 `V= V30SU7 0S4000000S@0000000 0 3ѯ 0Sr<0Sm00Sh2!P0$0:]0S 0SW`V UUQp P `P dPB UB U UR<2PEUNPP UH Q PA H U2 @U U60000  -- U+CPJ 0000 0 -P  + +$0S n- b+ p+qpݨ*f@T Ө 0r"600"$0$P @ဉP t{Pd09+q&&P-x&P7  bC-@PpMa M!Y p10S QฑPE R ލ ЍRP fP74p/5P` &HWOJ\P1 JP/0: S2  S)J /P0 JN@n` 04S00`dʍ0S ~phtJ /PJ /@PJ0 @X9+q&O-4MGMM z0P+0 <[@P MP ;T(X x[@\0P\+TX8T H;P  0S,;0+, Kh8S <PU hXJʄP@ 5OoB:pp:*:(8pp2P `ZT`h`Pdhmd:xJ 0pP0 `* p`W0 J ET,* 0 W0C 00܌10 l>  \v8P`T0>0 XPA0P- S)0 _P\9Tr P 49h(iP 9T(X(_Z⺇P 8h(^40FDS00  8( 8X(T( |8,8 B8P 00S| h8l ~F(8, ,, ,o 8,k 7H(g7l 86m)m^ 7L(Zg+qw PS:?@  0 x7P(H7hgmpVP78=l7 87<(8 (7T( X(2@7 7P 00S% 7$  6t(6 6P 00S 6 6p l`E w68`l`F080 P 0S46EB `V 8<p ]+k 5, 5L(5l0P0 p5`(d( \5eiH5P ? |5?Qt(]]GލЍP5T H+0D4<  (] ` ]U ]V ]   ]W ] rq/\=  \Y܂Z \>hti`hf``c`T``H]` 0S0SA   M@288S2@Px |b<S P 0S k kD2 kN @+v P:B?l |D081<Sa\+Tu P*`㑊0:zP 0iP TL@P`&_ _]U&@P_ _0@`zPP0@P`ep@+u0(@0@000pUp,`40U0 (P<P8l,(PR00S ,R  \0,0S \k,8S=G q,8S $ `+x&hx& q&P-8&3ai+HOx&QdL-+0 D :2m+ T A-P`Y(AE:h=KP03vp2S l P1DUy?~PO p 9P/P00@˜7' s\evP3038$ p,40pEWQU 4 000`ዃP C,uPE0S3 4# 3PLIFCwPpC`p\ TPcPH304}< {4S ,SzP  Cn P 4SsRzPn l & PpR},p`bG1/΅<01 1> 110101$1y   ݈#2R CzCmp`a P^ Q1s0S zpo`|q>yp  lQ00S zp P *`3P?o20S R=?o20 P P lHz1s0S 0 S tS 0Ryp  \y=`S 0 0000 l"z1s0S v`#{d0p!,.))1)E)X)q&&d)$,)$@ ))hx&)d &(p &))|",", )&(@-@`ᙈPP p1 lqd!pX10SAH81P@ 㗁 1*$qσP  ʃP 0 nPbP 9P0P x  c0@ S0 VP ij 00@0 P0  @0  00 "墁0Se1(,-1q&g1w1x&1 &A-`4C0P@00$ 01P0 0rP00y|9oЅ뾴sDK厩_P0r0a0"SBP <U 0+0C0SPP \p8:PPE ΠP 0SƠP10忠ڠP1 0Q PU 0SǤP̢㼤?PEh10S \10LB$DQ 0S(1(P#P-㋂8PJqp 000000S }l뼘{PP`0S PPp00S80(,11\d,11122 22"2(,4e,92d,h2&c2e2d,j,2,e,d,O-`pPLB%D_@`4"p(2 0 qQ 9pPpGeAfuP`P GP IP EP 0 %&a0@S 0000 JP-q&;9>@JQX0O-@xM0p5p%@l5P@d5b \5p@4P5b/元@E@eX00%`5(%(E5$%$50`0~|P`%* P P @omPD DP4 fPğ5 CP6  pP8 rPt$p<I`(~ P00: S0S00',tPP( pyP 00SW p3 3 CK3`3prW*pP  JxSNeOe0@ K9kPPD ,P [ 㼃 㹃㶃*VRy 0@00{P@xUP@`Q l,V ((P,@44`(PV,@0,@dB( (P404`V(P,@((P,@4`XV(`P# 0 0S0 0 0 0 0 p ; mW-ig`@P  0I00S1"O1~P*Z L0Q Qv#sWH 0 Ѝ;9pH,,' ,,,,,% ,,,,p,' x&' P-' 1) <) R) ,,' L,e) $-,v) Y |] Y ,) \ ) ,,,O-poM!0 @U 8@0 @$p`S4 W[Y~ pP 0  FP(0: S) 0T0[0Sf Y X{P%@PD  P !z z&PP]g@Pq t4pVaVb`FV` zV" !0 l 0` 00 0<3 1 $ 0y300u@s pT 0!0 02QX 000Ḑss` pP0; 0P* %Pt%f`Ph!!C A@ Y !0<1/"0<P <$ ɔ  P"   PY0S 㵔 xP0S 㬔\0 0/X0 Pp0 P0  Q   S  R#4sp V`P0S T w 㧁 U @p S-d} } q&} } ~ ~ "~ F~ P~ P-} } hx&ht@v~ ~ ~ ~ ^~ g~ h~ ~ 0O-PMp00@}P? }P ?M /" AFߍ(@).ᄀ>X?PX1P?/01012 211R"T122bp,[p%Tp^&[0n0d10 .0>.pZ90|n0C 0 0R080 ChN0 l10 B1!1pqι0 hPPZg0Z m 0R- = 00+G 0 80 0YSVPMP 6P@ ?P7 4Ptp=N@P fP j@PD=P 0=0X1h=)hVP0V30 [0000z00u 偛Po㔼l㌼i 0pP 0PH h0$Qa8 a0 Rj0 ڶPP  0p۵۽ G84'000`1ZΗp @ g1S;P ,;ecr_r:0P U0@ @ Tp 0 $)pA@( P0Q819:d!*`1 xjp Ҧ$PL 5   8:8@Ȥp, D&`11`V zPp)YGB Y9+  0. d1 ᱚmp;8)p╦?寤pP \X 0S` ( _PQ 0S  Zo F0080x8"/0  3    2s<8"/0 %  2sc!"# p B 0<" 'P$* F 00 7@ģp 138᝙2 7@寣寤P@ z@ w t7 @Ip0S 0HX0S0S 0 Q  8 0 +z}p{0S &BAҥopm0S t&OBAĥaP q HS@⹥c 4_,呥͘0 T S 0⊩p) cp% P x0$A>0 0T1 5T@ҡptDA⌥p$0 T1_p mcp\z$POp Kp,k@T 5@妡pA X000-!0@00 P  {@ 0 30 ẕpt@ F#\ XP$# H43ȥpI  ᳗+p 3@VpTA!R`14`11ZP0@!צP0!t00!R00SRd18r(`1Z  R! Q01Y<(p æ `1 1Y4180; X >< 49000Ҙῳ1PU| 0S 1P#P 0S  嗙 0S p R080SX  R   L1p0 S   0`Va7Ĉ pa& V h q& H P-L ˈ C Q  4 8 @4 J \   Ǎ x$ TC Y v ؎    $ D T t Џ  O hx&0@0@ L딤hX8oT0   Q/0p@-x@0Ppp@ P T0<p@ 0 0$010 4E t( /O-1bM!0Mb  [ !1 b0  0 30_bݍЍ  0  "\ ,{`  $;(0(0 +Pp0G  80G( Gcpn x8_S  000 00 0 PЀ @G 0  OxP x8##[`@* DxP0 l8 40G 4PU P0l8  40G&P%%pD @D $@B$0ƒ S$*0@- R P@ 0\ R^ H00"@ 800 0^ 00"@0/D#,##@-M ~ k GЍ8h  0S/ -PM00 0I p 0 S 0 0 Ѝ8;: /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/~*/{*/x*/cu*/2r*/o*/l*/9i*/f*/c*/8`*/]*/Z*/W*/T*/ Q*/N*/K*/0H*/QE*/B*/)?*/{<*/|9*/#6*/)3*/=0*/-*/**/"'*/$*/!*/*/*/////^*/*/ */< */*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/ */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/\*/ Y*/V*/S*/P*/M*/J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@z@*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: ܗ?DpHQX`f(i,ipkmm Dr sy<{<{"`'x-x3=4CJxPUȲ`iXmv{$ĘDΘlژx8%|#+|24;=0>D8ALGSIWW[W^ ]c ]i ]p^u^zb~(e jlrXxD  %s%s: %s not compiled in catchmodcpdddfedlnlsmkdirmvpaxtarpwdrmrmdirsh-shsttysyncchownchgrpdisklabeldkctldrvctlfdiskfsckfsck_msdosfsck_ffsgptifconfiginitmknodmountmount_cd9660mount_ext2fsmount_ffsmount_kernfsmount_msdosmount_nfsmount_tmpfsnewfsmount_mfsnewfs_ext2fsnewfs_msdospingreboothaltrestorerrestorerouteshutdownslattachsysctlswapctlumountftptipcugzipgzcatgunziplessmoresedtsetchrootsysinstprogressdhcpcd// //////////"'+stdin-%s: not a regular file%sstdoutmalloc, using %zu bufferrfrUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s 16!**33Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_open%s: %s%sfts_readreference $(*,. HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s is not a directory%s: %s%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLENpushdne/usr/src/bin/cp/cp.cdnesp >= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %sסdڡ(ޡL@@@@   t@@8%t@@*%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdinԎȎgdWfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of inputllll%,l2llllll8lllllllllll l"(/ll5ll;%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\TTT(IT@TTTI(1TITTT1sETw#Fm%c9wNcinvalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.BD69`hn<|AJ.O? [SV"ekqty2'%s: %s%u-%lld%llu%d%s: directory causes a cycle %s: %s: fts_readusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS/%s%s/%s ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long3Rg-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s!4&4,4411Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing 999999999999999999999999999999999999999999999999999f9999np999999p999999999999$9'+-/91AOQSYQ[]_9c @@@@@@@@@@@@@@$'@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@"'+0@5:A@lnuz@ Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appending2 )  AUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory "33"eVeee/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdout+LLL<LLusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sfts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found 5$+iEM=aO]Varithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expression8A3>DN#+T QIarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %sffffikfXZfffffff\fff^f`fb-n-ewrite error%s: : %s   " ",;OcEtZ# _^F<>?$error %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long@NI$2Vkks{%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss G   048%s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string %s is a shell keyword is an alias (multiline)... for: is : %s is a shell function is a shell builtin is a special shell builtin : not found usjQ?>TTTT7goujjW-EHOME :]./%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier%lldnull or %s %.*s: parameter %snot set%d%zunot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misused$4ad;AD:ZZP'/]}64/dev/ttysh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes%ld [%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d %ld[%d] %ld /dev/nullCan't open %slpZ%smore than one -p unsupportednp:invalid name: -p '%s'%s readonly%dYou have stopped jobs. ${#${"(()(...)$(...)">>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error tfd&s,c5m<lJQr Yapksnv b HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%7:/\ (8nYShjrltEEEEEEEEEEH66I8%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpected $+29>FNTY`dhov%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: \Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"7c/gkkPipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)@@%d: +%s%s-%s, +%#x insufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error %d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATIONY(0CX(1KX(1Q4Y(8[pY(0i\Y(0HY(0 Y(0(|Y(0PS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1>>0>&*->>>7;W[_cccc $/:EN%% %s: out of range'%s': bad numberXZ \^ `bdfhjl npr tv x z|~ !!=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unset   , D `44{#l)D/4<6$commandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexp(t=XȜȜ4QR~''>IL$l+,/f4;L@LB<GLXnSTkYaJfH&#$%dPPIDIFS1OPTINDPSc20220122 BUILD:20260420030351Z SMALL REJECT_NULSNETBSD_SHELLLINENO %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4incomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failed      option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOP;`%?8'F%K%S%Z$^%i%q &x&'$'&'$('%%'''illegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedttyCGKOS#Z3b#h3o2t3z3# @@ @#(.5; C$CC$C$-7<BKQW^fpw~@@  @  @litout-litouttabs-tabsopostonlcrocrnloxtabsonocronlretcrt-crtnewcrt-newcrtkerninfo-kerninfoechoechoecrterasecrtbsechokechokecrtkillaltweraseiextenechonlechoctlctlechoechoprtprteraseisigicanonnoflshtostopflushopendinnokerninfodecctlq-decctlqignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonflowixofftandemixanyimaxbelcs5cs6cs7cs8parity-parityevenp-evenpoddp-oddppass8-pass8cstopbcreadparenbparoddhupclhupclocalcrtsctsmdmbufcdtrcts%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8s usage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZ====0==0=9owner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreferencexxx#xxxxxxx/"&),FBXi|~DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %s555@4@5@5@5@5@5@5@5@5@5@4 @6@ 6@6@6@55!6&6,636;6A6m5G6N6T6[6e6m6t6{666@6@666666656666666677777$744,7%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%sattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:or3*3:3k3|33333344/4:4Z4]4%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=-+8/848<8A8F8L8R8X8_87f8j87p8777s8y8|88%s:unknown%u:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:37:7?7I7S7\7c7r7y77-77777777777777777777 88'8t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO44444444444444444445 555#5*535<5E5N5Y5b5m5r5y5~5555555/tmp//usr/bin/viMACHINEMACHINE_ARCH%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd %s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:LAAAB BBBB B&B-BA4B8BA>BAAAABGBJBPBDisk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>@AAAA"A)A8A?AEALATAYAaAfAkAoAxAAAAAAAAAAAAAAAAAFilesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdD[D[[V[D[[M[[[[D# %s: EFFFFFFFFFF'FFF"FF+FUF9FFFFFtype: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u EEEEEEEEEEEEEEFF FFF"F'F+F/F9F?FCFKFOFUFYFdFsFFF%10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. LLL%s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'147:'@*TMP-1  ,%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrNested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootableXlhhhhhh i3i i i i i j%jkZk vk!k#k$k&k1k2k3k4k5k6k8k9k9k:k;k<l=4l@ClAWlBlClDlElFmGmHmJ'mLDmMUmN\mOlmP|mQmRmSmTmUmVmWn\ na%nc/ndjnenfngnhninpnqksktkunvkwnxnooAo`omoooooop p8pUpmppppppqq/qKqeqkqqqqqqqqqq r r/rBrMrkkkkWrorrrrrrrrss-sOsOsOshssssssst3tNtjtrtttttuDuoukkuuuuu vkvMvknvvvvvvw%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table ;]`rorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypezYwzzzYwzzzzzz{{{"{){1{6{>{C{H{L{U{`{e{j{n{r{|{{{{{{{{{{{vfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%s Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block go!@GJ]cjsv|usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) XX))_*w_ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORY3:CCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entry   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblock||||        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%d DUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d a:i:s:b:l:t:[0%@index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:5 %No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec];$%AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]=(%@@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x),BL{Unrecognized attribute `%s'%s%10.10s %s , [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %ju (%s)primarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tablebiosbootLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to function d,%Media SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector%d- Media GUID: %s - Number of GPT Entries: %u headerKKKEKKlabel changed-rCan't open `%s'Can't copy stringCan't label from `%s'ab:i:L:s:t:f:l:$`e0%@label-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored~bogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrGF+++!+=++V++Ogpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: T\P8Xd $ Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameter*  "Unknown FreeBSD partition (%d)*%u*@GLV`ip ,<Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %s!(v8%@Afp:sNo MBR in disk to convert@Iex j    .3Re7 S!c#c$l&c1c2t3c4c56c899:;<=@ A4BpCDEFGHJL!M2N9OIPYQkRSTUVW\ac dGeif}ghipqcsctcuvcwx=J_n2Jd (BHaaa cccc*BTm""";Zy!=EwBccv{c cAdwMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sL{<%@Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremoved }@%@ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]~H%@a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]0(L%@s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] wP% a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l.!(*,Iy %%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)en_GB.UTF-8 (active)UnusedExtended MBR%d - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s Could not find index %dDetails for index %d: StartSizeunknownType: %s (%s) Attributes: None()start %*ssize index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ],\%gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed C`%@ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l <l% a:b:i:lunset-a attribute -i index-a attribute -b startsec-lSFH0eC쬏SFU0eC쬟Hah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+|nQn- q+ |nQn- q+(|nQn- q+6:=rGy=iG}>I;Mt?T_mWC 3KOOjuyD<#*=(YbBRuoqr3Dh&Dz\ M}-@Mjy֬-чH-чH*.ZIчHHLIчH_cIчHns2IчHL6 %?aS'@ )Ѹ*1@ )Ѹ1x )ѸST.qBHo6֯i %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBLSx%@UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]-e%o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdin`%@Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeWet[%+-/EXXXXXXXXifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s  linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroyzi@%yialiasdeletetrailers-linkstrdescription-descr-descriptionxxx%m,%~xx% %$ %P%@x%%%\%%w%%%%broadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6(4@ LXd@p| 0@arpdebugunnumberedlink0link1link2x|  @getifnameinitmediaSIOCGIFMEDIAinit_current_media%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULLsetmediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediaoptsetmediaoptmediasetmediasubtypemediainstrcsetmediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA,%s mode %s%s%s instance %d G+  6 = D \K , + D   D `P X @P X + D 6 = media_status%s: getsock%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s (unknown supported %s media: media mediaopt media_constructormedia keywordsinstanceanymediainst-mediaoptl%l%lld%WW%El%@@%no carrierno networkbackupmasteractivedownno ringinserted1+ 0af,%u.%u%npaddr_match%s: prefixlen_to_mask(%d, %ld)%s: prop_data_create_copy%s: prop_dictionary_setunknown keyword type %dH, <tunsrctundstsettunnel%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] ???0 tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnel!%!0%bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanif#%$#%&$$ .$VLAN tag(ELGnpTVnnnnnnnnnXnnnnnnnnnnnnnnnZ\^`bdfhjlNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ specnfscan't get net id for host "%s": %s $rhw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'Y YY"Y%Y(Y-Y6Y:Y?YDYKY QYXY `YeYqY@yYYgetmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled. 2 0 #:NSao}A*LZo%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).*cQcccc)dddddd&e:eZeeeeef8fXffffg+gPgusage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsbeleWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableappleufsApple UFS%s partition type is not `%s'ffs4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatime rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead./+-$ '5GIUamz%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s  #'+3;CKSW_goy%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @BCFILNOSa0b@cKe_fqhiĀkЀmހnor su/ -%c %s offsetcreate sizevolume IDbytes/sectorsectors/FATblock sizesectors/clusterdirectory entriesdrive headsinfo sectorbackup sectormedia descriptornumber of FATshidden sectorsreserved sectorsfile system sizeCan't parse timestamp `%s'sectors/track@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:/dev/%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyOEM stringBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per trackunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: no default %s%s: illegal %ss%#x%uCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file size%sgetmntinfo/dev/%s is mounted on %swarning, %s is not a character devicecannot seek to %jdu@@y@h }pp pp ` @  $%s: unknown standard formatCan't get disk size for `%s'bytes/sectorsectors/trackdrive heads"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880bj #'@PSVgmp] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%s?<0&),080I0Z]0`usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure       &A]uB*O$command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue5/ f|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c )+S QJNunallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s OOO»OOOǻOOOCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxy %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"prefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood t8`Fn%s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspec       " % ( +8/& Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???PFPF0* XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip ~W  " "&%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/Wg`s}``````+5`HMc}````` ``#+`CJ`im`````+`F`]`uz``ȾȾ````regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor !&ADGINPSV]bg9?KhKKK2usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c( S u 421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection2?\x "*.;MQag|usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)HJNRVZ^ ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiB@[Token in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend break9>plEt9VxUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forka'1HBHHHPaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhf AT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x),:EMT]eit| malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory 0000000)<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0.invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bCH @j18RnMHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEkkk=kkkk>ddddddd+1YMX]G;btH'2;z?5 'ug PD]o!by9GJ]/6ePQWDbQPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYATl ATl pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file2&*.)/35;!#%'+-1%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s 2"$&(*, " $ & log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %s1!4\VValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGSޢ`ߢ%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty   vm A\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'$*-5?Br setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %s5}}}}}}=}}Zf}}}}}K}g}}}}}}}}}}}}}}}}J}}Tam}}r}/}W}}}r%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu  . 'malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknown &26:usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-i #&/)  #&- ),/ $     #3( &" msdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. ) ) ) ) ,) ) ,) ) ,) ) ,* * p,* %* o,6* >* n,[* f* ,* * ,* * m,* ) ,* ) ,* ) ,* * ,* ,* * ,* ) P,* + , + ) ,+ '+ ,3+ @+ ,E+ @+ ,V+ _+ ,n+ |+ ,+ + ,+ + ,+ * ,+ ) ,+ ) ,+ _+ ,+ |+ ,, ) ,, , ,0, * ,<, ) ,H, ) ,r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certs1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.5machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy%s/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed /dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula. E7 . q7 %s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5h5 :7 ?7 ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptunFuT?????RE%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalid? < ? ? ? ? ? ? ? ? ? ? ? @ @ @ @ @ '@ ,@ 1@ 5@ 9@ C@ I@ M@ U@ Y@ _@ c@ n@ }@ @ @ a%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF : : : ? : /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc/netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugdebug32xdebug!,aN hN mN wN N N N N N N N N N N N N N N N N N N N O O O O O #O 'O 2O AO MO ]O   %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s ( O dV    0% `& < < 1L e8 u( %zu%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES /bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal errorY Y Y Y Y Y Y Y Z Z Z Z Z &Z +Z 0Z 4Z =Z HZ MZ RZ VZ ZZ dZ jZ nZ vZ zZ Z Z Z Z Z Z /dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijzs P `~ z lw 8 |x { w w ~ p | Hz r Ly  $  r r l Xx @x w | xw disklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSX hj `y %7%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0rD%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default " %2RAHXblv%/9#AJPV\bhai9258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_newq 8ih srsqqh``b`hhgtH\,_\c[\ xvzzPl0{@^\DX]H]]\out of memoryp p q q q q q q q q Fq tq q q q r q !q -a r r r %r 0r :r ,gpt %s %s -b %llu %sp p p p p p p p p q q q q q q #q 'q 0q 7q gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredSFH0eCMu Su SFU0eC]u gu Hah!IdontNeedEFIqu vu (s*K>;u u |nQn- q+u u |nQn- q+u u |nQn- q+u u |nQn- q+u u |nQn- q+u u =rGy=iG}u v ;Mt?v v mWC 3KOO(v 3v yD<#*=(>v Hv YbBRuoqrRv av 3Dh&pv xv \ M}-v v @Mjy֬v v -чHv v -чHv v ZIчHw w IчHw !w IчH,w 1w 2IчHLw Qw L6 %?a]w bw S'@ )Ѹow vw *1@ )Ѹw w 1x )Ѹw w ST.qBHo6֯iw w %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/x| | | | | | | | | A| | }  } } *} =} K} %u%s (%u)falsembr_get_generic_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_newX h| \| X4hhXĊTtD h 4 رD4,%s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition!usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s  ` d h l p t %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP] ` e %s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init QW\{22*\222.4jn22v282=Iy2/E3rw|2? t-27<Qf{splitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentĢ bϢ c֢ dܢ e f g h i j k l m n o$ p/ q r5 s< D t uL Q Δ vW w^ xc zs yz A B C D E F G Hl I Jƣ Kͣ L֣ Mޣ N O P Q S T U V" W, X6 ZE 1M 4V 6_ i |z ~ }  ͤ Ҥ ٤ ޤ        $ -   5 = G T ^ m r y     ̥ ե   % 1 option requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:strslen >= len + 1alloc_args/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULLxaxa^^(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_free&ctx->froutes != rtsrt_headclear0rt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deleted__rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_delete^^sa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULL   % ) 3 < G O T \ - %s %s_%s*(bufp + 1) != '\0'script_buftoenv/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%s  protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK) ú ɺ ͺ Һ ֺ ݺ ifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s   # , %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %s8 A G O W  s  [ BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa tcrer/etc/group: : :r/etc/master.passwdOOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- 0000: (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc00VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory . pS" S( S. S4 S: T@ 0TF PTL pTR TX T^ Talnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~t &x         @ 0N"L"J"ASCIIcs_pathh X  bc_base_max  bc_dim_max  bc_scale_max  bc_string_max  coll_weights_max  expr_nest_max   line_max   re_dup_max   posix2_version    posix2_c_bind   posix2_c_dev   posix2_char_term  posix2_fort_dev  posix2_fort_run  posix2_localedef  posix2_sw_dev  posix2_upe  stream_max  tzname_max  atexit_max /usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m (%s)aaaaae%JaaaaaaT[ T] ] ^ @_ _ ` ,a a tb c c `d[:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d pi  S7gb8"u lt$$ januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDҵ;15MS7) q:e%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n20QKGC?:64*(++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQvQvQQQ,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K6Dzg Tr_I" 6A.o\vI16Dzg Tr_I" 6A.o\vI1" acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0/5J+-t}`o;n Punknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatch`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @invalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger/852array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist