'Vg?V0ONetBSD/earmv6hfeb ramdisk 08g?V<  g?VB_t tg?V@@<@T 08g?V<  g?VB_t tg?V@@<@T Ug?Vt`Ag?Vg?Vg?V$ hg?Vg?Vg?VAg?Vg?Vg?VvA.g?Vg?Vg?VX`hAg?Vg?Vg?VwAg?Vg?Vg?VoAg?Vg?Vg?VwAg?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?VmD!g?Vg?Vg?V (08@HPX`hpx$g?Vg?Vg?V(08@HPX`hpN$)g?Vg?Vg?VxK$(g?Vg?Vg?VM$Cg?Vg?Vg?V (08@HPFAg?Vg?Vg?VCg?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?V!g?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V!g?Vg?Vg?V4!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V B!g?Vg?Vg?V B!g?Vg?Vg?V!g?Vg?Vg?V"!g?Vg?Vg?V"!g?Vg?Vg?V"ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V\?!g?Vg?Vg?V\>!g?Vg?Vg?V\=!g?Vg?Vg?V\<!g?Vg?Vg?V\;!g?Vg?Vg?V\:!g?Vg?Vg?V\9!g?Vg?Vg?V\8!g?Vg?Vg?V\?!g?Vg?Vg?V\>!g?Vg?Vg?V\=!g?Vg?Vg?V\<!g?Vg?Vg?V\;!g?Vg?Vg?V\:!g?Vg?Vg?V\9!g?Vg?Vg?V\8!g?Vg?Vg?V\:!g?Vg?Vg?V\7!g?Vg?Vg?V\6!g?Vg?Vg?V\5!g?Vg?Vg?V\4!g?Vg?Vg?V\3!g?Vg?Vg?V\2!g?Vg?Vg?V\1!g?Vg?Vg?V\0!g?Vg?Vg?V\7!g?Vg?Vg?V\6!g?Vg?Vg?V\5!g?Vg?Vg?V\4!g?Vg?Vg?V\3!g?Vg?Vg?V\2!g?Vg?Vg?V\1!g?Vg?Vg?V\0!g?Vg?Vg?V\2!g?Vg?Vg?V\/!g?Vg?Vg?V\.!g?Vg?Vg?V\-!g?Vg?Vg?V\,!g?Vg?Vg?V\+!g?Vg?Vg?V\*!g?Vg?Vg?V\)!g?Vg?Vg?V\(!g?Vg?Vg?V\/!g?Vg?Vg?V\.!g?Vg?Vg?V\-!g?Vg?Vg?V\,!g?Vg?Vg?V\+!g?Vg?Vg?V\*!g?Vg?Vg?V\)!g?Vg?Vg?V\(!g?Vg?Vg?V\*!g?Vg?Vg?V\'!g?Vg?Vg?V\&!g?Vg?Vg?V\%!g?Vg?Vg?V\$!g?Vg?Vg?V\#!g?Vg?Vg?V\"!g?Vg?Vg?V\!!g?Vg?Vg?V\ !g?Vg?Vg?V\'!g?Vg?Vg?V\&!g?Vg?Vg?V\%!g?Vg?Vg?V\$!g?Vg?Vg?V\#!g?Vg?Vg?V\"!g?Vg?Vg?V\!!g?Vg?Vg?V\ !g?Vg?Vg?V\"!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\ !g?Vg?Vg?V\ !g?Vg?Vg?V\ !g?Vg?Vg?V\ !g?Vg?Vg?V\ !g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\ !g?Vg?Vg?V\ !g?Vg?Vg?V\ !g?Vg?Vg?V\ !g?Vg?Vg?V\ !g?Vg?Vg?V\!g?Vg?Vg?V\ !g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V\!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!$g?Vg?Vg?V4!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V !g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V\?ag?Vg?Vg?V\>ag?Vg?Vg?V\=ag?Vg?Vg?V\<ag?Vg?Vg?V\;ag?Vg?Vg?V\:ag?Vg?Vg?V\9ag?Vg?Vg?V\8ag?Vg?Vg?V\?ag?Vg?Vg?V\>ag?Vg?Vg?V\=ag?Vg?Vg?V\<ag?Vg?Vg?V\;ag?Vg?Vg?V\:ag?Vg?Vg?V\9ag?Vg?Vg?V\8ag?Vg?Vg?V\:ag?Vg?Vg?V\7ag?Vg?Vg?V\6ag?Vg?Vg?V\5ag?Vg?Vg?V\4ag?Vg?Vg?V\3ag?Vg?Vg?V\2ag?Vg?Vg?V\1ag?Vg?Vg?V\0ag?Vg?Vg?V\7ag?Vg?Vg?V\6ag?Vg?Vg?V\5ag?Vg?Vg?V\4ag?Vg?Vg?V\3ag?Vg?Vg?V\2ag?Vg?Vg?V\1ag?Vg?Vg?V\0ag?Vg?Vg?V\2ag?Vg?Vg?V\/ag?Vg?Vg?V\.ag?Vg?Vg?V\-ag?Vg?Vg?V\,ag?Vg?Vg?V\+ag?Vg?Vg?V\*ag?Vg?Vg?V\)ag?Vg?Vg?V\(ag?Vg?Vg?V\/ag?Vg?Vg?V\.ag?Vg?Vg?V\-ag?Vg?Vg?V\,ag?Vg?Vg?V\+ag?Vg?Vg?V\*ag?Vg?Vg?V\)ag?Vg?Vg?V\(ag?Vg?Vg?V\*ag?Vg?Vg?V\'ag?Vg?Vg?V\&ag?Vg?Vg?V\%ag?Vg?Vg?V\$ag?Vg?Vg?V\#ag?Vg?Vg?V\"ag?Vg?Vg?V\!ag?Vg?Vg?V\ ag?Vg?Vg?V\'ag?Vg?Vg?V\&ag?Vg?Vg?V\%ag?Vg?Vg?V\$ag?Vg?Vg?V\#ag?Vg?Vg?V\"ag?Vg?Vg?V\!ag?Vg?Vg?V\ ag?Vg?Vg?V\"ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ ag?Vg?Vg?V\ ag?Vg?Vg?V\ ag?Vg?Vg?V\ ag?Vg?Vg?V\ ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ ag?Vg?Vg?V\ ag?Vg?Vg?V\ ag?Vg?Vg?V\ ag?Vg?Vg?V\ ag?Vg?Vg?V\ag?Vg?Vg?V\ ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\ag?Vg?Vg?V\! g?Vg?Vg?Vi!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?V B!g?Vg?Vg?V B!g?Vg?Vg?V!g?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?V!g?Vg?Vg?V!g?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?V ag?Vg?Vg?Vag?Vg?Vg?Vag?Vg?Vg?Vg?Vg?Vg?Vbpf!g?Vg?Vg?V $g?Vg?Vg?Vp$g?Vg?Vg?VV$>g?Vg?Vg?Vs$g?Vg?Vg?Vx$sg?Vg?Vg?Vz$g?Vg?Vg?VAg?Vg?Vg?Vm g?Vg?Vg?V$g?Vg?Vg?V $g?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?VAg?Vg?Vg?Vel!3|O| X REr+ WVs_DuDB W-n2zoozC*03>EbJO7Af5 1Yyke"Z xVk3cl(9=kZB~`6*k\-Of];g"| ;KOry~xb.Wu*&/`\RƳ(:$vV |FkY9Ԥ4ujjI(p_Ъ?$S"z@>ax%z *_RgK̳?%um/p|Aʂ#+qci^,gW]w <" dwiLK-1ZGR I$$ȇt쒰M5*rK+ppuhIx51~k@v4I(*hT)?nAacI4~y]ABQjVaf WE-Ot-;a8 :O^IsBs&4$a{6xAiNIFG=1,N6f }t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4!4 (!!!<%C<%C<<LL!<%C<%C<NetBSDAmpPaX NetBSDearmv6hfeb4p@-D0D 0@`Qp(@P`F`F&a03/T@p$h$B0A-`0`` 0PpU(pGpG@Pq`P03/T@0US $g\@-dPQMI T!T1 P`0 0R0418  0S  /S 0SP 00S4 0pp WI2I0@3)1*03/ T@p0pWH2H0@3(1*03/X@ Pd 0 P0 0$g4xd$@L$@l%X@-t tt3Pl@dphP L"0``POU P @v>vI& O P@-@⾞O-`00R@,2t(Mt@0[m ,iPp@tt@( | R  @PXp0: S ߿`0SЍ @P0`0vw9 0wpS0S.P0 S0 [ P  峿 0S;00 0   P %0s s0T TH[%T   ^P R&h&>O*w|w&~H0`  BR` pRp RX Xp/&h&@-Xm0 UNw& 000/&pC-؀-`P p0M @i){@ (c)@{{z`P$0  ,Ѝp@Y&%ktz&@- M @00@  gP  ЍzA- l1X0Zp 03 T@P m0S@ ((@0X;0% DP- q U @0`V/PlX`! 3pl0-S Y@|@Ph P ULP@ U( p0SX %kt{{ &{O-6M@T  @P Ѝ  p` @5Xp0S 5%0 0 |5X 0S_d50S&<0pP(@{0SN50S0p SpPJ400<T$尠EB00CS0 g)Pᐔ Pp  PYU E0 P00CS0 O)0 X80: S  +^ +pP p  Qt X0 0( 0X3,$05x000 00 Q00SD 0 0 `"|We@-0! 0 & 0 Ѝ|l'0@-0! 0  0 Ѝ||'00@-0! 0  0 Ѝ|'0@-0  0  0 Ѝ|'1 @-0  0 00 Ѝ'00'0<00/@-0  0 0 Ѝ'0p|'00<00/@-0  0 0 Ѝ'0p|'0@-0! ,0  0X Ѝ|'1(0 @- 00 $0Q@CЍ|%ox< C-`A!圁!ᘑMpW0 |! R0B=00 B  T廻0L 8 R<B 8!4100!0ЍPP d!=y[P 0p00S  0 P0P      0 3/R ! 7000@080L/!D0'00'0p'0 Q=#}o}'10|}}%}?} 0p@-@PP0 00R00 p800 p0  B0Sqs '14'0'000 0 0 /'0'00@-   R*@-@-   R*@-@-80M@0(@3/P $  H08 : S( 0h 3/P   00 0Ѝ00 0 1/pqi0S 00*@8m@-@NPЍ@  5PЍp@-(`Vp80@  03/PP 8003/(Pp~@-@P`P 80 (0(3/@h P hPЍp'0 O-2 PM`P(`,PB  0S9P06 I0S +%0 % 0 R,P0(`R0 *0 AO 000+ |tpx 2b0x ЍO-0 P % pHp 81/pq4   |?P p 4 TJh0S4 < p0 )0 )"a)0 )'0 '0 %)0 VU)(0, SR '0 ''0 ''0 [X'y 00 0S04H0004 4pX TЍ'0 0~ '00~0*~B~fR/ R 0 0 /\\CC  B0R00!/0"SSS S S S S SSS SS SS SSAQA0/C-hBM 0  Pe 0  4^ $0 0!( Ÿ}/LB/DPN#b`0@ R%H }//@#b`_`SP0!!!! d 4 !P`>4]Y4 +" C\\ T!d4+4JY4 " C  !d447Y4 # C  d44$Y4 ? `8<@p 0 `d  dp@44Y4 Ѝ'0bM'0~ 35 9LcV@-@S gG-A  `004P#"6P8P ( 1/pq $ 㰀娐pUЍ0S0C080 $0(3/P 0 `V`PE@r0  Z  $* '0*'0p%ox@-XAM P!#"18 P (5/pq$ PP< 0080 0( 3/PЍ80 $0(3/P`P4 00V0:0p080 p0l( 3/pPp 4 00V0* 0`/PRP `'00*m0P@-@ P M4 qЍ'184"iO-騇IM0@SpM. 8S+ #=|'|00S( 000 PP" ! <!Ix000# #B|0 =& %7IލЍ&R 0 W0 pS 0E0VS06  S  S $0S0 600000Sl60 0\60 00 H6RDW 0Rr0C0C00Q0 0S. ,B< j590P` U,  ( , (0S$0$ ,0`040(0000 0S~ $ R# `5`%``=c(0SP%0 H%00   0 (5(,0S 5%0 0[4$pWH ? W08 3* _08 "_ 08 P_ _8 0$_p#0X 0040 0@"D3@ 0@p  a( _U,0吉((0吓) _$0吳v'P00S0 ,0S#$P0U $   40S `5S S *_ 0$^ 0"_$03&"  0$p[XR3  0 0, ( y0$   r#0X 0040@ 0D"<1,0S 4v%o]'1L& SA}Xc|B S @fj S@-pPP`@@ -_P Ѝ`3MU@ p@-XP8@T`@D p  P<opQ<Pp'18A-AP 0 P 00$SQ ( 0$壶P ch d`P, 0R1@a@qU`0``00UPc 00CS000    0,`0CS0000 (00/U R c~8 4lD$0 00 $0 '1e& '3a'3"T0 S 0SP/P/S/@- `'1 Fp@-XAXT0040S+@! PPP P`04 0PV R@40P 0SU40 ^*00"  `0PEP P0P4  S U 4 P0CSR40PP 0 > p'3'1%o'3'3p@-@0(S  ㈵Pb ((? 00$0(0 T0V0? 0 "bD @L $ `Ɵ $e&a8'1 F0 p@-0 ?0P.\P@@eT0P  00S/S`8Pfp1p@ \P(OD8<p'2'3]oc'1'1|*p@-@(P P 8@:b' 0TTP/pP8(PP [88P0 "p'1&@-8@P(P 8P C8080'1 @-@@yP $000<0   R'6&h'1@@-<W+\ XT400CS00   _0Q0CS00! P1̃أؓ 0 S)"Rʜc0U```00P 0b0CS00 U 1Q !@o!S/ %S !`V U 00 0fP 0帱0CS000!000\Q00`PR# !RU``0``007Pc 0a0CS00jl0` 1 1S 0S11a0S S`l  P6 0a0CS00=?10`! S:`Fp00  1S pEP( P 0p# PN+60P 0#P]];P  n/MP/MPppEP! 0S0S rq=XG X00CS0kpl Pph pYWr TTox\H Z0Sh0S0c ?o2500?G YU.<.0 HG=0JPT.<.0 HG=0INP8!<0Q\ LH1RPX0S 0SP#0S(GݍЍX0 X p00CS0 q0 0S 0: SP 0S 0 8r'7X* &&h&\\GD0\\CDX X0p@-DPD@@@T ` U H H0Rp@\\-DppX 0Xp@-DPD@@@T ` U HH Qp@\\DppX X0p@-4P4@00T ` U 8 80Rp@\\CppX 0Xp@-4P4@00T ` U 88 Qp@\\CppX X0p@-TPT@PPT ` U X X0Rp@\\CppX 0Xp@-TPT@PPT ` U XX Qp@\\CppX X@-p0tp t\@ ^0@\\CX0X@-p tpt\@ ^ @\\}C5S %R R S R SSh -^L^S R 0/0/0000'7O-QM\r @ `u @ 0 @0T0@@@ @@L@P@,@0@D@H@<@@@4@8@5 SS$\ D0 !00`V0SB 0 0吐0T0Sx 40D0800<00@00$0S00(00 C,/A$xx9,0S x4 @?C000T$0L0x0P0,D0x90$$xx9$0S00D00H0#0xzx9,0S 3 @?CZȰ̠Р 0#xdx9 0p#x\x{90 \ 0C0CQ0 C003/0400S Y\ RS0 00 R0! 0T0S XP00| xS,0P 00,0 PLL5P050pQ0!H0t0QDD H0 Q,,.X.~ ^ 8 8 4@ 0< 4 #0Sb Q? 0 !``0$0 Q9 0 l!ll0(0$8[(8 0R  P ,X0*@80S00X00X00 PP\0.Sz0S0 !td0P$00P(0 $0 (+ R X0"5P000Ѝ'7HUUUVh( 2O-@a!80S 2PP! 5hpW  ЍO3<0匑SB儱|4@P F@3F@F0SL H450CSD\] $] T00L0S \0.S0S 05@0S40S |P5<0?oQ20S X g040 Ѝ'7H65xyG-`L?<P04FL0 $tP0S&00D0H0pP0pP蕟0 pN5T H0 `F0P 0 ?P i5X0 s0X0d 0t000|00PP' S'Q 'R0 S" S# S5 L0S5 T0S40S4P$Q40V  00Ѝ10@GS8ttttttttttttttt@HLttttttttt((@ttTltttttttt<`tt4lt4Lt` 0$00H00P0L00T0QX0s0X000P0L0T0H0F000P0L0T0H00X0<0P00L00T00P0L00,(0d0%PP"0<0080 P0 D0h l00D0h000000 0p0p$0,p0$00,0000@00 00p00t00D00h00x00|000000000D0@PDD @\0 SPWI( ?R004(0\ SR PPP00`0S0\0S00S S S0|0`0Sp0\0Sd0d04"'7@th%ox& $CFlP\%o;&'7\0 80p@-@PT @@\p'7 +V80p@-@PT @@\p'7 +V-L MRM\0 + pDD10 ލЍ 00 >04@pXl0l 0 0  L00S   B*& '7'7'7$0\ 0S 0-'7 *0L0S/000/@-0 0MS 00!:ptlЍ`0`@\0Q@P00C/= 0Ѝ@'7'7'74"'7'7P `00CS`0p S00 P0S X0X /X"&h: S@-  S  S/ I* S  S%|@=A-t1`@pTXPM !T@L10S @10S- ,10'p @0 0 0( 0@0S00S 0: S@Ѝ0l 0R00C/<0 _T00S '7'7'74"Q'7'7'7'7'7'7'7s@- /P@@P `RU00S @IT EЍpx p Q \0 \@1T ,P@(U'8'8p@-P@Tp!0C0  ,F @G-@0M?$3 30S`V0Ѝ!0C0{ 0XPS !,0S 20Sm 0$ 2+04p|E t S0 0 pH20S 84 ($ 20S  $ 0 : SK ,0s# @#4<10S10S91!0 0H 10S|10S : S0: S z`y81p 01Rp(10C/;0 O'Q kp| 4 p;P^ 4200S '8'7'7'7 '74"Q'7'7Q'7'7'7'7'7'7'7'7'71O-0S,0@010S 10S40 001!0 q0P0S ЍOPa0HQE0P 0 `0SpPQPU% Ѝ  B 10`    0S[  L0  ,R4   V '7'7'7'7'7%o%o'8010G-S,0@010S 10S40 000 0 0PH0`VGbpP倠UG s!0C0 W kp0S,4  `YpP [`'7'7'7'7'7%o0G-@0T,@0@SP 00S40 00@p0`0堀S㠐@VG 4!0C0 W ,,p0 00 S #p0S,4  Np` '7'7'7'7%o@- M @ Ķp ЍT  P  T023P 00 0S@SQ 0  20&0p@-0PS``2@P $;P P:A⥳@P42 (Pp'7yk'*C-CM@_2 `&? "?PȐ`T *F 0RpPPCߍw ? P@?w0S ?@ P?lP@&p@-@  6& 000/'8@-@0 \&@- M0P!00A00P!0 0#mc R#pc Ѝ "$ 0P @000 h0h 2#pX   DH弑"$  (0嵑'8 v* O--Xe@PQM Pn ?0Sr  pP 0S P  tt00CS01p0pЍ0S P PPpPX 6) 84 Rl, pz 0 ! =0 X 00CS0[p YX 0 P 0S  |f (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx PwP X0: S P@Ph P $SX0: SPX pP{b0S 㟛 ጲ  P> P`  R ,QP J0 ¯S ,!0 0 @!@ ({{ z0 p#00@0 P @p lP >0S X0;X0XP P >0-S  sPUpPt0S  HOp @Y'8{ &&h4"   <*Lz{/Weys@-@ `PP#0P U,*ЍpU \@0 NP4@%oA-A~M0pSM P0` 0`VP=p! p~,P =@!1P~܍Ѝ0 0`6P= ~,PP= ~,P `0 0P=x W Q \00 00P=0$ >1%omDn00CS0 0 /O- U`DMp w000D$000 0000S00xV"4`0p Q 30Sa4PZ|PZS=0`$0B000 0K4$$P?=0$0V 0030p Q  #P0 0 =0#0V0030d#P =0X#0L3000DЍp(0: S 90 S" BP 000 S|2"00"00 0R  Rz2`2Vn `i S0% 00 04pq<0S 0㐐唠0 0p) W W)2`V% 0 /j6010 0R  S0R 0!CQ:++R:0'WW~Ta0@  0 <6T04[@T ;0W ` W00l W~,0 ~l0`Z BP* BP*Q*S  Q T0`%o'88';%s%o'l'8XI%o)%o[@8m'c'c%o}D00S/@-4@~M0S~, P~܍'88%o0@-p@$0l00S Ѝ00 03 P0;, /P%o'88L0@- R81/P 0 0 %/'88'T'cA-p`P@ 0PPEU`@T@A-p`P@ v0PPEU`@T@p@-P@T0` Qz@P 0 Q @;;S pj@P00T@ ;(0(  /( .%o'88'c=@-,BPU` V0bP$00 p?W0 pGWhPh[;0 SV.00P ЍP#ڀ;;S 00 03 P0Q/VPppD1$p0pQ Q(% 00$0SP ( f.;0S00;0ES00;0S ;0ES $0SJ.;0S :0S :0SPU :(0( .%o'88^'=p1 RW@-`QM R P!  BR@.Ѝ R RR.  6 R R  -R R @pT pR0 Lp2Po 0]4p0T e20 L 0P000S$ʳ/'88%o%sHmwG-0 Q@ ,pPP"ڴAQ"42P`0 Q Q 0#2PP:D -ЍQ 0S%o'88@-xaPMP d1@0S2 SQPD;00Q0pp 01 P: -Ѝ0Q R(0S 01P: 0Pڌ T0 /30 d4-0 L 0<P9 0, z-%o'88 :g'cmO-rM R4M0`RX0E@FP< F園 0S 0  F0S(0S h  X"wT2p0 0i304"j>00"#cTp" #>r܍4ЍT 䁟0S =! !K!0`#E#d+# 210 00Sx1pp10 0(300!)>08!000$q0 10`(0尐C     ,0 ( $02$0 t  00 0 `##+# T%s&'88''d''T'?';,,'c%o=C-LRLb0HBS0000 Ѝ((0 0 0S  2 r0S T1 p, 0S 4pP (0: S)0 p10S10S PP 0 0 0S q4Tg 1 9,00 0S000p000 S(00(000 P@0S 000S x03P 0 0t;A2P 0XY+%o';'88'$'' ','Tn'8X%s'''d'cA-MM, PW8#+H PK8"+RB$0`SF 0`CĂ0S2T+pE3P} @3Px 0 u S( .p@+l>+h2Lr0`0CSXX5+2+H0+D.+@,+<:+P,3P000 0+ 2 `ލЍ+0S  R  sS SS YSUP*yS*$qx*l*<*P,2P 0S8 42P( )1P *0S(*PP P0000**'4%o'88''T%o%oE%s(P  0s' jDTp 00@-@FpQp`%tO-q\ Lt0S(P1`@PPP"@U(L0 R1V10S {*@DT  AQ0d#0UPTPd*PV0S pW*@X`ꓢ" @2/PL0 !ᓢ#, 0+%s%r'9%s'9 'O-Q0@`p@F T[ PppWPH* ЍPT10S   *p@ 0 $03/P$ 0 R T @ A  80 3/PxP\\00Sd \) Q < 02/P " "''95%s[~'?'9 @-AMP/Mr:@P+ p`pP/0P0 Uh0h )AލЍT0_"_/0P0 0@0 `)'?'9 00CS0 0 /0O-S$M00`Y P$Ѝ P0,03/P00厥L30S,p@-@P` P p ޳P $0>+0 Kp',@-!@ͳP 0*+0@ 6',O-P0`/Sp/M/I@P7 ´P. zp /00 ᩴP&  P!00S  ሴP ᝴P 0 Dx Ѝ'hG-@P 00/S (QP ~00Q  G BZP$+0 0`0S V[뤀夐p0 ع\P +0S@$<jP@D0 40 @cD' -'p',7A-M`P@p!P6,10S Ѝ 0 RP  0RP  0: S%P JP*0 N߳PW DzP * P W0 @0'H 0fw0@-:(4@: SM-0P ̈́\ 00[ P0 ᳳp 0: S ,Ѝ000  t:P/  0 fA-pQ?ZdV`=PD*0H!@1@0S/0(DS7 (1!0 0 =  "4S p4P*p0 D借0 40Ѝ@$<@0(DS PL(DPL(DPb `00 0'h'l%t%t 'O-J#Q30` P (tJM Mp40CS񟗄@`xh3$P x30S P0: S* XP2,3,0(So0S| (4S~ 0S20S 4m0C?o2 000! "p"ap)0 "X})Z/ Z\20S0 0 D" J>0@Pz=0 Czx Jލ Ѝ  Y Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(402$Pz AP#VP) 0 `0 + H`\ QX00O0S0(4 008 00'T''h'l%t%t 'p72X/O-pPM W 0EQ 0S08 0<000S@@0C080pG0S 0`S : 08 0 x! x3  P< (@0  0R X2P0P/f P*(@0 ,0嘰 R P` dЍTT ꍛ Y ` `Pp''''Rs@-Ѝp@0 @`P# PP(08  PB(0 '(0@-@MPP*00800S =J"Ѝ0'(G-`QM MJP㠔@ Y #p P 0p 0PP=! RS J(Bݍ ЍHPJ'8 = $LH0RP J(L0 00PJ'8 PTIG- QP 000aq@T+00CS0pT0 0S0T@ 0 S@ 0 P 0S@ 0S0 0 S P ','8%s|&h 0 0 S00@-@R00000S0@000S `yP LP40P''','|  '(p@-PP 0S|p `P@P` @P0/S000000f PR @@@p<W',h0 RX R  H R/< R/ $R/Q/ ','''l0A-0S X0XP@0P`PpT R S, 0@'(',e&~C-b@ 0,MS0S.,Ѝ0 0P50C S=""""""""""t20S 0X0 00!P! " PPP  0!$)$!$ 0!0 㓝 Iz X Bw%(4 : S>  S8  S%  S04 0L! N0 J $!E1i!P6 S  S0  S04=! 0400S -ЁЂ ;Ѓ"040+04 P&&0P 00   0 P','( 'Tp@-8M@  ሰD 0`P`xU`$ $ @ 0cP8Ѝp/9A-t1hM0@S TƵhЍAl`Z(壖="(<Wp@1WpP0 0000p084 ⢵40CSL$0r"60"$唵0( 叵4 CR+x ᆵ.hЍB>'P}S+<  x'$e4"EW O-px ?@ p\Pp`#0, [/00 ` +VO-lM/P&POo`P `0@p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE <zP񟗳6p41L46h44444646666444464444444444444444444444444446 6,44686D46P6\4444444441L5`44445|55444465441L5454546444444434444 44\44h4x4444455 55,5 545<5D45T`N>4=Q $,PMP>@J >0 -R,Q0 00 0;= =, 4<=`?\?\?\?\?\?\?\?\?\?\?\?\?\?\?\?\BB?\C$C8?\CC?\?\?\CCCCC?\?\?\CDD4?\DHD\Dp?\?\?\?\?\?\>h>p>>?\>?\?\>>???\?0?D?`?\@<@D@`@t@@@?\BR@P꼃@2QH |- 3@ > 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eBp Q P?@4@4@4@4@4@4@4@@4@$@, !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0-1Pd H'T'd'X'%oN& $%s&',&'c"'8L8'%t >'h'l%t''$'%tN%tD%t:%t0%t&%t'%r'\|&hv%sǛn SN(''%t'(','= & !]''dXo'''9'''|'x't%t'P-)'8P~'G 0 .'%s0& $7'X%o 6M#rL#n+M'0   0G 5가z0Q , G# 01F  1@ wP00F BP`1'PE 1E  1D s1 1C1TPC1PB $2B  42A  D2A  T2` `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C ʭ0 0S3# C*SS8C0U Pg000Sv|30UӈePE3PlPN0000S 3 Y0P  /'Xl0P/`0p@-0 PL@LPP@0@P6 eB'X'^&'TA-`  @PA?\+ \ *\.  Q R( [\SPQU !\@@]^.!Lo \0S8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ 'p@-@@0/SN00N P\IpPQP`Q*C0CT030@"L00Q*pQc@-1MP MAaqUP/P 0P0Sۍ Ѝ.S@T|`l @ @ 'T1d  7O-cM M33 "@pn 3]PW0`0 00S 0f0 0 0׬P``$00 ;RSVz @0 0;T*Q`DV:  cݍ Ѝ&Q) \Q$ 1B\ 0 BQ "P P BRCR0  0@&R\R ,0 0CP;T+ 0S( `0V"p0S 0 0S ٫0S s  0l 0 xȫ@T *0S0T00  R S 0 ' b&|C-`PMM RP p\SP RT P0S #  0S&\S R. gS PS$ SS GS  0 0=pS sS0S00 R @@@(PPP Аu@P p ʛP ; ፘ0 0᷐ ۍЍW2' A-PP 0Sp{`pF@PL P 40  R p`@@ @u'X0A-@0LPL`LpT  SL 0@'e&`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0  <04 P  0S/  00p0S/  0`0  @0/S000 0D  /''''0A-j40@TPp 00S0o`0 00/S @Tx0T0oyP0 SD fP04'''尠2A-0@SP' 0`.S0.S0S/S XfP 0 Q CR S.R  S.R0S/S r 10S410S 4P:4 CSR ! Q`V 0/S0S.00 p  #00C0V0<0< `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0 0A0 B!"00@&A-Q@pW :'A-P`@p娀TЍ000S$0S 0 0 0 00! !=<00S z‰@''l%t%t %t7@-@@Q@A@P0!!\S  q  160@I Ѝ0 @G-鼑M@TZ `P!ApT 0S @T '@PQ 0T0 0 PD ;P6]" 0`! A+00! 0 PQ  ލ P    ߾P]$ 0 P 0 D ^.(  'G%to1G- pWP `VY @ 㲆@P ؾP` ҾPAt@T P`P ᵾP$'H-d0A- @T`pH PATgP 9@'Ppp@-@@,0C\P \@@ \@@@@ @@@\:0Q00^A0L0B\ B 30b 30@pp0 S  0 - R 0R$R:/A-0A R0.p0X!MPPaM\ 0  C0/S' 0 ! ⦡ P3ڍЍ *R.@ ?R 0pC @@\@0@C0@0 C0 0 ~ P 0` Ts P 04 $g &o wp@-`0Sp@e\ 1e #p@ lP000p 0@-500S/'0-h0^0 SQ0Q00P' Q#p@-0PSp  lCP`0 r   Hv @Tp /%tA-`p娀o@PP! P@ P 0 \IH0@ LD00CS0 $ 0 H%s4b'M-`PPЍ8":0J840K0CS 2  `70 01 .  db (l[ <tV @ |pq}  F=/$4  0 =C@2Q! 1Q) ($5Q/^)040)($84K ARKQ  $@ q++@@04(4 :(40/S0004084(49)($ q++ k$' 'G-z4@0CMS*xx4xLxx|x\xlx|x|30SPP ލJ(nJ(J(J('0kN'x// Qp@-(0PS$ l` [@P|^ t 0000X0 `%V0  y@p'O-P`P Ѝ#:0J84YqW V#/00p0K0CS`3X IPk0<0043  a  d ( |pq  }? 0$00004JH1P tn@0 B(1<iP l`<0 㓍 H K06S 0S 3 CRR~~gSt K CRW0 40r;; (49 xS!04(4:(404(49(408400C /Q000S($4S::  $ R(4 @0&"**40 p0 2S($0 *4($040)($84  R KS 0 0 40r;; 0KS8  0w( $ ''H' O-j4@SM- S pcW:ڬ60WS0dpGp0PS/SpS 0EoᨂSXA T0CSPP J0xğs# W/0p -P 0p %P04 T 0 !.00 S~ .4 0pp0(p Pw J60000 0 P JS20 SK010d 0 43 00 0P J4 S&L p "p Pp e++ 0S  Q0 ^q @ P0 c0C 03 30 P J( S0070 0=Pp0u;; A 0  0S  Q0 ^q @  2.0 0~p0<x P J7p0@ P J,1  = 0qpP J<3@\YE   }XM  }} 0 KpP J} 1P LP$PP P P $p px 0q0cRa1P'7? '-GPY .w'x{4"0@-PMM@ ` =XX  0P+ U;@ 00$0$0<00 0ݍЍ0$ Sp 'p@-@ PP ip@#A-0p-S0S' @P#  0O0` S0 DPfPP40TЍ@`&h-@-0@P   屰`Ѝ@Ѝ/'p@-@ATp@0 R P^P ` `~P`p'-P@- 00|0 x0x 0 0 h@0S X&_00L0L <| ,q$ _ Ѝ@ Ѝ/'D''$' &'TBp@-xf@Pl6hPP X/P p3g000S  p'' -P7@- 000@ 0 0 0 P0S x^00l0l h% XT+D 80 ^ Ѝ0@Ѝ/'D''$' &'TB&@-  &@-M@P@ލ0/SXPtXP :p T5p  0RP 0RP  0 000/'@-  㹘 &A-q`@ MT tt屛lAPDW00CS0?@@P hDP0P 0@00aT8@p 'A-ppP`0005@50 05000@0CS000SA' 'p@-P`@T 0PV 0@p@@-PG-`=0@T3 =P&P 0 V@0P U V}X00CS00 cV 0 00@p'%u%vC-3sPc 0 wp3@0! 0  0004 Bl @3 3 00`D_5蒟 0@ Ѝ/R@R R@ G&@ B&Q4$4`LP4@0=S0  "?R 9R:BP<D`X|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]&' X'2''w0@- '0s@-0P`0Z0`0@S P 0R@P@  nP@0S00S 0ST P000 R  Ѝp'' %t } X@-L ^8,D0t0\h` @@~8 \  " Q?0 CàΌ c1Œ? l1 0\PQP̠Q  S  S Q PQ PQ! O-`py딠P @%R= &R X%1! -[00 @P@ P@ Ѝ'&@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F/P@$ P@y W'Hp@-@P0)Sp'O-@p`@4MTY T\ T( T* #T! @$TX "T 0P#S@    4Ѝ'0DSYJ P@V'0I SP@ 0 0PS@'Y`000`!`0 oW! mz! g0  P@@! Z0  @PQVG'T`@@@P, P@є ']4BHO-p`M8P谟蠟-!@ )0 N@ 0DS U# 0 U 00S^^ :U 00SY` p PU @ 0DS Ѝ' SC-Pp 0BS00`S@! @ 00 TP`@@ Ѝ'G-`dP0@S! p0 00P@@'@-@MP2`PL(0P  IR NRpp PpEp@@0PS@ $s2Ѝ'oPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P22Sp0@1PH0@P4 0S@24"%t%t'' !@P/-0 /RRR00'@-@PMލ0/S \ p p  0RP 0RP 0p@-`\1@P r1D0p@110"SP Vp{g'p@-T` RpH0@Q 8 >PP J1pp@'%tXO-pWR 0S)P yB000000000CS020S @T  U tU`rW71t828b0400@/Sp?DpPI0S0/p0CS0oppW001000pA0P00 y000 hHU \DU00CS0810S 00CS0 0W00 pR0S/S0@D001@ P  R*0000t/S0S P 0/0CS0 pG0S 00CS0001@1@1@'' '%t'%t 0A-Pp00`0nP 00CS000S B0@0CS0X00S 3X @06 R0S T$0$pQ@$' '%t'eG-p2B`M 8&0@T"U@P$ 0SM .S00.S0 00/SSC10 p PPB|ePpZ% ``VTOPP@ ` /` E*0E}s s@`0-S0S0@T@@wUP07P0: SV P >PЍ%t'Jp U8' 0@-A$0Q @  T @'p@-L@Qi70P000S LT#PP 0S}s@@P 101P00CS00 %P 0 P0p}yT''(%vIG-pPp@R` V101 Pp Pp `b\TQ @0T! \0DsQS񟗀<8X`hpx@0 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 O 0 0SY00CS00 {O 0 ]O 1 0d1@ @ @ @ @ @\@@%v>TA-@ ` PR 0R 0S S,Op0S0 R O0S  OU  OTOx xOt Td@00CS00 O 0 AN%u' '`B%v *%u 0@-P1 05' @-@(0Q >P' @-x0@T   @@@@ @@00S 4060S Ѝ' '%t-$0@- R    'h-@-   0p@-'h-@-0@0 H@-P@`  =@-@-   3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ 0H P @-4 4N,P / S`'$0/'0p@-@yPPPP ᕈp` 噈`P ㉈p` 午`ps@-P.50@T t0t`6 N E2h0@T POT0 0@ Q@DЍp'4"%t B'0'`s@-`P0@S'<0`r%kG{{'jfk[P[x 06S 00S T,Ѝp' @0t0S0T.S @N'0 0    /'0@-@TЍ0Ѝ0CS  w000 P m0 (6@ 00 0@-@M PU PP 0p ,P   PPP 0p 8 0  Ѝ0 9u0 0'0%t\B%td@-@P 0S0S 5P 00 0A Ѝ'`G-`0S q0P00#@儡T0SXl'@d1$@00CS0D10S *Ѝ00S P Uhq^v5  R *P00CS00S UC0SGCUP<@ 50Sy#' ''0C-c@PP^0M& S'=,똓sQÐpT4ˆˆ¬ääääääääääää(LS#$0@30S EK0S 2$P@@T L^0S 0S@ ,T ^0S$0 0 @^0S 0S$0S 20S VH+ @@$@++10S @H0S 8Ho^0S 0S$0S @TM$@P10S "H,10S H 10S H00S H  0$ 6 $0?o2$0-0$ R  h00S G 5@QL<Km+  Ѝ%t''0'%uG-PMp@I+0 `㠀堐堠APP  m+Vx0$`W U ^0S W P 0`S-+Ѝ' %u%t'0P8PG-P* `0@00 0R0Cp0W S `S0p 00 P++S p0@*PD0(00$+ 0$ 0$/%t%t''0A-Pp`@䀟000{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S S'0%tG-P䑟 M^`AV $`*pWT0尡p0p00WZ 0S- |1|a460S >0S$0S 00D0$ 01C 0d>0S$0S ph@DnT@ xP H047S 7S) >0S*00S5 -0000,0(00 0p(0P =&0S(7S%00S 0 0Sd= 8  ,=, 3p@ P 0 ,= M8 = <, R , ,( x%P000<<0S @A @X$ 0 $ ` 0bh<<<h1 Hh@T: =p<P`P H00CS00 G 0PppH@T4`@T @ [00CS00 yG 0 H@`@T0Hk PU#00CS00 ]G 0 :>G00CS00 IG 0  TBP @P07:0P ᴤPP@HPP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP0077S 0Cs0S0TT)SS B70s0SCP0 Q AqQ8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  p8 @  (00(00@070040. 8<000LבP7 7H 00R}0( ?$0SP007pGQhJ 0'000 000 7 0|'0x'00$(0h7  10103/$0 7 G474' 6,' FL0S 5L8 6 6 @ R] 4 0  X $E&@00CS0 ot`60S KiP x60S%,0S5T6$5D h0 L5,,0( c0000+,0( ]#0hE$0(0S,J $ \5 d50S $5,0S pVt<%050S 0 @0 BP0ET?0 000$0 0C0 000|D000t4 8\XR00CS0D40S P) `40S*T0SXR{K8 3 3 3 \ 4 03ǐC*00><p3 0 0S '|0R#C#0 0 3 Bxh;L00S0\P0"0C0000Q/K8 2C  |2  t2 \ 2 =*00 0`2 T0S@"00CS0 2 R   01D0S$mߍ;10S -0,!SS{1 08 L0H@YKq10@0@0S P1 @0S1 41$ @0S  1@0sH1 R#0S01   B  @0S @0S7S@<Y 0 00S ;X@,0S0  >,0Sh@P3 F 0,0 0H 0'`''0' ' %t T'' Q''''8%u%v'' -)& $%v%u%vb''h!'' t B =uG@T(0Sp0 t0~,0 0s,!p)DlCHF0/'00 /'00 /'<0/'< 0  /'0P@-@(P@<0 QP cR   '00 S0/'00@-0M0/0@0WP P T0: Sl  S` PЍ0P0 : Sv# PP'` 5p@-Px@x`M$P*00S o#0`00``00."`0#$Ѝp'0'@-h@P$0'0 RP  B R    '0//C-LM*8@8 p@<(P@0` D, ` 0CLЍ4"%vA-@P`}pWU vNU" 00y(p''`O-pWC R``%` P0S:S2E@А @0S,W@  @0T/S/00 f0 00S00P R:R0:SPPP@DOb"S"%t%t'd@-@MP/p EP㨐K  0 z@ T9~p0 @~0!0P 09pWZ0S 0 `TW0S S0S O0 S~~p @H" f`P T T T06@@T >0DS'dA- @PM`RkpĤ1000  8p"XZU hCB Q PBLBQ8B 00AS 00CS00 uB 0* 00CS00 eB 0 ЍQ PBB000M 00CS0 TBBHD00S Z,z'`*%v'  'p@-P@@Pp 0S%SpP @ ^p@-P8@Pp 0RPp@ ^- @0@ R0S P P\ 0%t'lG-`P@唀0吐00|Up00CS0h00SG0S0 S 0S00iPPp' 'l%t'A-`pP0@00 Q Q:R@ @:QR@P0SwppR %Rw@L%Ppp0V:SP0@w@'`'%t5A-`P倀000|Vp00CS0T00SA0Sp00MLi@T`' 'l'0A-pPS R+%`a@T"W p000i 0 @0 0 d00CS0H00S G`P `@'d' 'p@-P$@Pp0P0@ ^@-L@000@00 h00CS000S@' 'd'O-PM/`@ 0%P @@@ (|P000 S0S O0S K000Ѝ#   P@ |?P @bPR R R R 0S 0   " R0""  " /R0 dpP>Z0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ $P %pP A0000S R  pJt#P R  R ({P0 * R; R 60@@DZ P R  Jo T@0000S R    BR =D R9 7 a'`4%t'd%u5' =%tB'O-@`pM&PP'0S*[ 000`0p0Sw|2!| S6hB?01 P@PЍbPEU00p`@[ Q Dl|V  0P!0X ZWYV M1 00 _0S& 0s1TP P*X 00SW0 0 S0 P 0STYT 0s P ku@TW''l%va''`%tp@-`P0000S S@oK000 00 00000CS0p00Spp@ ' '0@-x@M0 0000\0P>00K 00CS0$00S Ѝ0@Ѝ0' %t'@-gP 0S,KO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩00S"" 0RPW>= >0 @ TW 8L> }P 4>>0 R @ T Ѝ>>A00CS00 > 0 00  x100/BPXP!  sZZW Yj>g>TyPW]>W~`FS@gWxWtWq ~W 0` @ p`>`''e U4"!1%v'`7 ?>TiO- MLBLRp*0@0`V' VV:V  VF /V   BR 7` F RP! R  |a[  0000SH'B@P  ~p[/R 0/S 0x \P Ѝ[ @TW 0 BR r R  BR    BR  W R %t''%tJp [A-(A0S 0PS0 0aqP0S00 P000d00CS00S P 0SRh`hp0P RP000d000CS00S '' ''s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `R_@0S00S=STL00 <0 R0AD1U0 S 0S%t''A-dp`0PS@  R R00PH @'O-rP0M00B00 00,`000崂00<00Cn:<`0P X0$00CS$0E0S00CS020S ' PYvP+{0S 000Pgv P c(P C10S 0EC{0P0CS0\10S Ѝ000 @$P[ [` V0 0( RP0  Q BP 0 SR 0 0 0CS0s0 S00C0~000`0C0  `F BR V00SP 0P'%t' %t'''0 [1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xqQBP  `V' Q`:00Q@  @% Y0S" SiP dP@\P PW DoQP @@` ''t'%v,4A-XPX@X`P0p00b0p0CS00S '' 'p@-PL*@]%0@ p'@-QP`p0G0S `*00E@P`MP P `R@ Ѝ0P@@0`SP0S0O-@ Y X0 S@0 S@HY" \YX0 S@0 x0s0S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x r SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x~^\| ]\Q000``S XSQ0 0 @ 0000xqQuS^ P[Sc:Q! P-Qe]Qb  \QQ PP$"`( vP1 0$0 $`( vP%H08PP0 QPQ P !$ P80QP*0$0obP |b`0]S0 S 0p@Y(\PP  8QP4\SSPP0 SP0S  @p4 XO- P@M0?S*S3 [S;0^S!S00x|\/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xpPS@0/SR"@ R0A$x r RP R  \$$ЍtPX9$P| 0U0/Sd 00E(pP $0S/00E0S``0` xqQP 0S V/00D0x r RP0  Q: 0 R /00@>0P .Z. B/o" R  P V0 k[$' 0 +V'0 q Q0@-0 @\C\0CC/x~^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S P o$$$&`0$000CS0H00S O 0S ~0P'' 'p@-@ PTp 0@ @@'G-p 0s0 S QA0P 耟`V -`R`F@ V `\\\\\\@S`` S =QQ RU  0P   P X0G-p@ Mo oF0P 㑕8a000e U00SW-00E@`PIPE@T Ѝ00CS0@'O- R@@0`-SPM S! C R$$$$$$h$$T?So @Sy 00C Sh0 0 5Z`0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666C0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   Q ~ K   0S q QAQ$AQ!   Q R V  BR + `w~   0 BR儡  BR  ~ ~  `K E~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00'' ['' U< U@%t''T%t't%v,O-$M000 Z0 0H'0=u,W0Jp00 0 7'0` 0`F#ZGF@Y0/ 0h@P`6 Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG (A49 6`0P`F 0 0S Z?0Y : @5% @AQ TK[Y0I Y@i ZD5  A0B F0  %T5  0 Z@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R$""$0$0#h#h#h#h"$$$$$t3  AQ AQ~00AQ ~ K R  BR ~0 0  BR l~0 0f @0RP[ 22 0AT[ @T 000S[@Zp  Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0 0000P  00B 0C 0000000T0 00`P 000l0 GR00#S00 B00S0p0 G0 B0<[m$Ѝ|0s0S[0000p0SQ X''%t%t'' [' O-0M P0 4ԄдД00C0~Q 0 `p0 @Q Q!:Q =Q Q QX   L  BR  V \PR AA KA P񟗇)&)))&&(4''W 0S@ЍQ Q@Q =Rp( `p(``# P  BR  wp$ w     BR u    u   BR    ( R 0BQRQ B  W `   BR  v v 0ASq Q AQ~@P   Q @~  @   }@P ~ i  ~Rf=Q0Sa 00 h   @'t%v,'%t' 'G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S:000`0`0CS0!0 0@&p  Y 0  i 0  R 0 00/ 0p %t'%t'%t' ' @-0@%tO-XAX`0$M`F;@ 0@C$ Q 0000CS0H10S 0q000 100S01000000V 00CS000S 0S @pWZ00萠@ 90 ZPꙂ! P00 R @'d' '%tA-`!@SPp% M'WVV |1N0S9 U 0S0PddPcV81IpQ!1@ ! #&0@$$060S& $$$V&&U 0S PP bXbP HHV WT  0 '%t%t|U'''du08 N R S  0S  P %tO-pR0`BM0 pP 0S0S ЍP880@000$00 ##P%:T 0S0 10S 160SdTf P c100CS010S 0S 0 2"  \ Q R05S00|) \~ Lo ^ \ \ \@W~ Lo ^ \ 0S 00?TP 000'' 'd'%t%u' G-pPE@P ?P1N0St `H@'cT @#cHpP `㜠@0S0S 0S0S%`@Y 0 X 000 /%t%tjU'dA-@P%P PT0Q 0S tlP@ pP@ ZP@t|06 R0S@@d`Q 0p* 0 0 Sk'*%t%vO-PTdTt,M @P Y< U0!0S05 @nT pTU P300SU00S00 ,Ѝ 0U(P ,,P t0S 0SD3 P#Zp `X*00SM T0 @@0 00 00QCZR00 RjUX  *Y ^  pP\2 R  Y RRU@ )260S( p @ Y00P'  P0`0V 00& 0V0S(0S0S 0S06 P 0Q p$@I0S 0S @rԀ0U0X0S 0 S0C0 g0SY UX n) @0S 0S '$'d'$%t2p@-@Q```Q000 R 0S <1Gp N!q0S 0 00D1  S @` 4s` V0P 4s0``0S`0S]00CS0X00S xp800P0V0S ' %tU'dOr5'@1A-Q40@S{%P`q0SP00CS00 %% 0 w&0Fp |N.R!%PlP000T0@0CS0800S 'dUe*%v%tU' '@- @ 004"'@-@ @4"p@-`@0 0 p 0Qp\ PU %00p'd0A-:pTb0AU RAЍR R =RU "0Bh 'Rf 0 BRaab4b@a`aa`4) 1PU ^ S \R0 R  p ` Q\1 0 0A Q "Q" .  Q1 01p0} 0$ S0." W p 0p: !0}RQ 0 0\ $ `0" X00{ Uy 0"  @PEs'dHQ_[b%tekA-@` tMTg 0SdPUcfPd8dddcd deHeeefff@flcPfffftffffd(d  S0S p#l$$"00CS 0SDA0#\$;P  @`@P@PrUV0S 0S Pl\ЍP@@rP i 0S P ]PRPIP\ |klh0`aHPqPLUH %} 0 SuPqE Bv P5 P2 P/ P, P) P& xus'd|2  $Y2NvyC4|sp@-@P\`TpU 0S@@Tp  p@-Px`x0PP6 R@N0S2@@@0S. @D0    p 0 p'd%tA-@1P0pS`3 R4 0N0S- P]V0H@0S{]V0H@0 @000W0܀ ܀a]V(0H@V0H@U '%t%tA-P`p.p P@ 0 AK0 O-P- 0rM00S z1a 䡟100 0000 S  @PЍ0SI  0 Q S/R C]P" 0Q 000X00S* RA PP0S:SU@!00S8@D6"@00CS00 ! 0 ( `0ST0 @200 ''' U8''d%t'%u%tA-M`.P4q4A0S Z 6V@oP 1#Ot!0^0e 0P!1U00V0S^0SP60S .0S !P P P$ЍP ^X8 0P0C?o20'%t%u%v%u'x0S/p@-@000[P00CS0p00Spp@P00S K00CS0 P@T` `@V0`0T0@0l0S V00T00p@c' '%tp@-l@0P00T[P 00CS0 Ip@K,00S ' 'p@-P@PUh p@-cFPK@-GPKp@-P&@CpA-@P0PS`~Up~0000 p 000CS0h00S 0p000000C000CS000S %t' 'P @-(Z2 00C00/X%t00  0 00   /%t'p@-@tPt`0000S0 000D0 00CS0p,00Spp@b00*H' %t''@-D@ 00040 00CS000S@F' ''G-qA0@0000I?o2 V0SPkPP) 00>0 000E000PS V 00CS0l00SG  E  P0(` [0`00' %t''T 000@0A00CS0/00S/' %t'p@-PPP`@ P T @D|@p00C0C0p%t'p@-(P(`@0@Dw00C0p%t'( A00C 00 0C0/%t'-A-@P(MHp@`DpPVP u T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@&B0 P pc T4O-` 0WUT@>P0 |P0 &PU000@$P 0Ѝ%u%t \%t Z''9Ub}''%t& X'('%t VI' VH ] [P0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0ZP0  0{P BP 10 }0 01{W00E000C00R#PpIN}PP 1 " )00 0: =}P,p @R<2 3 wp BR *p* p|2  BR P=  Ť>= P2 Y%W :W5 #Wg}g 0P 0 h\"0G P wp BR pYpT3 0 @ R   B 0p3pP3?  BR 4p02!R1S $HQ x0H@ 00 X"0`0001BP11=tP|4  wp BR pPP4HW I/o}W" R #p BR p P 0X0 'P02`5Qw0  0y0"0 `! $0  0G-`̠̀0@T@@0PU @ 0S 40 0  B/o"`f0p 0S 0 B U0 0 0Y%u \@-P0@-2aM0$ 0 x10< 010@01|0000XPI@1| 1Q @@00G d 0S $Q. 4QG Q ,4  8000<  ,000 0 0 .0 0 0 S00aߍ0  p0 `0 H0 D0 H00SWS,0s 0'%t' %u \%t'4"ȉ G-Vp0 004 P" 000-P6<<<<<<<`<<<ƐƐH8ƐƐƐƐHƐƐƐ0$00pKs@P 0 R |0W` p    B0@0S 0 00}Wx P0, R_P}" 000@ 00 00 R, RWP4  00300 0000    BR   00` P 0000 CR Sm 0 tP P`  ``s 0 0008 @0C 0 00`0 SlP XC0 R   L000`0S.0 R Ӻ00 P 0 R000 0  P 0@S P 000 i`@`0P0|0` P/ 00000PU# T 0S F0@P0@00S0P0S0S 000@Ѝ0$00p%uȡ%u%tA-Q@`Q` @ p0 P0 0X@p 0HP Q$@@`Q < W R    0 00 00 @ 0p0 `4 P /忮`P l0 08 00C004`ЍRQ%u%tȷ A-P0 5P@. 000`+P p@``@@P 0`0 U000 uPPe``PP0S %u%tp@-@|PP ,0 @P P 00000Sp App%u P/0S/80 P/0S Q/0'pA-@Pp`00p` P@-` EP 0@ pT@$ PP  &D Ѝ U@PD㴻㱻ᮻ㫻 㨻 d uEQ%u 0P/'pRQA-`Pp%DpWpPpW@ U C`0 R@DP P2 0婺C0 %uA-`P@xpT@Q00C0U U 21@P0 PC'pp@-X@X`0P0000100CS0p00Spp@>' 'p'p@-PX0@TpU@PU@TpPtCP'p|0p@- PR @RP cC0 _P e`XCO2 %p%up@-@tP0 S000C T  D6CP 0S9C,03O@dA T @0@p@%ufffg'pp@-`P0 Sڜ S  C@P t0 R@U Cp0S 0 S B@ 0S 'p'%up@-P @0Pp @  0p'p@0@-@ P  Q Y0@B0'p 0 P/ R/'pC-LsP0 U00000@0CMS񟗮xҨӈӘӘ||` B@P@2@尺ܹ rB@P2 R@Ux20S Tq B |B`<"<jB@P2V0S' `_Bp@! CptPgBpP 1 k嗹 0: STB]00`l!x`\!l `V'jPP 41 0( V U0S000  (P @-1 0B00CS000S Ѝ@pST 0P 0 DZA' 'h%u%t k 'BRp@-@P PP Up 0 |妸Ap`U ԹAp0U ɹ0 pʀʠpO-P `ppW@p  0Ù`ȐȠȰ0S UT  O   0@  U  }T 0S@@ `U %vQa4" VP[k ʿp@-P  @TAp R  KAp d0 Rp  @Ap 9Ap 3Ap 'p%up@-@PpD0 0RPPp03/!APp'pO-@$M0@000`p@A p2@ ̒V 0S"2 0S2" $Ѝ2@0Sڐ2 R@00CS 0SP P / 8宷@Pz߸sPP jT @0S_ ZPPZ@봡P000P000 S`|1 0R  @pP\H B R% / ( C @PP  R  {@PP UP r@ꃸ R rP0 00CS0t00S T0 00`Q RP'p%v%v%u''' %u'O-`0Pd#dCM`s`` `00 1p(V( PEWUCc 0 pW` w@p00S0S P20SU0SRp0sS vS ֶV`p0+S -S Xȶ @ @Q0 @R: bP     (PU 0 P0SA<0OЍVF p p0 %  " Q  %5S' ?p". Q  0?p0T ʎ00勷x. N X0 M IU00 DZ-)& $-)''Q VPC%v˕u˴A-PQU 00CSQHq10SL R@ 0r`0CS00 `01L00<S0S  50qL0S 0CS>S0SSxh R 00CS00 -  VP2p@-@0TP R R R& 1S# 0 PpR!Q QT " "D0600S0T0S 00S0o'' '%t@-@1P @-P>QP +@-@P QP0  qE 2' QA-@ 00CS00 P `tpt ?U UH?U!P0P0CS00 `*G-@Pp000 T` 0000CS0H00SG0S 00S +@' ''P P0  /\ Q0 S//'@-b@0pSM910S5 0SPPT,2C 02S p? 0Sl UX U` Pᙵp2 W`RUQ0@D>T000 0i00 =10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ ''%t'PO-`@T到P P@ႰP ,}P0FpS`@ PCPBPhP34 ZPP`tDa0S! 000*U 00CS0 PT40S γ00CS0 40S P@U00P@`s䃟1 R 0PU TgO@`@VT @c儃Q0S 00S 3@@TP@P @PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X P̱̑@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR )pVP 00CS0\00S в0U00 P >#._ %v'' ' % @%u̺eA-@P P0` pUTA0S 00S Do0@0@000CS0 00S P''' 'p@-H@P02`S@20CSp^V02p'40T0P?o20S 0S//'C-p@`1010r!Q0@S10C1 ЍqXPU X2ļVPV)뷼P 0S Ẽ''T@ 0P/!!R /'p@-8P\2Sp@?<9\Bp'0-MM01`"R !R X"R   1 1d"1!d2S ,LPl1, ,LP L!0,00K@P$1, @T0d<`0P, U @T 0S Pٴ00CS0 ! ;ᘲ00 0$0(00D>S 00 :T<:"!031''T''  0@-`"dy'p@-L@U'Pᙤ0PPp0C/U00p Wp@-T@TP0 0P0 .(0 0000CS0p00Spp@U' %u'A-@R`P  ^:0PPEU`pp WD蒲0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S sDP`0000 0C0'' 'p@-@P@0SH00Spp@00CS00  %u0%u0%u@-@VPհx'Ѝ-@-   Ѝ Ѝ/-@- 0  ЍЍ/%u -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`ኣP$ 0S! l0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 '  W%u0Q%u@-@@%u@-0rSد$0G-p0 P0R(0帐@0=00形=`Ṣ`F@VPpPER000 S=S B`` R`ĥ`PGܠ@%t'%t0@- 4@ 00C00 0 0?Ѝ'I0P P PR00/0@-HP@^ ^ R0L00 XA-鸀(  R Z(p`@pW p0S 0QPU  0S 0S   3/P@P00'0SfA-@ᰧPFU p`pp0S'STP@DAM'PP(  EB"Qli* A-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T  %v[O-@00Sp 00P㼀✠Z  0囝@PU* Ѝ`V Y   [ QʁoaP`0p''0@ R P=R/=R/A-`P0S=SPERPU@'㚪\0\p!0qV@pT 0S vPVpp@''@-1`0@S @  PPV 0 `$ Z h  `R Ѝ@$Dq   R <0 2/0`$ 0R , R  00 0000@!L@0P U U0 V00CS0`00S Ѝ@褭Y0#L 00P P Ѝ%ts' ''-p0GM00`000GP  80  00 Gߍ0  0 g'' A-`p= P 冭@VPp ᡠPfP0D @S= O 0V  @`ЍA70C͆-GMP00 0TGP00$0 0  Gߍ'p@-7X@P0`#@0U<Y 0U`00 0p@'ͥ͞q]ď!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    \$Ѝ'ͬ''`%t'p@-@`TP000T 00CS0p,00Spp@谬@' 's@-P@T@ bPP0 P00Ѝp@n` PP 0 @"Y00000 00PЍp WL'ͼA-PpU`A0  0#0+#@TP@ s0@00`' @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =,@@'4C-pP@0聟rS``PW! 100S T! 0  ЍC^nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  h@0 L @   W P 媫ڐ's@- P`@@P 0 Q   00 00CS000S bЍpQ     R T0000    " 0 "' ' U8A-`pĀ@TP0U0  ᄫ !>!0S R   0 02/0 !00 0000'%u%tA-p`P@P 0`0PPEPvT` eTp` fTxTp`X @V R@'PP@-  VC-ܑp000P0`-S㴁@TQ  @ 0@00`0CS0Uh10SQ ЍC蚪 Z@P=ᮝP 0 @0 0  0 00 00000  0  RP 00 00=S Vt0T 10=S010C0 0P00 Ѝ' '%u%t'  'p@-@PTpu@p@-鴴P@`P \SNP@ xP@ IP@P(P0 P pV,'00@/ 0S0@/s@-@`0 0,`PW0S S0"S U1r0!l%*0S`0T 000 @0C?o2R0SЍpΥ&ζ@-M@ [4P ލS4P@ D0RQH0PP0@-M@ :4P ލ24P@0D SPH0PP0@-M@ 4P ލ4P 0RP 0RPA-@`&4PI0 0SC P3UA 3PPPdp3PJ! 0RA @- 0-RS# 0S0 00t7 Ѝ0SX0 0P0S00 040,卥P$ W0 X X W0@-0P!S@M0SPЍ0P| 0SyPUo U U cPo U ~3P? m3PPEURl|dd,d dddHX O  P  P  P  P  P  P P t0Sp00@D3T @20(S0)S0 0pnp@-@`P'P} 0Sz00CSt(H`t@dᾤoopᶤPᰤ᫤P.@`*TV#`@VT@`V@ @` Q@`Q@`V@'Da0S0!SPpp(S0)S0S pp@-@P=PPE7P.U)0op=Pp0 \0!S0P p(S0)S0S 座p}G@-0B㽧 %u@-$0$0 00 㯧'`%u+@- @ጡ R0Q0\ * 嵧ЍϪO-@`@MsT0pD P-R lRC 5R -R| `$C@P{2 000E @PppGWP 団PW pGP〢倲PE0%S``PX哧pW ;sR R`6pTP`2傧PU W@1 000 PPP@U _DP@ 1 3Cp ICP l/h7 XA@P B@P0S0Sp@Cp0 0 Ӡ 0X` R Q!q *S0 0R dS /pv   TTTs/o4"&  +G%ve }M 0   0@@DPU#}/@0 6   10P x, pp LdDЍ0=aP '$'d-2Џ%v, qYkq]ďД Tp@-\00S 0| 0x 0p0p p@0   PU P@P0P H0H P p Pp''' '4%u'p%v%v%u%u%vp@-@:0@U| 0 0@0PU@0000A d0 R 00CS0H00S ԥp@[@C0PC'T%t'l%t' ''P/p@-@PTp000@p@-@P: 6$A 1|@  < S S  SP  L6 CVyP   $W        @u̅0ST  LlJ- ,X@ |,@W h,t @ Lx@l 4`(TL@ 44,@   T4 @KV ` X@H~x<z 4hv `$r Pn Dj<<f0b(^Z3U@V LHD @>|<@l 0@4TY ,Vt,<*8 $"H@V S  W  2VxApr`VЍ00 d+ @V   Q  +0넑0l  @s+ Tl@ pԟ"-5=EMX`gov|ՃՉՐ՚ՙաժձոտ&o w _*ԐԦԼ!,4<DLN_hnu}ՂՊՑբթհW`h_g."* v!@- , )/&@-,0, P 0 0 ,('N֯&s@-@`000 #S@P 0S  0S00S 0 SЍp*60S/#Sp@-@,P$p{0P 00p'N@-PRP@ p`p 0R" Ѝ˛0"S0SO 00SS  00@O&@-T_PL0 p@0"SQSЍ׈'ט@-TDPL0 fp@0"S6SЍ׷'p@-d@P0S 0S 0SS 888 U   S$PPp'4p@-Px@Q dRcP L0    P    pp@ @ e'0@-@PPM 0SLD00Ѝ000 0?P0 0 ',3@-0S S S8 4 Ѝp S$ Ѝ*ؐI 0/O- pPMPa  R <$, P R B ߍꃿ Q R @sQ Q@ Q@ YT WpZ: R D 03/PUPP'RhUى٬7@-lP$ R\3R@4 H*$0S p (+R R Ѝ0''p@-@P 0Sp@嵑0PS 0P0Ӷ00SpQ@-/PD@D D`DpD0S!'00* gT[&C-P`PM 0S00(p/p0 @P" @/Q `0p0@0P T0p &PH$0@@ 00Ѝ ','iG-@0X T) HRD2D1<#<)( 4 ), ()0 )8 )4 )#4R! )!4S )!4S )!4S h)!4S L)p!P0S t0)T!T0S \~)p(HP8W ЍG0S. a`v` ' 0b) 0 ])0US !S|  !3 \P)0US:3  U02,  B) 0t=)pPچ& e'ڱڸڿځ4" BB l#2 {(O-Qx ,@QdP0QL 4QP8PQ$ 80S,00 80<0S#<0P;PP;P1 QB"8`㠱8X0apS wpR   <0RTP)0< S4P0S9`(Q (Q @P0S0 BS `a 0ph R  R* P*da (Z<K\oہ۠'"ܝ۳Z!O-4+M p*-bP 0$S ߍS YP@T[D@lP 늤 40ਫR ZS$ "$0f0Qf/jK,2!S!R !SS0С1,21S ?1P P @ P0 0ꌡ1P#>00 P,2 S,% P 0 @p#>00?s0 R* 0S 0pj5 P 0S 0 p1Sw j  P@'1S j+ f/jۖ01P P%DP ''GnWEV}}>VEW4"ݖ*'&A-P@p+P` %R 0R000005Sw D $0f0Q $@O  ''J'8p@-0@P  P$p@^$0@-0S ,P'@-P  '8O-@:P,kCM M00 8JP( 8ʄP008ij80p0SP :P  #@00 嬳Y x =P 1(p X  p@ /P$4 X p: 0 $0,P$0S  $02P  P pGGqrP,圙圩$ pW 0S$00s  P$00  P$00$0  P$00   @ӑP pWa 0SY] 0 0$0P @: 8$ 1\ t$ [P( $0S  S;Ƒ8@y0;RZ(( P  d%发P 冑 P0 0$0P$0S ++RP0 0 E |j P 0 0$0nP$0T0 <Y P 0 0$0]P$0`0 H P 0 0$0LP$0X0 7 P 0 0$0;P$0\0 |&P l!P 0 0$0$P$0d0 (P  50$0P$07  P  l50$0P$07 { P  (50$0P$07r jdې P  40$0P$07a Y$ʐ P 0 0$0P$0x0P H幐 P 0 0$0P$0|0? 780aJx0S0S  |uP0X: `X0 H0I0?0t 0 ST 7 6 2Z/ \0S 1 #0Գ000S05 0  3000"0$0 0 0 $0dP )@$0!S D!@0$0|2$ 2 ,@pCލ Ѝ0S 0  QP0 $\P0!A"A0S 0崡0S 0Cs RS񟗚i_|i_|_|j_|i_|_|j,_|_|_|_|i H[0S0 0S Pz  0$S Zo 0 S Pe  0$S~ Ez 0STsr 0 Sk PI h 0$Sb )>] '{Q3x h<rާ޽'8<'@*'P ,:K[ivz߅ߏߜߧ߻', h&Fs@-`0PU V  PC>@P h<Ѝp`PD!J 000@⯱V  huMX$00S @-/00%vPp@-@5S4 0PSP p@<$Pp0S 5S 1S K|Pp5S T \Pp< HPp (( PpK''8_(AdeAdrs@- 1 AP(000(`;a5 S4 5S Pȓ0S ē0S005S  Pt\ p0pP!"5S ЍpH DlP8 VEW'df΀dm%vPn'8dg@-@P f/㋒@'8 0 I%vP'dm0S/!  -3@-P!T \P 0S S@@ XP@Ѝ0@ Ѝ/&hp@-4@4PQo;p@`r" o" @%vX[b@-t@t0MQh  `P0cS CS SS 4嗰sS00ۍ0(0@-MM@` PP 00YSP ,uۍЍ0nP 0 u'&@-@M0 vP ۍ{p@-@$P 0p@ T&'' @-YMM@p p\-YލЍ<0< S <fCPژ10YS<0<0!AdrC@-*0gj zgzz'z'&z'z{zgzzz { [!Ѝ5Z7@-P0@ 0$S0S> '0S6 TQ+BQQ+PN10S+ 8@ 0, 000 C0ASsssstssssstsssssst(c0As Rxq!to! Ѝ0zg{{'P{ zg{{{ { { @(n}@-\@\0MQP  HP 0nS yS0 $倯00ۍ(e2 P `00CS`0p S00 P0S X0X /Xl"&hG-P 0p`0;@P I !pGƒT@Y @ 0@HYPp ERp〠 0  aX U ឃ`V `` XЍ6q&O-@M MhP`X%XTuTT0S0#!pD P ┌P MP'p0 p( P H nTt`(p P  wVP `x ZP<+08 Tt`( p P  SVP T 0(0Ss`, p P  74`P92a0C" 20< S :A$"YAx5|%.A  pY P0 <x5 0AApqAA0 P<0QADx[0x5< 0RA| LVP 0 000S P0`p尀(V R s S 0 0)0`PX<ލ Ѝ%8%vX jxCf jZv)8'&(P - BR0 R cA-P@ R1! 00 nX0 hX0 pbX0 \\ <( H, <0 08 $4 < $}$y$u$qP mT i&0p 1R0S*0X`p\PQ VVlA kdh)8KTdsAO-pᔀ 2MSR R@`aW 8QT ,[Q 0W0 Q  ˆ0@"  8 B,  < ᭈ`@04"  $ 0 !R21`  0S 0Cs RjSg44t4T4  1 0 02 p8QI jT <0P+8Q* 8 0A0R @2<0P+8ψQ *ЍOL0 0 02  02 p} dx8 T ЍOЍ kd4" \i6/BTA-@Pp(DW<`8SA 0`o0/p/0p@-  R( R((,,004488<<DDPPT@TXPl XRl@PUt @ 0T0p  Q CQCQ}C'(@-@t40Pt08Zf/̋VEW0H @-P \PY Q@5VEW'(80@-0@S K08f/㤋'Ԡ 0PQ0//@-oL0 Dl<<)8@8P(` R\ 0]&%vP7@-@ PT倇P0 08P8 0p0  D Ѝ0R(dv0@?o2P0S@- p`PY@P TP OP JP@V@lAPH@T@T }p0 4C@@ Ѝ(du0@-PM xdP@` ]p DC 0 4&00+ +Ѝ0(@dz *s@-@ =p C0  0 0`P   0   0  h0  P0  8Ѝp(@dtR_vM4"N( p@-@PM`PJ p  ( >V V dPЍp (cxH( p 0 C 0(@(d}|(d~0@-PM @ BxP 8B4P 0p0 BЍ0(d{C-`0@Pp!匁匑,M00  p0SP@TTA  yp  0BeP qP p` $0Q 00S*@P BQV%W V 0x R00tP 0S,Ѝ00* *  `@-)& $(d| `4":K@-P$M /@P p phB0P  ?0P 0Pc 0Pp@茥p@ 0xAb@d;p@|U@@uGPpdictaraynmbrstngC <+!* 213/P/(A-PT0p`@,0T@@DA??@(?0@-0@ 202 0刁0Q!Q3(> 0R//G-`pB 0PkE ὂ@PPW 20CS20CS G0(@-@p 2SM"n#^  2" E 2"HЍ@֤"2d`ɤE"2@|X"\4Ѝ@v(%w8_mwns@-P`:  0SЍp00S@)0"S1Ds@-$M@y00  0 04"&A-`P 0p @Tʬ> /, q0d / 0~pq  RЍAL`0S`@D@,څ Ѝ%w9O(A-0ppP@`ph/!14P S H d" R S R 0 glU(p@-4@PL2S0 ( #O0B1p(0/p@-P@ŽQUp@(Q B?   ^ L043c 0PpQ B?   P Ƞ̌ Č @(X0P@-<8B 0"@@$18<4@(O-PLMx0 $0|0#(0p0@00030儠s,4000S9 23LM( `0$ 0  0/0   0 000  0 #,bd"P y= 0,0 "; 0 RD0 $R0 S p2000#1-R0" 4D|D`P@0|p0P00S }P  }P  |}P% D`0D00 S> kw0g24 plU$[EL1L?$S%\2 *P@\2CP0p0PXBp0 X20@Pp0 X20T@Pp0 X20T@P`D`(0T$0000Z 00S $0 0(00 0hY @ PLЍ P @(%w(!&h"gQ&4'=-s@-@500CS0 BP` Pp pp<0 P00CS0A0 Y@oЍp@Ѝ/&ha"gO-a@ p|<Pp?C$0e@O 0|pq Ѝ  R ЍOq t` 0S 0 y|pq `BE,ࡃ X 0S %wg(0p@-"@R  lP"n/ቃ0!!UU08 T0p@@PB @+@Tp((((!G-HbpH@,#Q.PPH < P UW0剔LI J$ rk0,U 02U!U !" +I s?@sό0QlX2 G    <1 81 41#(,$#(,sO$@tr ,! (! $!0000 0 8< 4^0 p 0 8< 4P0 @H20H2((!Hp@-d@0P01ps/Ġ2P@ `^`H"̌ B B$ jH20CH2p(O-Q04 ЍQ\l hX0)S  Z0)S  R0  Q !P#800 0g 0<  P2S8#(v l\x4"%w1S7iUQYyUA-x RUP@P@aЍPP0RB1P@4a4aTSp ЍAKI 0Bp p8 131!1<0 * 1%1 ?01!1<0d  1P 1@?0ЍA ({V4"[kz O-- 2S "$, 00S1 1S. 0W , Q  RW !(,$!(,0$0W0,,0`L$@hd0S, 21S( 02 (, $W P,$ QW  0 W@T0,0`@ pp3"Rk2S |400 0 0 P D00 0 0 PWK (0pD <0 8 0 4 0  < 0 8 0 400 %tb0 @2S` BT$0`pPX " 1 B<0 0@@2 0C00 @@pn2 0?0 @@pGq"??pp1 B<p0 @@2 0C0 0h@@p2 0H@@?0pGq?p?pp$0S 2SHB @TJ0241S$0Sd 0s XPX2<8"0 RS 0 0RTPP0 !01P,30  ,3Q #  h c0c T0<  p@8 PA ,0S ,< 00S< 00@ $o]P&0FSʆ`#P0S -S@= kP00@@P`,0S ,^\^A0 QP t8800   0 R00S' 1410XAXQXa400C0 C0y0S0Sy0S0S C 0S C  CC$0#4 ܍p PS| Ph(H4"lo HeK [a%w  !0/(I0/(I0/(I-@-$@  / ,&G-P`pJy@0S l 0S X|c U TXY0S 0Sy@ H(IB-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @PPݍ Ѝp!rp@P=0PPD@rOP00: S0 RP00 0&PP P81: S  S U r&PP+}+P%PPPU rPP @P(I +V(I*.Hf@-;0P  0 00/$Ѝ  &(M0@-4S 3/ (I@-Lx0 @( 0$w@x@ sp(I@-:x@`ww0x@@-p PL`@@0 7/P0 S Ѝ `00(NO- MM06@  @  @ 0p$000 (0'+P(DD@ ܍Ѝp 03/0P0   PQ @$0PS (0SDUIf*`P 0 W xU euX0YpY 0 `  W p[ 0S P%5 e@ u UT \ 0s@W0SU 000 <:?VH@P 0  X*@5#z @ 0X L0SS  Q  R 0 000 w 0R00 000 0@@0 00R0C0 V B S S `V` 0S 0S(N* 4"-G&a@dz& #@-0v .'&-p@-QCM0S 0P?o20S@@Cߍp@ Ѝ/<墓>!00S# 0S,aQLi00CS0"$3@ T 00CS0!3 P @YT Y@DOoB 0Q  ( @OoB\ 0 @0  0 0 SNT(N8$&h&e2 0@-M 03s0c00@S oPP* R!PP<c 00@   0PS PW `Ѝ0S 0S }0S\0S\  0/@ u\0Sp 0@0 @vp 0S0SΒ @g0SÒ  @"  @0St屒 @D HP@ @0 @ `!0xP|"%#   T`    P @@``a5 s] x Zp h 0 @`(N8(ND(N<.@F4Dg}Ja)G-0@ < 0,P 0S< 0  Q*g  PP`   0`P l %pЍ!URQ H l [s0H00 p?s0W0p JP D2 0?s0Q(0  1!?/s0r 0 1!?/s0r $0 0 02/1( ?s02/0, X0`P  Pd 0SD00D0Dpp $0"3?X0(0R+* 0H0p$,0#3?803?/s0r 004  pl00 PQ  y   0P 5;P y/;pP1S1S1US1S 3S3S3US3S,  pP0p- p202 12 1300pk00 PQ  RP'   0Pp00S 13?<013?@040  k40  PQ   0PA0O A0  :P 4J С 0R  A eY   X`V P0En 06#++R`DX4 $0S,0,  RT0CnD0"P#10P 0 # 0QL \0  0P 0PdP@d1Kg RRaArrAaU  = a   ! @-p@\`P P00 Pj 00PQ | Ѝ 0P< 02/!@ 2/! Pj 00PQ 4 0PU@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  ] ,fP000n!P!G-X` p@PI Ѝ0PZ%V0 0XjVU D8 X0 UX0 P!!O-@,M0p@l@$0`P PprzP$P @,Ѝ  q0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 Sj f0 Q q ,  L 2/Q0r 2 q 2/"  @ "  p@*"*  P0@ S  2"!"0  0@p!"!"X"E".0P s s// /"`"dRnO-`@PpMP0S Ѝ X  H r0A D00 s/ r qh  \P0p@P q x0 ` P 0 00 P 0 00 ` P s0 `P pP0 0 P`8P "k """"#?#\#p###R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0$:!O- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  ( 0 TX  R 0  0 p p P YP  L BPTR2 Q PE$U$$%$:O-X`0pM@HPPdЍ n0Yl08L0  S 0    s   00 P䑟P#б 0 SToS sH 0/MP^ n V 0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"03 0rg0 PQ P QP!%BG-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0SP  R`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@0%V%% Rd%@-?`XP\@#@3P@T@TpW @@T`L(OHO-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0{fPQ P0 Y:0 0 0hfPQ PLF 0 FP<0T 0B(NH&%O-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:&!&y&E&(NH A-@/pp0%B?[`0S `0ES PC %mp@@0T?  C0(NH0 PK* %/(NHO-pcMW , 0 [P0 S@0Pp(0@@D0 0$04@TD0' R$ X0`1#b3<0#0000 0,<0e<00 PQ cߍ0P@4p(0@pD0 0$0``0 K2#  ,PV002800aL0`F08 0L0SD00S   800 2800,0<0je<00 PQ (1 0H 0  RR R0(10D40L0 `0L0C >p h)P.  (10(11  , B 4 0B0 D0P D0[140S  QI@(1  0I0@;+ j P(10(10@4 40 0S\ 0@ F /o@0(0"s R$ 00, P 0k0p(0@0$S@0! 0C@0 0@ 㓢#X0X 0 PP :X R: U$0p 00pP01So | U*0 pPf(@\Q UpW$ P   pPK/\k g0x!P0p00pq P$ b QQ#hQh  0 U P p$pu00000 ,p$@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W v0!L0/r s|!0<80|10W03?1u0U`0 0\}xQ1PP|!R \P PPL0sPP|!=0I|1@|Qx1U0P U* SR   1S \XPP@ 0 00000I1@h%gPP 1|!RH PP 1@^3s00 0Qs (0R} U$0p 00pPu, uX000U\`0( 0$ (\T P000 0T 0P0 00 , L@W $0[f1Sc I`1 S0(0YRhfP0S 0Sl \khMR P0S02S 0S0SV 0\2SQ\L|!-xQP 3PPy 00I@ s 8 |1P .<P PPPPPPL0Is0PP@1@S!U @ZShWfP<PU p|1WS P@ |qppL0Ispp@P !RP~ `(PP 0 1|10|1#40L0s_?00|10PP* K/\jPP05P 5P0h00h0Id 0ES:\P P|!d1HrH"HP :0 @0|12PPp>8 ,z80P$I0 [P0 S0 U$0 P 0o00 0000 0,@ D00S0 0,<0]b<00 PQ80,R0 >PI Pd01S\70!X P %4QIP0%8%\0 P@m(NH%&&&& s&!(OH'''F'c("X 0(5'{''&''(b((())7(G- p@r W pPJ\aPP APp $PK/hD08QP0Q:" 0PS00  Q pUxPh`P 80"8 R 00 05 !$x(NH)Q)u))*)*n*Ap@-@5%SQ%  5%QPR 5UU(&QQp  0Q   0Q0  (NHA-lP`5p@ @ 0% Ņw@ŕ\(NHO-POMp*P* b5S 5唢@TE  vdP@ ET XT 5d 50 1 S$52S$5P ROߍd[P  RR @` d0C## 0 `0 PQ d d0P Eh0K/0h0 g0 8!,qr0d  01(h  j g  g,10,1#40L0sK?00,1001001#40>00010 00 000T0 C`(5,%PQ Hd d0P *r(NH**(Sx**|* *@-@ P (0 5(NH0/(Sx0/(Sx0/(Sx-@-$@  z  !w&G-P`ph@0S  0S X| 4U iTY0S Z0SKh@ A(SxB-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @aPPݍ Ѝp!rp@P=0PPD@rOGP00: S0 RP00 0PP *P81: S  S U r2PPP%PPPU rPP @P(Sx +V(S*.Hf@-*0P  0 00z$Ѝ  q(W0@-4S 3/ (Sx@-g0 @(O 0$gg@ s(Sx@-g@ Pgg{g@G-`MMP@p`PR0 `: SW/ak0P  rR ^g00A 0C @L#!@ V& 0S UP0P`弐0tPPJ0: S,^0"6@PTP&PX 4bP  PPP @v3M`@ S @ S@PVPZ P Po eUE f-@0 S R U>PXt5p1 ""PU00`P00D! @P2  Pf0S`X PP0 PP W80% ܍ЍmPUy eUu TqU ** F* F@F0/p/p@-P@I $( $(0XRX0X00\00`0ddhhllppttpp@-@ P GIDIAIDD;I@@5IHH/ILLPPTTXX\~`\`0p Qp` dP0@ S p@-0@"!Rc0p@-@PHHHHpA-0@PJ04S->CH->C?XH9>:>CH?n:>CFH 0? AC>H}C>GHmFHEnFHE~GHX J.X R  $$((,S>,H}S>GHmFHHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqxH1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,K2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+}c000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@   V PP1+\#b0A0 0 00L B 00 00 00000u0#$ 0 ',"'("&8'$"2&,&42r"bJ 40Ѝ+@-@0S6([00S/0/(Xp@-@PD @ *P ,00S *70 0pp(Z 00S/F(X00S/p/(XO-l2M 0 00<2P0pS@ 020S 0`0 `X#3WQI 0KW0A? R! R   X %|10SI p10SET@Z000@S0@0@ a``0@S.T0  0'W ,(PSQ RЍT /T AAV@Td00S X00S0S@ FP( 0 7(Z(Z(X(X(Y(Z(X\+ p2O-0@4p 0 L0PPQ7, (0R000U00S,  7`P%0SP Ѝ5  prX001P``` 0,00(0S/", (R00Z P000 `0` R0(0, 0 Q 0R000V00S  P0P` "`F0S/"0PS0P X5 P PpX00 0(Xd(Z+B(XG-@PDFT@ppT@@@@   0@S)st h` 紐pX 5pD VIT 8 0 0 00Sp(Z(Z(XA-P`( p@5p0S |50S"0 SRpp5p0S j50S 0 SRP@P@A-P`p@ `$P`P00@AO-HMQM &#0@20 C_ `P/y[0VP(P,0 \`" :lO"0S1 P L000 0$t  HP' $0000S z0 0 Q.P 3 p\tD.Pt3 0"0J 0 3 @p | 0 0S <r  P1 !.P Ѐᰢ L000S0 H \ t 0D0X0x2 0J0  000r00S 2j0 0H 0Hh [ Z0# 030C  4 S 0040FP!]zt1 0 V 0 V000kI000C0 0 S 8   0 0001   p"0000 0 L!0sv  0 00S *n:+(XX(Z+(X%wc+(Z++(X++,,6 ,A(X,b,,G-P`J@pXpAZ x10S l10S 00 0T P4ЍG&@PEU<  1 QP0H 0  P `% Hg0S"00S U  0S y0S GprpЍGcX,P H0 ЍU(X`(XX(Xl,(X%w*n:,,,,-(X0/p@-TP@081 00 @ 00 .0@0 Zp(Xd00S/p/(X 00S/(X 00S/>(XQ000R0SO-@<"P0 `RMhD R0R0aď080S  C/ S ! R 0C00 0@ἰ? 0 0YU\5p!pS 0 00Ϯ0 ?@U '  ϬR8 R  00 \5S0 0/070/  0Ѝ  [ X R  00Lr0 0<00k/(X(Xd(X\-T-;-S-s-Q0O-`@:!0 R0* 0p딑唡 Tp3Qx 0 T B:\5 00TP/<# P 1R 0 0/."<0 P 0T`0 C c 10P0S   0 -0 x0T0T 0x0 T4 , R Ѝ(X-(X(XdT([(ZO- x3MPQ P*0<PX k:$ ` \5 0 0IT@/<#| @2R 0 0/."<0p @x0 +T`0 C c10d0@@b CC c@31B $0Q,040(p0pPßPp0 8+10S 18P0YC9 P XEʰp 08I,80<01h!0<S0<0<0Ѝ U6 p P\E>=EE;=k7= U0 00= 0 S0TP0S<0а(? 0 XTEU p P 0R0SE ?Z0:P00EU S(X-(XdT(Z(Z(Z(Z(X(ZG-1 `pP0wS0  00@ 0S !0 80`S P`P T0p8!0 R0p8@/0P0S 0SpDP0Sp 00S )x 0S0 X0S,p@,.(X.(Y (Z A.(XXB// @-p@`MWP 0  P  Lp`V% s 0S H0S 0 0 $,00Stt, T(00Ѝ@LJ&P0S 00`Ѝn:*  R. `@|!\! 0 S P  P  (    . #0 @#`nP0 P 0 $ 0 S` @00 R0 SR Q\ 0=J([4Z(XX4t(Z(X;M4(X(X44(Xh00S/p/(X00S/0/(X 00S/+2(XO-M,MG@g" pW+# p000SPEW ` pP' PUP!00 0؍,Ѝp000 L(P  8XPUPh0S ! L P }0S, M : : j  W 0%4500! ?0S S :00/0S 0 S :U00#03  R00S <:0S7 0( 2 : 0S R 8P40@S0y4Pş 4 Q)Q90000C/HPp`#p90S 0p k!h 0 0P 080S, +MmT09 S`p0 SUR680S2 U0;Q0-*h0S* 8(d03 (P xK@80S (00X P! @((570S0 h0!&77(%RS?U0O:7<U0030#\00SDRQ7 !0? , V0$00(p ^47 V`Q0tX ZuVPk 8' 0 0pPP6.cPK"kh0S`p&ao'qQ `panq V0 Fp`Q `pt A?7#bp 10S0A[p0 ` Z$0S 1000S 50S $0S 04  p`kt0/F$0S 1000S 50S $0S  ,M 10S0ꊡ  0a000 04 0 S0 0  P00 0!$0000 #600S<40S `4 PP @ p t3000 00S0 LPX00H00SS7 0S 30S0 \P$ !D7@lP  2 pLtPd\2 0\00Q&&0: @000S82<`040T/806#e PR8P<`@hX0@\ SP 10H0K00AFPa`ppPU 0 \;<5 D5@0LT 0 b32 R p'@ `글0d$\5S b5 " XD0/0 EJ,40S$40V SV 4t`V0`@0x@S vd0,E0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0D30qA101XS>  0A00Ϡ% 0 S  s0S\00 0T@T` VT0?  `@@T` 1 0D20qA000Pͽ0P0E!`I00pQ :*p VT0S0@  QX`` @W0`3Vŀ T 1,0`7: @T @0 ݿ 00   ^ RT 1VSd 0P   W *  A 0H 00(Z(XdT(Z}(X(Xx(Z([8(Z(X(Z(Z6&(XX(Xl U(X666([6O-` @ 0MpԐ԰ 0 0  BRЍ :PP U  QP p@` {{p @Q RP Q @p([(X;M0/O-@dMX H0pP0P1P 0L1L H1 0,0SdЍ0S Pd0,`ND0 `00 Pట 0E RpU0 :u`P 0RA0 S0T TX0S P@Spt0D(Xd(Xh(Z([7)&(Z(X 0440@/00S/p/(X00S/0/(X 00S/,(XO-TM`PV`@@M4:0S P *0 Q0*`00#010S y0 GDP0 X P )K P9 `0S 0S \)8L P00 49 < 80R0p00S0100,050S80S1?10000#0%n 0P @pdy _ 0#a70 @0C0P wG100S 0y CP 0sF0 S$ 0S '00qP7}`{ /00S0100,<0z50S870S1?1$'p 0pp00ppP*0S  ;P^ 0 1/`V/PR @p` xpw/ p/#0 #0@0C0Ɵ 0 00 0Q,*0S  P 0 "pWQލЍ0S #0 #|50S p}e0 00$001 (/b,P 0S #0 # 50S ae`0 $00 `S!  Br p /x ᴑ/Q@6#0 #=00C008S< .PRS8$ 0.S ($PPP3P` < 8<#0 R0 *3 00hP2 0 0v<X P0Sp0AS񟗳\\\S$3 00V20S400005P 2 B< 80R0؀"0  < 80R0xQ' |20Sp20Sd"؀0  (P  : S000! *!0 < 80R0 Q   0FQF?h!h  D10 S' Pgd< 80R0 š!ɡ0S  0R ؠ{P!0   0p0P``0P00C0X9P2]  (Z(Z(X(Z 07:(X7(X877R77`8+7q887(X\8_8n8~8889+(XX(Xl7788889O-WM M0AS}(D($ YP 7 >^l hLP P7 00A , 7 7P 70S 60V6 %4X  E0`06`00Ħ100V0:6 R`0S:`@aVxPV~Wލ ЍT P@P   ]d 0S X @ F  LqS 0 00@(0S S㜕u%p A`pG(pP) 5 /  B+ !D ]g850ST 0$0(0 ]/g 0S ;c(0pAp@0pGS(pE p(P@S,piD40xpS@09Y(0G7 @,0 S1 # (R' S000000Y!"!"9 dxhp:  (  0]/   ,0 S1 #( R S),)-*-{ {d ` p0S(0S , C2(p2W ,@R@ )' 0x AT!W"!"dh 0R@ )' 0 AT dx@0 (0S 0$P Q 0  s00 \"0p10S t10!h10!/00C0H10!P0 800000C0!" |p(0S{@0z !0C0v 00@q9 ,8(X9R,6974(Z(Z(Zh(Z(XX(Z9i:99&(Z(Z9(XlMR9,(X-(X\9:00S/0/(XO-В"0`1CĢMa2@Tߍ0S Pdp@FDAG@D 0 ddp:00@00C0 00 R2PU 2PU0p 0S0S)@P@R1PPUPRPU Q0:0000S 00"P D1y00C,(P X PB0P0!!0` 000pSL" gTdXHw!Pe 0 07 ;000pDTt(Z(Z(Z:/&(XX(X`(Z(Xl(X:Q+cP(Z:xd(O-䳟P3张pM/`@ 0i=\1P 0/ |0/ G0 BT30SL30U SU <0 S 3 S  @ 00000CSGTYr! P 80R000303L32   0/=` R b3",Q Q0|`B*k*P2020S oP PA PЍS   OPe?00 1>!  R1W 10SF0T!  0 S01`00/ <  030!ܰ 0S H0S 0 04040c/ $ 80QT $00$0 40 4L3 2   ^[0{ {<0 ,PpC(Xd(ZT([8(Z(X U:(X(X(Z(Xh(X00S/0/(XO-plMX UA2吒吢00,0SlЍ0S @d0,P=0 <<Pc000P㸀 @1 0 0D RpT0<:9`1 PQ@ \`X00X00@SQp\t`d`V %P 10S  0]@P%P 00S  0 0S  Q\ {{00~ xK0Q! 0 P  H 08G (Xd(Z:&(X(Z(X\:;(X,;=;I;QO-oMM@PL00 @0|2?0SX0S $5Sڔ0SXPYX0S $XmX S RLfH?`0Vd2 P\20+! `" d" B[@00!X d"B1h21$\Pl2ڼΟ\0C00p21`t2QB1l2 ?V 2l20CL0=SLq Q\20B <80S 0 ㌎$5> *(t>h>0S 00 0S0 $5B111`R B- 100 S ` $|00S% @ 0帀- 00$%BR0Ө`S<B11D%L0ᠵPP  Y PN 0S  <P| *堀(<<0S !0 00\0 bA?L0<5A?X0 =<0T0.H0?; 0VHRQX0h0@ @0{?8 <48ϠQ b{ S W,0 Sa?^ @PC ;0S @ A>+@B@  C(P4;"  @0\ 0 000D:J*'::0S E0 0؍ߍ0<00<`/  `!.0i0S pd, : 0  000y;!"\Q 0 i0/H "?0ЈSh90m Sm X90S 0`)S 3S 0S ( X0 0h80S 8 0S8`0`80`M 880;."\^ `0 0/dh pN.' `n3&>8+?ᛓ)T<D  0PRT%ͱ|7DpP0W`C ?Q `,00C[ qS  Y0;!"\Q 0 h0/D0刖S  70S P#@6z0堦h &60S 0p&\Q`\uT6PD60S6<650;."\^ `0 0/dh pN.' `n3&>N `$5S89x( 0R #0", 2R #,2$24"00 (2S W08" x S0! 2= 2@%S\2/< = 2%Sd2/?L =W=SL5s45p`Ḡ? ?`00SE[ 2$Sd2?/0?  (2h$0C(2 2Sd2?/0?  (20C(2`D0P ST003^0 `0 D0d]"{ "{ `,00C[@49p ?! |"l 0AS°¤¤¤° 20 2(2@#0C(2 2Sd2`0/0!!!p`Z0: 0`P   Phdqzq08PPN$20$2<0S4 d8 2,"S\2/0?! ! 2"S?ԀP5/`20PZdB9p>90 0 898000$5S `0t63 03080D ` ßD =R ,20,2! 2`Sh2/0^>0^00/\N(Xd(Z(Y(XX;u+(Z(X<;;o;;;;(Z(Z=(Z<$&T(Z00p`Y7 0$S0\000S7呫!"pW`嵏X7 0 %S 0\000S7呫!PpWO-P`@DDT(p | W @5==A-Q0 % C@*r`!00" q0SU 1]0aO0  a*J#1t10S N0 0T 0@# 03A0S4 uY@ 5*< 5"#000S &0 0k@hTP%UA t0Tp Pd0 0S L P<0 0S (Xd(XX%x4>,(X(X(X>D=>(X>b0/([0/([0/([-@-$@   )&G-P`p;@0S  0S X| <U qTY0S b0SS;@ I([B-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @iPPݍ Ѝp!rp@P=0PPD@rOOP00: S0 RP00 0'PP 2P81: S  S U r:PPP%PPPU rPP @P([ +V([*.Hf@-0P  0 00$Ѝ  y(_0@-4S 3/ ([@-:0 @(W 0$&::@ s([@-:@#:::@P/00@-0@S @(XXB>0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPP  hP R 8 4 Q  0/TTT 8(X(X(Z(Z(ZT8 t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/(Z(XT 8T8 (Xp@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0 H3H3L3u/L3P3P3T3T3   h p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0 H3H3L3u/L3P3P3T3T3   EEP  4K44K44h 4  5- 5d0Bd00000P5P5H5H5=CS>S>h p@u0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//(ZO-t4M X `D``t`Apv@L:8D80_ 0 P\lP TЍ0/20 Pp P\QP0S 30S30S tYl3l#0Sd `#SXq P L0S @=0bS  s*0S @"\5S 2 2\5\5" 0C?o"20Rh [řT"40Q%㓈Pd0$"0/"2:010S?,0A1(Ÿ "\ P 0 B0/ 0Sf0S k0āh V0S _|!\5St1\5P l10S(` XA L!0 0@! 0 *- 0S 30 0 00P`U@hPİPPHT* 0R A (X t (Z(X(Z?>(Z(XX>(Y>(X>?(X?=(Xd 8(ZT(Z?T([`([(X\?n(X(X(X(Z??? 8O- 0x*MM08xPpP7售 80S z:P7偮 h0: S P SPލЍ,8H0$hSO 0)00S 00 70 7 9   ̮` Ǯ8 8 㻮[V``Z`P`D7V< J27P Q P 嗦@8P0 0G86 R>0 0p 0<&0|&0P7p0p 60pw>0 H0p p2S # )1P )1P ).rVPZ `Y 4[ 0S[?관X V.+05  F1 ,0\9P趝$ V Q2C/a0iPPe 2Sl3% 8 S20#"20#20PC 2SB4$040404X02P&V20A2T02@2 000C`o1 `Fb0 0l 0H 0/`0PpT#0`P\`Q=S/0P 5` ( 2RV0 S,S#c 5*< 533 30S 70 0`20S 0"|#0 0R V 10S \2RXX0S@}2؂= C ,0x" t`06 Bq'/ 0 >#a0 `0S10S!0 R=S0S lG $000/ p 0L%000P%X30,F4q * 10S W0 0(Z(X@ (X@(Y([@1@A(X(X([@Z@S(Z(Z@ @@@AA/AVA}TAB=AB[B BxB*ABTBB(X\C @CC<CC]C/"DDCDD(XE(XXE$EMEvE:(YFJ(X(ZF(XF(X(Z(Z(Z(Z(Z(ZF(XCCDgDD4D(ZE(Z(Z(XEE(Z(Xd(X(X([`F%(Z(Z(Z(XFr4=SZ0SR  0\p<<00P%X30*0 |00S #0 00S5 0 >0S wPq 5*N> 0:#: 5(1_ 10S 0 000S(SP0q0*1? 10S 0 00<cQ3,hP 0r<0*(2 20S `0 0倂0 RL%r0L%r0H00q" T 000cH00SP4Pr*220S .0$# 0 00L40q"  400cL00S Ps*\330S `0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*'d4\40S +0$ 0 04t R,5S0%45 RS! t004e0SP*$5`50S 0X% 0 00刅(0S xQ$ Y0S< x 0(%0S8zPȅ*5350S t0 & 0 08%<5HRS$ + H00<508S_LP*660S F0& 0 0܆@%D5LRS$  L00D50@S6P<*mL7D70S q0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@ᐪPLX p 1@ Tʰ8  @@/  @!. A@O@@mP 4  1,@&()P4 ' <) QHI ϠR 5l)p) x))pPW)pp _ 9 r3 P. ~P)Qڨ0Q, G 0 0S kPz*:$ :0S e0H* 0 00S O0S0QQ 0 0S 9Pz*::0S 30+ 0 0P O0Sh O0S O0S^Q  "Q  O0S&! O0SQL<Qk O0Svq O0S0 O0SH00<5L080D5h<@ ,5S0SP ,000<0,5<0(5H04e0/<5L0l08%/@%D5*0 <s<0S 0 - 0 08=0S 4=L=0SHm*T=TL=0S 0Mh =c |P'L5s0SB E-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!DtN00 00L 00*>>0S C0. 0 0.P0 @DT@8LH$d0/ C#Lc c,1 0@ `3P Z( \?0S  Q8L4H$0/d@ A! a,3 1=?0S  60p00PX6@ ~<6P0E V0$& 500060S 1S  ,P 5 5 @GQ /U0@ `P @@0 8< 4 0h%S L50S PZLP 0  0  `` 400 0 0 8< 4Q Д A0SXhPY 04 S 20S^YP_ 04 Xh$0Sd<KPe0 $V:PP/PQ  0Sd2Pe000 400Ry c0ScPd0 0 0ipM0S 00 0 0 00 40 M0S 0 0 00 400 0M0S 0  0 000 g 400 0loM0S 0`v``&$` 00Q 400 0`qWM0S 0@00> 400 0 1 1Q1Q,+ 0S A 5< 0!00|!0x!0(pCSq #0p R0 !80Bs00WP ;P0Sգ0@ϣPT0  Qt \  (E/ !0!XD H!](X(ZF(Xl(X@(X(Z([(ZLABLG":(XXGA<GvGGGG6[GD(X\(ZH*(Z(Z(Xp(ZHKHw4"E00S q: S *C   S D00S @-4k * R  S//(X(X\H|1A-0`S hd9*@ TL! 0S<10S,B$11 00 600Sp@+"00CS0pP U 00CS0 P PYU Ͻ0 P0  0 0 SNU 㻽(XXH4(Y(ZH(X`(YH$&h&p@-PD0@0`S 㤽 0LPp㋻(XXH4O-01 (1$100 P 1 P 0P  PPPpp(㙡 @ PT`00 XT V ܣp WP @@ 00p([([(XdH([8([([O-@10$MϠ,"4H`  00P p0 <v ,(aP U  0upP$Ѝ? 000/  ě0P0 0\00? 00QS / Ϡ/'0  8"p0P (ZII(ZIF2O-`M0P8 0Đp@/2#@ |Z 0 Ѝ 0|xPZ ЍO誼 0/  aP 0/ ܼ0Pp(Z(XIT2C-P`U@ (1 U -P0 PP0 0T2`p܀*0 L@D0T@S   8L4H$0/d@ A! a,3 l1 ~0S   x0P00`0@T Ѝ(ZI4"I(X(Xd(X(Z 0S/A-@p da Al a3`Q0 000SR P00@00 0` PЍ(Xd(bd(Z(Z@-0P@T@T^d pA `anj3ƌ` VW @ 0 0 0P0@0@00 Ѝ([(XdIp@-`P@XMX  + `P @%XЍp @-Q    H0@S X00S L3J004^,P00(XXI*IIp@-<`/ `@0V @p% @%*0@D@0 ?0`F0+ B\ЍO' +V(bdfccP\%2R/C-=@SM|QPG 0SVP3V.10S KI!L5 R. as0倀Sp *0S    X0?00S  *0S  ?># $  $0 \# 4$$ 0<$( 8D$ @HL$C0 5L5s0P500ߍTJ(X\JB(Z(X0 \P/Q/ Lœ4|    ,PŒPŃ ,kTPH40S/<$0G-4DP,4$ 40S2 40S. T0SD #3 `3R0B-R? cS*53`30S 80P 0U`dSTSePs_PUU00Q A2P 0S ?/@$@>P`"hR0"00S8 pr003Pb0S* xZ0S* 0R0E>0*X4 2p510S v0 00SH[P10S G 1TQ d1*X1`H10S I0 0H10S <G (1P 0*~0`00S '0t 000S d0P` 0br 0(G%(Z(X(Z(Z(X(Z(X(XXJ|(Z(Xd(Z(X(X([([8([JJ([([JJ(XJ(Z(XK (X\(bdK%O-@PMp8 R3B\? 02 ? Q00PaV`` 0[ΑYP )l"0\P  0@" 40/ ~0 ( 2 r0S0a Sa 0!S 3S H0 ? 0!0! !0!S`0 0 0` Td!Ϡ 0 8 L3R 24  B # R#  B ` 0Q" @*0`0S `A ` `Ѝ0jS  $  B$ $ R $  B (Xd(X(ZT(Z([8(Z(X U:(X(X(XA-Pph0``ATR C@P<u0S @ '1p0A(ZKE80 0 1S/ 0S/(Zd0 5 /L0P 3 SP 3:.  SR///(XdF^QO-0(,P0p4@8`7 P P0P` 0S 0 S   0  0000 S 0 S H0 w0    (Xp(bd(ZQ/0/O-@8`夠 砰P8Q ЍP@p8Q Q0pሀቐp t v v0` Rt`P/! 0p P  C1p  1p @- tHKa0` RL8o/ 10#/C!000P/@- tTKa0` R  /  /C! C!/! !/@- tdKa0` Rx\@4  /  /C! C!/! !/@- tqKaG-@$ uQql#`h RPSq p$ Z!Y  @  T*B\ !B a ! L @DQ%`L  R V@T@ ^@  `R A G-`RM@Xr HPP <P`, `pnP P8  喰p ;'0S 墖ߍ<08 0(0`0,0 000040!04 04$0D0(0P }WQ  hmpK Hgp  <8` 0 % n o o o o % p 4`?`a8SVPb 0  00*0P0  0 *0 K}@dAdeK@dzLLKKKKKA-PCMMPp`;8 p@P  P0>PᐮU 02 " CލЍG-`MMP@p`ïPR0 `: SW/u*0P  rR r&00A 0C @L#15@ V& 0S UP0P`弐0刯PPJ0: S,^0"@PTP&Pl H!P  dPP @v3M`@ S @ S@PjPZ P Po yUE f-@0 S R UPXt5p1 "PU00`P00D!⫴ ⾭@P2  0P%0Sƭ`X  PPᵭ0 PP $W80% ܍ЍmPUy eUu ϮTqU Ȯ** F* F@F00S/p/(X00S/0/(XO-pT1PL1@00ʟ 0) X 3#ˠ121` S`0 Q䐟a00!R00S B% 0 %#s(0! RXh000R T00 pp8P,0(Z(Xd(bxLC(XXD(ZLY:(X 00S/=(XO-,Mp0`@Pᄡ0V000,Ѝ00 ?U0$p$00 0000P$00S 000/$ P0 0 0 410S t?$0 S0   /000P+ 0(P0$00 00{0$ 0 { 0  0S     `@`00S 7N(Xd>>~(ZM9(XX/"M\/M|MM+N(XԷF^^FM(X+(Z(bx&N!DN9:O-1APQ P1a`3$MS0_ 1P11r00`q00 0p000P0@T <)lPXpXT 000/ 0cP'0Ġ[@  0S >  OP !PD0$ЍN(Xd7>>~(Z(Xp(ZN*LNT(XXNN(Xp@-P0 % .  @Q 0S pP# #30l0# #:>00@0SpP p(XdF^(XXN4NNR/"G-P $` 0pV@`0 @`` V`@&!D( `G-@P4S p`X30剑zuP| | 0 0! ##P 0p`/Ѝ_ uP : F^ :^Fp@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@40P/ Q\/O-P5>UM 1!0@`Spp$`J0 U  0 0n7Π ^ÌVQ 0V>   P" G Pa b72 R0 V1Q0V"   P 0$P ` U `P`PЍN v 2O$0A-1àQ`P x0x xx0@Sp$P࠱ ` p@QL ࠁ PQ N v eO$p@-@PaSl0l ll^0C800S   00080P4 PR*Sp0 OB w O$OX ,0S/`0@-0@  L<,0,0080S 0  &0@(b|OoOX w# O$,0@-S ,0, ,,@TP ؔ@ՔO w6 O$O--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D5@D0  0 00Pe U0#03?W[[USG @0P$0,5Q $KO0$0 ዔ9D 0XR @L"!H08pp(0

O$P ?C-`@0(Pc,0S0 pQ |0l x@PEU 0P !  0 P P ЍO w OO$P QX0sC-Ђ0@ P@` 0 00 0EP 0 +Ѝp(b|(ZPX0sC-Ђ0@ P@` 0 00 0*P 0 Ѝp(b|(ZPA-0PQ @`p0P R   T0! @P 8i4P㨩0(Y(bQ#(b|QxQX4@-,@P,0S @00(b@-,P ,\  D Ѝ(bp@-@Pmh0h 0 SX0d0R 3?p@006.4 Q#3RSpp(Z(X(Xd27@-0S S+,Ü2 R0 ELi `Q |x7PCAaQ* Q( PD*P <4B 5*< 50d30a3q 220S u0 00@ @7.Bt#|3 Ŝ ' 0 P `XA 5*< 50d3<81,10S @ @0 d3S, CQ,aQ$ 0AS#P 0@a3d3*0wt00S  D0@ S Ѝ04(X\(b|(XdQ4QQ(X(X(X(bQRR1 @- o 0/A-pP0`R@ @TW8$ A,O-0p M##$0H@` (0,0h3 0SD XpP(s0SP-$ 00#@ {q*,ѐ=lU tU bU8ap P-, j P@0( 0I 0 0S 00 040(`$0#!,00^P PpV0 VЍVp F pUP ` CpHP`PKV:PGVX  9P Up,$$0S 000$4 ! P  0!Zp  0Rp 0 XT  l X0 P0  !Q P0 RJ& $%x@RWRvRRR2S&SG-@Pp 0P`6oW  ;40 040G /40p040O-0` mM$0P@t004080 0 Mp40S+ mߍbP AP LP X8ȏ4ƏcP iP06 p8} 4@K0 0H4: S@ @0(0D04,0008`0]P 7P 0! tST` pp 0Q= $0 ! $∑匱-@P 0V$0 0/S9<<`V $pP)pW<U0"<<7P0<0㸡`P< Xv áHp< , +n?C0 n?< n/ᓡ0P < ᤡ<!$ 0#$0@0P!S `V|t 0S `0S  R$ R Z m0$H 8 HPp`G0$pS 0$ pL }pCZ 0 PQPQ0 S R `TVS& $%x\S@dzSSST_ 4TTGTTvTO-P-@p`,M,$P p($0S0$020S'$p# P V 00 0P0Nd0 # /fP AP PP \pP$p,Ѝ`P0 `P , ?o  0S0 00 ` p 0Ppq 0p U,p`U & $UU%%xtU:UULG-@pP` jp`:D10S:  p o09 6X $$ #}p+ P%W00S $$ mp YPPU `fV rV GTP$$  Qp$l<|& $UtUUU%xUp/0/ @- 8o A-@P`pP hh XU  AD<4   AjB&%@- 0R0Ѝp` P@i0Q  R SR  R $$00BR R *P0 -) (P/00#s01"$# wO-`p  @W@ @T  WP00 Ѝpꄀn>6 \  dp7 P Q*" ?    PQ* @ P*Q*? #? O-@`P0LLp@P T \0᳠ 0S@P 0S@P 0S@ 0PP 0T# ?@TSU:[*%@@6 p0 7 0Pu R0Q @@ 0B R ! 3OG-(`$p@PP 0㘤I$0 0P Q fPЍ ɞPC-(p$$ 啒S%p@ 0 `P Q Ѝ 叞P404-@-0  Ѝ Ѝ/-@-00@姍 0 Ѝ@ Ѝ/-@-P 4(ҥ X ㊥Ѝ Ѝ/BO-MP`p@P(Ѝ 0PW0 SP 4S  0P@T=$Q 0MP 0S 4S y0 40XS$ R g0  ᩋRG20 0 !|0`!u0 0 0  @ 0P <0  Pw < t0T됩'P*``4`VS ڴ 0v  ` -0  p`P@ 00PY: VVV7V[VV~V*VO-,MX`\@P$_ 3R 4S 0,Ѝ0 P P0   RSRQ" "S 0 d000 00 @0 9P֊4S0 S: 00 000 @0 0P 0 oO0@$00SS P %XPp'xp   0(X$0@S4S 0g$R  pP[0 RS  0   pPN P0P 00000 0 P(p6VUVVVWWW(W:G-`pHMP @P(5@TC^t# E@0$4$ 0840 ;p+p p H4$$: S R B.\ pL $4S@ ($,40-B.( ֝p E0"dR04<($$4,4$t0K>Ѐ 0 %0E  Z00`d$t؀E0 PQ0`0 Dw4S  0  Pp 0|p 0 p pmp| p0 ppt P )P 0; 0 SPp5:Ѝ0Z hpW"WjWXeW@dWW@dWWWX X<@-@P 4B BRP ;p 84  'Ѝ@ɛЍ@dXrX@-@Pp P P4PS 4 XYY)A- @PPvTr 0pl`X` gcp0 pYCYY$$ @-@@T@RT ńCs9 #600<0$0@000< 0 0 @-T$0    O-`P@p M6`(LP̀PP `00000 따 V:Ѝ 1 00 0P0`P1 0 0P UP lYq4"Y{&YqC$4 A@- Q@- `S@l)ЍpP @P < 0R00  -)YYYO-P_o 0R0`@tMR(0S00S $ 0R0oU tЍP PU 0SIpWF (0WSB 0RSR8$ 0R SR.pG-0[ KP# 9/p  9/p 40 P m0 $8  g P P  ^P YA-@pP`sP 5/p 4 5/p 4 zYC-(00PS4pR Ѝ$d@ 0  0 0d`> 0 0  0 `WP YZZIO-0 0P媂p@᐀删T Ѝ`  P `V Hp  0 ㆂ@-) {Z}A-P@$`$p0 @ޠT {ZO-Pp$M `@Ȁ뼰0     Q P Lx0 p `p X0 X p`K00P0 5 1$Ѝ4" { |`ZO-PQ@04 p 00` ЍP P(U0 E `P0  t  0 4   04 p #00 #p  kZZZZ0s@-SX`@ Pa0 ?o2R0S  <Ѝp-)Y@- iR sR aR p`  [p@-P@P (`Pp p-)[Ap@-@T 40`PPpp-)[\iR@-- 0 aR bR LR( sR% tR@sP 0xP0S`00p`(j0 [-)[np@-@ M\P`P0 0͵0,原0S ∟ DЍp4"[G-Q@PM Q  |ЍA~␀ p$y`P pxhB~0 00 ` 0PP aᐅ[g[[O-$M@p#P tB p $ЍPP0  0  0` H0$0V!<#P0* Q P`0 0?V `S0S PV0P `E0t PU0 op $P< 000 00 `P  4! `00004 40W0000S08pu $$5 3 M0KH R*F0P01 T0P=Z-:L0SX 0 pO L004 0 00P0!!P= 4$$  J 4 Pk4g4c- p〰% [\&\A\_\y\\10S 0@-@C^M E$EE$4 0 ,Px,Ѝ0 @1q !*#0 p0 \zX 80 } DP<1& $%x]]^^^(^?^]^q2^^0$ 8fO-`LM P4   1堡報D0!垇p  0S# x! Rh!LЍfR lRG F 0pS   P 哞@P  K @ 㥁PЀ  T ? 0˝ @  T -@  @ )P@ p^-)^& $4%x&h[\^A-p`(P@ჂP0 p!`P @00 0$0@-@P$0S 壃@蠃O-pP 0 `0Q 0`0P0@SP 8@4(P<Ѝ_g_ |`_N___XO-4Md@`P 0\0T$00X,% 0 0 0 004 0  0$0 $0 04 $0,0tWH 0Sg   R  _ = R  X 00S(00 0( `S$0 0 $0V0EV0B$00$` T0  00dP  ( 0,0     ` p4ЍT0 0 (0 0(00 0 `0 0`V00V(00ppO-M8pP <EJ`@QU`@0S @ `00 0 0 0 0000SpQ `@Ѝ 0 EX 0ZX X0 0 @X` 0  @S` @@`000Sp ` 0 @ ` 0@T` T#U` @ Q 0S P rUpP 0S 0 SU Q 0T P fP00  T 00S0p` @k` `$`H`i_```P/0S//P/0P/A-AP  `pSP  0@W S Q@-@,MP@p`ZP8,Ѝ $ p`gP _[@-s X@P HHH0Hk@@(:@8P8`@8TX laaa&a |+R R R @-@R R/////bap/0/ Rp@-0@P! R!(<<<<<x< R< <<<<<<<< pp B R"Sh 1@\ \T0 LP pppppppp |b(bbO-0M `@P :PЍ"0PP X8PP( p0Y:4S 0t $48PLgY:-P `PP04S ڠ0"S1@ n0   <03/p! 8 H0 ;0(8$0P  0S  0(0 QPEpbVEWbb |b(bbO-0P`p4M8,0  :p@30S,`S^P 0! z pT AT fT @4ЍsT0 0,p00 00@!pq 4 `0}p0 00$04S 0Q41!0 N R? 2R502F. Ypop np 0oo`@ !dp@ R@ 哘0R R 0S 0S0  00` 0` 8 H00 $F C0 Q`Fc& $c$%x }p |c>8Xcsb(bcWA-@ĔQP MP  An``llph`p>P LЍvp ( 0 gcccG-@Pp* U$4 d& A~ĐĀ p$$  ?0 P`]Z`` 1d0;p  HU 0`$0B~ 0 cgcdG-P-@"Mp ЍG20S`Px 4PS  4S  ЍtW P tWmP 0 Y 0PQ  WEU 4S 0Tp pP2J0 0 0 PP ,B!?o  0p 0 00 PHpU 0V p 4S 4S 0 P%x& $d5dLddU%U:UULd@-g|g`ggC-P0 @p`$M!!ᘑ P ~p)0S00 P 0SO0SL P\^H 0T' 10S#!Q` .NP. a@ P P \ddddddddTfpT ZT  3,$ЍP`g& $%yT+p@-P M,@(`&"3X …P0 0͵0,N0S H Ѝp4"h$@-WM M`p'@T 4<G0S @^P< P% $4 $40 xx0 sxP x xx 0alm0 $8PL#</"Wލ ЍhAhYhp]*2xh-ijj0hHP  H8HP  42HP  ,HP  &HP P HP H HP @ HP 8 HP YYiP  MP ZPY LFIP @P ,>IP p_P GPU U}"80xRx rHP P P2"uGP  iP_ ^P^  p $ 02#W: LHPN <^PPH [ 2 " FP= 0!xx 2HP2 !0xx 'HP' 0 GP 0 GP 0 `GP m0$ 80S iP  $U { GPp@,0T s00Ѝn~-)& $%yn nn4~ko>ɭnnnnnnooo#o0U!oNoX2oaof Roooo u)W&p/0/O--@PptktM vp T;0S DЍO 0FS iS ;`pC>؀C$TP W ЍPP WPl|:PRa0Ph0 `^PT00 $4YP,oT^`P ^P 8 YP[T8 {EP $8  pQ< p GP <XC P < hPr0 Q00000[00$0000S 000(0>^P :^0P,0 hPP ؈ؘبwU`P wU$fqPP0f< FP <hP h*P H EPn DP DPh L0 SH00T0 RP0( 0.`0 pq 0S$$03"pq 0`~ᖄ$4P p`$$勄$4P` V<]`P! ,]P b' ]P g0P$0+800 $T`P$T&? `0 qpqx DP 4xo h DP  P DP 8 DP    DP   DP   DP q yDP   rDP q/  pDP q?Kr?t 40cDP r?1S 0Rr/0s/0{0r?0,s?xr?  BDP s/ 8DP sa$$ʃ$4Pk,fPc GT`P GT$4` 0pq\8 x8D EPR DxP D p D |EPB DPH CP7  (CP.  dCP% D DVEP $ DB@ CP @ Y* 0C$ Bx $ PP$$03`"Xpq$ ;X$ .0P"]  $p ( 8X0$08$Y1T0P R\XM` $4pq|_$$$4PpY`\e0$$;`"pq@$$؂$4P `o& $%z-)od5oono>pooXp)RoapDoo p~pgpppU!~oNUpkɭnnnnnnooo#o0qu)Wpq;qYqx0@-@M P  \ 0 0S[p< <o 4p$g0Ѝ0 qi'q@-SM@P, V0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`p2 .D Sߍ@iqƀiqi!q@-@   cЍ10S/p@-!MPM@P% PA. (01jP A!.AkP7 0`0?oS c`1 06P- 0H,T0 0A. 00P0;P A A< 0  2ލЍp`+0 0A. 00PH0P A4 4A@v`(c(h4"qqrrrBrs@-6PP 偱P z -`@TЍpP  00SRV   㔈@ rL0 R !O-M@ Pxp.p"B`P"  p  lzZP- ?_sZP:nZpP 3_pxgZP ,_ \@P 0"h 0R00  p!  @Pr 0SohQl @ 嗂pal ^! R R RZ  0PW l Z XɰX (s<W 0j0S, @ haP@ `[pd HQ L 40R !01Sp0S 3/p\ U 8 X<p \ [ 5@ `/p Ѝ qrLrZrbЁrl*rr{rrA-p;Y@P@YPPBY[Y POPZP P`PP@- P0 I@Ph奮W\ P@ L㜮@DXP 4 QlЍpt  st)t;rZtU7@- P@:pT T|LW P@00 <<g0400X@ Ѝ0 rltmtwsrZ7@- P@p\ \U0HH@W P40 00:W@ Ѝ0 rlrrbtwsp@-M`}WP~0P0Ѝp1\P@Uxi@Pd0 D(p< 8 P@ PP k|tttit@-$MpGWPH00$Ѝ[`Xi@Pp 0 XpLݭP@ P`@ p$׭kz ttiu@-C= Ѝ4"u0@-M00 0  PXp `i@P㧭 ` @Gpp P0 `pR00bS ʄNk㸂U „P ixuu3uY*s@-@`+PP  .p pm0urp@-` MP@VP p[ Ѝp P)    Z  PV@kLDy# iv0@-,M@ Ps=P0 # p,Ѝ0 R0 s0S 0  "ZPP  (V@5LDu  fsy#p@-P,p@`@@BVPH0H HH[Q P jptw st)@-T @=P#00Ѝ  p  du *@-}u@-M T@<PD0D DD08 0 p$`dЍ <  sۀiu@-M T@<PD0D DD08 0` p$?dЍ ?\  sۀiu0-M $00J P  mЍ䀐it@-@0U P$0$ $$SV@tmtw srZ00@ P/a CRWC/A CR=C/@-00@- M@ =0( 0 p- Ѝiu@-PM `@@:n{G 8 8 ⌃Ѝ$$= ?4"uuο@-.@TPP mpPL``P00 00t0@`Vm`` PT0d0X @ @@@@J03/` $u%z`4"uuv&v////0 L0L0/%z`0 T0T0/%z`0 \0\0/%z`0 D0D0/%z`0 d00d0/%z`p@-@pP 00p00D S 0A0CS0$P>P 0@p%z`@-p0(cH 0`P/ R/%z`0 O-4M@@!2T0-  DP|pğo?(p"WD@P`T `P 1sexT6| P`P`@ .p00KTp R  P Q R07 0TS $P\(P  1/P #{@0S  K|p 0$ SR(0S`ת\ 2/P X0 [ C (cHx9;xGO-MMPp  X p`$㯪 pP$ 1  $ǟ- r :|pJb et -|p Q X 㶁8 p$0Q $_ X@T >X00@0 0|Pс@U 0 0& ,0@4@{p 0e0Pl0q 0X 40,@{pDg 4<媁g0H0S 'P31囁H0S=I0S:Z`@T 0 3/@: " A렒M0S:00 % p"4pM0S  j'@ b@03/@r JⳚI0J/y{pNI 1Rɩa`"%J` 1 0 d1 T|p 1 d\!1 H`@#%Js!1 @ t1 x!|1  㺀P@Tf 03/@ 03/ݍЍ *qx]xkxixi~yyy %z`iyiyyz(cH z#y*yyi~xQ Cgz3z<zFzQziztO-@PpP  p >T Q@QPT!*Q8`P \'PPU D1O0S TEHCH>~W oP.Z  hP' ;P! K0S 0 L0S 0M0S 0 N0SO0`S PPV  ur @z~(cHl&@-,MP@vpP  RP`(  p0S h㮨 H8P00< <墨0 $唨,ЍrP}(h(i8} }}@-P@ҕ0 P倨}G-@QPP0 n`@ Y㔀VpuVϛPP  Fpp H H@@@f@} > 2~(heus@-@{Q@P00ЍpNVPAVᛛ@P <` FPeu ~D(h#s@-@QeQ@P|0| | %VPVr@P T` Peu( iЍpZ > ~(h#A-@"6QPP0 `@UUAPPp ҕp< >FJN@ > ~(h~O@-@ \7PP0P PPL 0 S@@00 >00Ѝ~W  ~(h&~a0@-M@PPPP PPpPP d0P P P Py 4PGp jЍ0Z~D}(hi7~s@-@彔h~ P L~HPH` P! ,~Ѝp~@*~ ~G-M`@PK _ppP"((  )   xp% (( px" <@T t8P~l2P\{~ UR T Ѝ0 P&Asc@P $@xp !S~t 0R J~k)~ ~` `p=~tQp R%P\3~ }mLP;ЍGmdQ\ 0Q    1 0P~P0 RSғ ~~ # }0` R P U 0pD` P\\\rP q(i8i~~ ~~}   x4" ,$-Pp@-P`@NP V  O`P rE`oE 00pNTpaEA-@T ~00`PpU0 p `@@-MPPb00Ѝ`0 00p0@ 0 P S0PJ 0 p 0 `P0G-@(P600!`( p Q1r0P*0X 0U0$ 0R0 "00"SЍG0P 0 , Yp 0 @0@-@P D@ O-`@pP,(0V0S 8`P$P$P 40S 04S 0S(0p(`8P0S$0(P&cO-M00 X$000Ѝ 0Q`?  0Q> 00 5PP; XFИpP ,,p=,4@[T /z@P00 D-0800 0STz 2PP]0"勤8!10#R0 0l8[9bP Z@  0YPH@T 0CS 0 0r xC0X0^ :T 0CS wR0xL  @0aD\W@DAD\ 7@Dt@S 2s0@0t@0@Dt@ T130Q@aTp t' MPJC@ HFC0 0 0`0 } 8t;tUA-X Pp@`8PJ00<0PA 0 p 0 `P0O-P`$M@ HpX8 P W0  pPp` 0p0  0Tr*zO-PMM@ 40L00h4 T4PL4'S$0P0@ 0 0 @PE( 0RtP 0S0'U 09 0909 09帰090909Rr(@!!0 P k0 /C BRZ      -BX9$ B2"! 0P PE ^r PE0y900IppcppCppPpp Spp@BppA`8 0PP0` q!0tX@"0(0(0S@ q0$ 0B'S$0؍Ѝ 0 0 (S   BS>C0C''S Q:ǟ"!! CR   ##9C0C<"!% 'S>C'>C2"" N=C0C Q 0*S ;S. RU 0C'S񟗸9X999l9t9999999999|9999999999999999999999999S44h2422242S# St 0S R S8Z 4&S0U 0R  t t0Vq0( 0 B( @U0S 0S `pBq븅帕帥pW>p 0R 00q`|0Sl 'q0S `p0H00 <q45H3,,娀XP0  @ qp` q0S Z0$3?S Z^0S  -Pp0S xqp`p`ov`pDW1qv `pov`J, zX4,003c1s0Sa|qpw ,, p3pGx#0P# P# ß P# hp`HH#S0S Tp0S0  8p+S }p0S#  wps匢 `0VV /r  !"   0apV" [p0S HqSpw0Np` pov`X1pwp 0J,0Y 20, `&#Squ ,Q, 'p1H!0P! P|! x Pt! TpLI  plhd`\XTPLHD@P4iY $Gt(i$(c $EJ*C44" P(-2P9 PfEJc ,q #,5<Pp@-P M@` QP0 aPp@@O Ѝpi@-< @'P$0$ $ Ѝ  <@-< @'P$0$ $ Ѝ  H0@-MP "MKi@PۍЍ0@O P+ gP@yOۍЍ0@g0S0S1iS0@-M TPp@@]OЍ01 咗z@i@-T @'P@0@ @@yI \p {Ѝ8  TA @-T @'PM<0< <[  >p]Ѝ 9W  ^< 0 /%$/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0f-@-  V|V ЍЍ/@-@iVh 0S/@-(il-@-  `V\V ЍЍ/-@-  RVNV ЍЍ/@-\00S 0  0000 0 pЍ(il@-@9gHggp0}hp Xp@-pMPP2 P0S 0@P 0 0 00 0Xp DlP@@ ((@,P0P4P8PS700!031 0@-Mt 0@P \ҕ 7QLPP @ (@@ 0P 020Ѝ0%((it@-@0P ,m  mj&MP@-d0 !T| T@0!6q0\ (0000/ h } P@-`0` X| TD0!6q0\ ,00 00/ h } P-4s00#p^0<\ 0000/ h } P 4ps00#\,s0P00/00 h } PH- 0:# ^4 0P$0000/ h } PH- 09# ^4 0P$0000/ h } P 4 <# \,4P00/00 h } P- 0:# ^ 0P0P@d|0:0# PDD#^<s0\ ,00$00 h }# @- 0 00jP ЍE%0A-P⮌p`@WЍ P 3MP@ p7@-P@U0  ( (R Ѝ0pA-0@nS0oSp@ pbP``bMP R0nS0oShSPPcSPP'@-d0 `lYi&O-MM`<(0p0 0D@00 l0`p0S SH N 00,00 勏d&p@-@PJP (偏0/Sp)p@)i~@- gd&O-p0000@P`ᜐ (,唰00 Pp0@DTq oP0 P~P<B~9 O4& $-)-)n~ L@-M@A>0 0D@00 l0`pm0S SH fSN 00,00 2d &p@-@P¤P (0/Sp+)p@')i~@-  d&BO-`0@P(,p娐娠娰0 Pp00@DT oP0 }PP}  cA+On~-) ,& $@-MM0An H 0P0 $@_p 啎cw vp@-@PPP (凎0/Sp(p@(i~@- fc&O-P@M P0h`r"Op)20 R. +x   &  x `!p 0 *00)0`Vp_pz /uPfPMP9 9P$ GP g@Pccccccccdccccd0cUP|0 0|00|0|00|00|00pt`x0 |P|~PyY_p Z,0p0Y00t0V0;;0x0UEw`$00|00|000ЍY00t0-)& $@ <-MMJNP0 @P300 x0^p0 \喍0 0N/ 8 ᲂ000 0@(dbv |7@-@P F0Lo SϜ 0 a Ѝ0A@-@B@0P@N@-@A0P@7@-@ E0S 00S0?  5ЍSp@-@PP (/0/Spa'p@]'i~@-7@-H40 0,0,0(0(0$00 0=e6b&S7@-P @EP00S\ 0  Ѝ08p@-@ PX0 0(ppPP(ڌPap@J(j`wO-@H pH 8444f Mp60pGWQq 2@FPj8jhhhhhhhhhhhhhjdhjjhhhhkhhhhhhmhmhn,nhhnhhhhhhhhjpjjjhhjhk hhk,hhk8mjnn n8nhnTnp40S = 4 40S 4 0<007aE08:h$0000000D30@90;g)P04P 0I 0(80@008 0zPP0       +  @   ' B ,# R#  # R" , @ ( "  )            Oz20  xGz0$000 T=z0 000 03z0$800  )z0<:00 z08:00 z0@900  z0,000 |z000000Dz0909Rf01r`0$000 0 0tS0,0wL0 0xE00007000+0t40 E Ѝ%%-)& $(k(k(k (k !rZ`is}% A-RMMI>0PC@P@(0L AH`q儁( `L0[pS0KSh0  R < (Lh0)%&`0 ( h0N/@  PP ` p,P.`0TP ?P T0Cb0\ $00X 00@00\0|00x00t0 0p00l00d0+bRݍЍ|(k p@-@PdP (囊0/Sp$p@$i~ R R @-~/0@-@MP`p 0Z000 [PPЍ0P0 0 0[0 Z0P ~s@-0`08/00@P qZP0 \PЍps@-`P@00!  PT0 0R0S PU @m@k 0aЍp(j J(002P0/0S" -CM001010 000000 0 0P @-I, (fa9H00Cߍo/ RO-Mp8@@`p* P PPD0$00 040D0<08P0,(0|0PF0<0P<0< Dp PH00Ѝ0S R@ a(jqr ^O-$MP 0UAp@` PPW V0<00$Ѝ 03/ Y0p P$ 0P-: Pp ` @P LH03/pPA0 0Q pW@ P  } AQ Q Pp `0  ` g'A-PMM`p//a P@1L# N4ApD0@@ 0@00 0p@0p]ߍPHڀ@T ,(jG-P[ 0M@'@0P` :00P`P#T  00T 0 dP  4#0( 0``0 0S0 V0S00S0 ` pp  oP 00P0Q D0D00V 0 0000P0P0Ѝ 000<0(k(D|q(j--0M 00H0 @P (i= zg Ѝ@- `]&O-P@M$  0N0p 0@"b0"@0@ "cIp20a0CS g@P{@zzzzz{X{p{zzz{z|0p00@0ⶊp ! 0 vPv J{P 0S Q |ڇ  dӇKz \!! 8({P 0S Q   -z ' ]p l+ݼ!Yp t 0[4S08pS @p @Ѝ?B-)-)& $# p>Cn*@-MMCN@800 0@(00 0PXp d 0 ^"^!^(; P(0l^,V: P ,0T^0L^ލЍ4^(^w";GTdu7@-@P ?0Lo SϜ 0  Ѝ0A@-@90P@N@-@y;0P@7@-@ ?0S 00S0?  ЍSp@-@P᭜P (0/Sp!p@!i~0/p/p@-P@5 $( $(0XRX0X00\00`0ddhhllppttpp@-@ P DD@@߱HHٱLLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@P᧱ᤱᡱឱpA-0@PJ04S->CᏱ->C?X~9>:>Cy?n:>CFt 0? AC>k}C>GfmFbEnF^E~GZX J.X R  $$((,S>,:}S>G5mF1HHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqxẰ1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,~2.0) T U0+P0sC@p/0@-@R 8< M4 M0`! @SP ۍЍ+'000 400 0  0  0 0 0004 QP S<#0#$0 2"8<"4"rb ##̠#4rb2"LABLQA- brs@  B<᳾ PP1+\#x0A0 0 00L B 00 00 00000u0#$ 0 <',"'("&8'$"2&,&42r"bJ 40Ѝ+0S/!  O-,Mp0`PTXPy $ E$ 0P. @T 0 bP BPG@U   Pxph@ @ @ @g@p \0TU @ T0 0D dS1R 1"P  T8 DR0UQUDTP 0  @@@0X R    0Z0 p00 S   T,Ѝ0 00 $㚃0 (k"R@-@ PU xx[ppy0h`SPP\@Lp0SXD0D,[  [@(k&d 00S/@-X(k0/s@-P0@0S 00S Ѝp@T0001!Ѝp@躲l0`1#ā0P029V rB 0$Z"XXЍp(k(o(o(o(o5R/s@-@00S#000S 0 Ѝp@胲?.ă\0P`8V O#‚ 0Px0 `0報 C c à01d0 P CS cQ0@D@ @00C030S300C00  0#0030 #300020SNd 0A0 a/5 0 ST0T00  B 0Pu SX00԰W,ڨ0d0? 0 0A0 a5 /0 Ϡ Ϡ,,3 0Ϡ ,0/z00C000 \qS T10S   d 0A a 0<'0! 20ZoXV40Aӏ8 0 B0 080 $0C  $@$  $ 40040 08 R R` /  1> ( (o(o U&$%Np@-P   @ F@00Sp0?0 00Sp0?0p(o%d0p@-0@SklP 00000B0F0p(oO-MMℵp,@ `51n_R0PPCSyq451WQP@ ?F 0SB ?2?F4$Q/NFp؍ߍ @D@Œ@2L 0@?DKd04 0BT0 0 SC0ISyq$41QP@/0p22220B'oF0k?0 0 40 @DŒ@ @0L0 @?DdK40 0L l104 @0#p R0Cs000 2s00Pp`20S7w 2࢟ 0 000p0k   `  LZ XZ0 ``a , 2\0Q0@/,040<010(08? 0$UQ `@0 0D@ő L00 /4;0aPP 0@d0 0o 0  1r 0aW Op`| 0"/\0X0`0d01{0?{{{{(0, ` D@őL0 0/4;$!PO 0 dhl 0A a 0<%(k(oA%`%p(o(oTO--)MM,0=0?0(8$0OD0D`0S> 80pW:,0 0  0 ^S(k(o(o(o(oP@P`P @4孤 P@  4壤pO 3E▤p@ d3T@  =SPp * =P tC(0S0,5 Sx0<0(5002 0,%S0022Q04JUe 0QBU]xx" 0 04 0A X4UO 040A 8+UF 0 4Q"U= 00 Q*U4 00Q(U+ 004 QU"1 p00W00G-\3Sr1\sXX\1X0SHT X0SS0$50 40bH00aL00BϠ<50A8ŀϠ@ŀD50\P00\T0R380^S`R001T p4ӌP 0d0 a 31 Q$ (o(o%%l(o(oIt(o(o(oQT(o(o%3T(o%(o(o(o0RC00#!3x000<44$0<0t D0p@p{0|00pXsL5P5 P4H 0/߾8@`D0/ؾ p?Z`ipt00F,o! L ϧ !>  <4 04%8$ST+22 p<4800x 0 08`S¯PN @\P@0? 0 0P@{QQ* 0 /z@QP(5#R0:<P@0$- 00Z00 1`%"0 ?001>0Z`0 c2# S,[!Q [300 !1 00^00CC #Q`0?#"4 0/V`1V`#T0`10F 0 I  0/ B@TP 0ἐ둈! 00B1  BZ1 ` Y"B !!0 R0C1I C0/۽ 0`̽둈!0  B!Zӡ!` S1B0 S %S@u @P`x1~ F0<48ĔCP`0S8Ą<4-0$5BPS,`QɑRBDL0 0 0000|60S|0` ?H4L04P@0 @6p;' LKp00R  QD9{P7\5?>C00!#4t x0Yt7 8!"T a31< A202!0 03P@ 04 `  0L$4  E$ ( B, D%LV.  R*h 0(b < <( X D( \ L( ?.@Xd@+@B@A.@B -< He ` @40K `v0 ,p B A YZQ !\0 XZ R  ŵ{A/ 8pW $?. t{ 0Ąß Rï<0\@D$44 0L4( 0ĀpH2 R 5#< 5,23lr0S*~됺 z'z'zz {' 000d0 CSQ c6Rc(;R`Q @ z犸 z'(Ȋ0 (08;R,tQ 0  R0:1P000\tP2#00@Q@0 0Šp00 R00&$0 .0Sc@ SQ QQ0 뀠@t9 j0JF 0mK0`0S>(oܷF^ C(o^ 0(ovh(&h@th&(oT(o U4"  T(o(k(o%0(o(o 8(o `00S^ 0 #$A `$0+V. 00S  0=S,0S$g0S0$0! , 0 B2\,,^   00/d A! a,3 1 !P$1H pp!KPP04SP0 0R0 S00C0 S 0,0A0P0B 0,0ST2 p开<ȿ 0ᘥ+" 8 Q \%p#R!0@ (0 0 @DU`@4Ä20 @R40 `0```0T00(s 0 ` pL3$,X0`0 I9pQ㸐 P#(x0t0 Sx0x0 B\0X1`01Q0C00h0`0lR#00B1 d0R*,%u U0   (0 0C0D(0( 0 R R` ` + 0$5S  l01` p0000S3dᄻ0%ST0T00! !04%SP5X0`0`P5S00d0 0    00X00080` l@Q +H0H (qP+Ha H000-ᴰR㰱 ,  BU 00k0000T0 10X0岑0; R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4400CS ~T00C@ 0`w`d4  80Q~T:  $5SʨG $`$`(0wV0S ,4  d,04  0,4 $ھ 00`  Vj0S   0帀0 X#` x0x 0X\%Ϡ  R     d 0L  l!1v L9\%R Xi0SP.pi\`/ `ƌ$  $ m0`S` 0$5S  l01` 0000S1d;04*ST0T00! !0X*SP5X  ``S 0d᫺먐 ᧺   ࡺ 000080@&0C 400400T%*$ Q`?0@$00$0l0`0@hppT:S $S0ppS $S00S0`@Rl倐H) P00@r8p`0x1对@pY70IX!@@l00@0T: 0 @%A$\Q  @08( 0冹 0( Od@ 0LLC l 01sp0SH=0S0 000S.M08C|M = R0/5,\%R    0 d0/ @ `.3,0 $ M0000S0S 0,00C0S0 X>0S lM0S {M>0S 0҅ nM00|:x*,8gP>0ScN C>`>?.0S003040 4004 pCVW*DvV.XP\oV.GV0S  ?0 PS?\5=S,??^0E/0 0S 04  dHLĒ 0A a04 <,$0S0S 04 d ,04 0>G 049G)ݍЍSmfG-`RM@Xr uPP <uP`, ` P P8  2Gp ׽0S >-ߍ<08 0(0`0,0 000040!04 04$0D0(0P WQ  h GpK HGp  <Wu8` 0 T      ; Fp 4`?`a8SkPb 0  00*0P0 5g N0 *0 K}@dAdeK@dzLLKKKKKA-PCMMPp`;8 jp@P  P0>P,EU 02 " CލЍp@-@PᚊP (t0/Spp@i~R/6G-P $` 0pὶV@`0 㶶@`` V`@&!D( `G-@P4S p`㖻X30剑zuP| | 0 0! ##P 0p`/Ѝ_ uP : F^ :^Fp@-@P`    pp@-`P@ ((UX0 3?X0pA-$P0 U PP(`,0@4p*^ :^ *^*X@O-4MX0p0\00``PZ0 0,&, 0Q% P 0 smQ;aQMQAQBA0|bA QSQU @  DT dR$0 9Q"P T U8$0UQUDT P 0 sQ @ @ @U  @@@ X 00 ` s0S000 00  0$04Ѝ"R@-鴻,@ (KnkH&H D0/p/p@-P@    ⷺpO-@0p [Pp`G0 00000ZI00SB_: W `B?F ᴐ(t`(zP0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p(t`0P  C @- r co`/ s@-@PH` 008(V  P@rЍp(t8(t` s@-@X00SPH0`ă5#40<(V  P@rЍp(t4(t8(t` h10 PS/C-TQ@@MPM`6`@f$q x!`0 P08 0 T:@6S/O@  DD6ۍЍC 0+0 R  Q\ Q 0`;Pd= 0+ۍЍ(t4(t`(t8(tP(t< O-BM p`-PPp"p/ P @D A01 S  bq0S @21060&/06@p  p 00C 00(t` eO-@PGM@XB``?P>U㰐Y  0@00D @/60d& 6F H w T4> S`$p h3 XRQ 0@H0圳̭0D 0 R (cR 5-0 (0决0Dp9 0U C 0 fP0  0 00CR0 00,0 g  (cpF\0L0 06 0 6N< 01200UD  ,000$P`%($0\ $(p,,|<d0c0@LPAA 0T0;0Lh5)&L0Sf h%;PU kPZ  d L f[ $ ' \p$  0A! \ 11 C V0E0%QPffC0CP!Pp\p : \+PP0   0 0d00,0\0000<402802@p$0 0Cs0<000C(00SEE\0|000=090& 2|0P88 Ᏻ 0 ``Ɣ2& 0x 0D?o2e#D&0#ೳ6P S2Hv8 pG0 ~HD=GߍW;0/p/p@-@P+Ᏻ  $$((,,00@@DDHHLLTT\\``dd W_ WOpp@-@P`}zur o lif c $`$d]dhZhlWlVSPMJVpE0AVp0Sp7Sp2Sp-Sp(Sp#SpSppG-`RM@Xr kPP <LkP`, `P P8  <p 0S "ߍ<08 0(0`0,0 000040!04 04$0D0(0P K WQ  h<pK H<p  <k8U` 0   @ r n j f  m<p 4`?`a8SکaPb 0  00*0P0 \ 0 *0 K}@dAdeK@dzLLKKKKKA-PCMMPp`;8 V`p@P  P0>P:U 02 " CލЍ@-`pܲ  @PԲ00S0?0\$ 0S 0 njS\F\GL \ xXhP9U 02 " CލЍ@-0@D\   RS0@  0 S& 0 /)zQ@-$ Q:MO--@M Mh U`0#20t00@00D00400L00X000 0<0$0H0(0T02000040080(03h0<080404d04`0F0|0G0\0H0040P0050P?0(0 SR 8T0S PTX0L 0H0, S$0>i/08p @X0L 0S @弨 8P Q s0 @宨a`PP#\#8p b":P (5 WH0aS 1XL : SRQp9   [@P@0j V@r@DOoB@b } |[P pY00S  ᣫP@ t pᘫP 3m`PUb$0 p00D0E$PQ Y@  80S}0t S10S10S00S 11021x0 0180SK0 RS00 R0 R0S= /9P; 0@S 00 T^OX0Si 1Sf 1Sc 0  1C0 S [  [ *0SR3#:\00<0S @!0S 幡P@ T <0 0P U8 PDJp8P@@0 101e000W0`S`St0S4X0L 0H?0 0Wp+ p`PdC0S)7p3 p1S?V?`#)+p' a1Sp)!p Q 1S Af 1S Y"8p( r 2"OKK@0DP?`|KL0OKX0K@L0 0Z0T0Q0S<P[# [ [ F [h0S h480S h0S`0d 000@0D0 *d0S %`0S  T*,800S0 [0S0S"  0C 0T 0#Sx{哩0S0\0S S <k(0S ( 0C(00\00h0S0x0  |0S|000S1d0S1`0S140S /㏠40P$0&=Z0P$0 $6pl$b 8 P1: SQa0mV000S(dR0$0S00[X 1` 00PV`5U0,00A,0Y ,`'H넵U p 0 pSf:Yf,0p`uU ? 0`SM:!DR&0S 1 S+40$00l000 [ 0R5 R4*P !RP5P"S4U  R1SPPQ1t SR U HSRQ SP" 00S<0 ㄨP3P%P5 0CP0x䐝Y [  0Dm0P,00pP 1+!`G00b#02b#b& 0X 0S䀍 [( Y&: [G,0"P!,"00 S :0㈀ 0[3,0P!(",,0"P!0 Y` ,00 0!030 q W5o:0+a&0G 00+10000- [\Q [PQRU10A+!0 Y0 0@c&0p0 +1G0A 0ާ0S1!YV*<9Lp |*& ,4Z7c/?6Nh9i4"!7@Qq X_.g&)zfffgT (URRaArrAa [0 [00S 0( S00R 0( p  [0 [00 bU*3!A$$1QR0X@;Q5?00SU000 [0XS 03 !p5 15;000 ,0;P0S ;0S0 ;0L0;Y ;1X01X\0\ 0; 1?Q0 8;Y!L;P;,r\b\RQ;l;Q; J;H0S ݍ ЍS03 150p5 [1 1Sx0_ ?H0"26`TPP cHW5?C"6Y18800 8,02#|H0峫 [00H <0(0$4s0`0,0#4s0d0P0#4s0h00#4s0p0)4s0x0X0#4s0|0\0#4s00@0$0Q $$   T  00D4Q0T0(0 S \40S d( n(0 0 0;0$040S& ["q4 0W0W03 W00S pZ$lp卣0S  l3p T  $< p ]Z [1l C/oS" R `0 @ 0 0 0,0 [0d00000P00h0000p00L00x00X00|00\0000000 013?$00(013?,0100#410120#430)001t 02@100 0$2?@1c4 04v 08#$0 #(#< 0 0': ?Q T0Q40S0000o0 00 R  ST T'?  2p@ TU z!R R S 0 S7071011H0, RZ*8JQL0 [0 0+ S  R   0S* 0H0< 0J?oR20S ?(0 00 25 0?10 0P B24 0?180Sn0   k B*{@-S-f@ 8 / Ae@00@- 44@4P\P 0B"" )z@-'B=)@-X V:O7&G-`@ P p00:P U0 0  <P@ G9K0P`0q' 0Pa R 4a U   )z-*s@-pP@ 0  4X 0TT8LЍp P `40 8)z*)z@-0S 0  *9 Ѝ)@-@p$M0 0S ` PU1 00P 0! 09))91 l8X4\8S4L8@DpQUVPE:$Ѝ8".@ z0@-4M@ 0P0S Q 0  R0  2  0$4Ѝ0@8R  #  0$R 0S 0S  0!( 4Ѝ0@84Ѝ0)zGh @-1p`){D@-0 L@ R0* 4s# p)P `00CS`0p S00 P0S X0X /X9&hp@-`@P8!R#<10 <10 .810CS81V <1S 0 <1l0 h儜d傜`0Pp <10C <1$0 810S81)z%&&){0@--@4MT 7A`7d7hQ 7`"R d2RK7 7d2SA = hk0:{PPS['ΞkHk?[E{7<1 = > * + (;R  PPP7 0 @@@ ! zj{ k{[;R[74Ѝ00B:k{{'*k{h;R7 ?@@?6C-@Y)|)z&%\)}8)}XIo@-ڧi0d2S5)z@0@-0S0@d2Sħ`2"R2%)z@-@ 081D 04t,  t  t  0S (8xS`S)?S DS . x000qNz*P0C 2K+ C (K0C+ 00CS00UNa0CS-l,d..x.,d,d/@,d,d,d0,d,d,d5H5,d6,,d,d56`5ċ ŕ  NPK @0P* 0A0 9 90Sx9 00K  K F ⟕ 8 NPK 0 V PK. 3K  ₕ  NPpK P 0K. 80  h p N@PV P80S 7  P  kNP>8(<08808407007,07(07$07 0707070707 070707073   ;NPK  PP ,70St'0 0C!0R3z T70S0Ss K 2 @P PQKh ?PK t0@Pp] K> 0 pt`@@hP0V#T00  HT\HX0Qt0pW p`R000QSL00D0Q_DD0@j0 `X\0X0S 0PV)PP PPP K 0P@0 K. 2K>x%x 0 f1 `@씟D@pP @ VG|  0S$0 0C!0R3 0S0S 0`0傝P `0|P c=0,C 0  R+ .t 82 0  d0d0`@ 4L Rp 1 1 S 01 \Q \HHB/p@!bK L0 S1P00P0P D0S( X3 R  h1  X   `H0 S   \0T0 S x`,@0SJ @DUYF  Γ  LP0S|& x 1 ⼓ ` LPcݍЍ ⯓4  ⩓  LPPA0S, PP  ╓  LP ∓  LPv | x LPPj@d0SXT#000+ dOYd'T +VY%$*p*`*8*&>[ LlGˤ  "`*%9|Rȑ;8K*ZW@\|ɓɲ1Uu]ʗʹȭh**fffg6  0!'H=MCel|6FXirw}ˑ@-<00iS03S !:KP-**`l0@-h@l   L @0 0 *x*y@-@`| |0 P0D!0PUR3P T0p0S @0R<<y 0,$p0 Ѝ*%*&C-P`@!@1 0E!YR!tM@p  10S 0 tЍ000iS00S 00S d `P a/W @ 0  P + ᙛP000 p 0pi W@000*%*&**%3` @-@X 0C @T!0R3@ 0P   0S %*O-xQ0S llT @P 0S @D@a@qP0 0@0C!R! 1S1 < T`PpԀܐ 0U0(' @P 0E!0R3x0S   /0Se @TP`3# 00 @$ *&9V****h*xO-M 0% 0Cq0WsP88 P p Pp0  @P ``G FR?l??B0?T>@ [ R  R  R* T Y   ```_ @$ R 3  n/ V 00030S3Ѝ  R  R  `& "  V P \Y F 0 F X@00020S 3`%0 #/X0000  000S 0``/ 0  0@0020S `0 Ya  k 00 0 X@V0000Sp X     Rd @ 0 0 8T R$q0S 1 @T 0 @g 0 @$ 0 @Wh00S 0 tL} 0 `D|.0 D$t.*t*̌&͎̰̽&*x4Nqp1G-0S ```@TqT 0T0 :@18a P8qU @T+$PtP@`0S 0D !0R3 PȐ尠U 0S 0S   #.'P0S0S \0S   .@*&ͩ***x*0A-0S P `p @T V @\PT$@ 0S$p$00a`@*&*xO-!1 RR0娑S @Pq倡 0 P0: ЍS DPl`P 0 #^ -000] @QP:RS  0-n Q yq`P0p[0 o000%`000***&3**Vk{&Βγ(2O-0S  0b0- 7f 1QpԡP@p0Q00]: 0Q0 *@@ > 0X0: 0R0*0 S( -0 R S  T0:X00#03RQ00S !Pq 0000 S  Ph] \ X,000P@ Ѝ*&***t{&C-MM@P Q 0S m0 iJ000@T0S [p@ 0T0:ۍЍ`PP@p0 C Y ;  000PU/ *& *0A-0S `P　p 0U0(@TP`0  RF000S ,@*&*-A-p`P@P -,Xp0S 0X0 0C?oR20S ,DoS 0C&q]p@-? @Pە$ Pp0 SRp*@-8~ 0S$0$ 0 0+(φ*Ϫ&A-@0`0/0000 SPڤ/0>+b T0 P<P0? 4 00?**%0@-@0 0噓0AЍs@-@P`P @TZ TT+ ?0 0/~+"+R  + #Ѝp&$0L<S/ @-阍P*%@-<p#p @,P|#0@0% O-2@`pVCMy Qp@0DWCߍ`TV B/  0R ?s0 0@ E U@\1P0 S8Q 0S>(h X:0000[3*0S 0 0S 0 000R*Q *0S x`WQ0/3?0 S 00000S  `**h&?Sm**O-X3p0]MS DD@c@C 800#0)00RS #0) jp"& VRPP "uR*W 0")00RS[ 0"u)xiph"lLWVPP"L  Pp DDB@@r0PSY : SVH`P؀? 9!aL<S $ 8 <8  @ ( D `  P  `\  T  ؂X  HYP ,@ J*8!88hN/0>+b  P<AP P q`0?0H @P VPPD , *L P VP1Q|]ߍ*&Е***д%*%" +V *7*WnN`N*Dv&%ч@- @ 00: S*G-@q `0S+!P 00S yP0 S00P R HRڀ00S |p) Y \˔P Y00:$00S $)**&Ѧѿ +VO-AMM`P@opP8 0 840 AލЍO/0 009/P6 0p!p G( f`Q D D @P <⁔PD {@P@ D) ?) :)iPD c@D }`ḰTAލЍA> B   R ; 0 0t)D G@D a`4  0  D ` * 0-&VA-MMo 00 /R @`㨀p PP 0S P@ۍЍ0 D /܊`D @P 0V CP` +V*p@-0@ @P BP @ p@-@ @8O-3tM0 S pp_l00RS\3 P3P#0Lz'HC4#S<88tЍOF, ($PL    x(+t(p0@`00 آزL<` 'L\0@ WI < h`VV#W   @Pp &L<0@'pm0PxSiSbP 0'0@$ 000 'L<0@  ``T|L TtЍ0 0C0\10S 0`S$0` S\\ X\ h0SS   218/10S d00X00%90P!Td0 <'d2 *&s***%%Қ&Ұ***:L]z*;ӍӮA-MpM`@PP 0ppd!d@P TT'L6몗< 0'ۍЍ aD D< pPU U`k ap0P ^'|i xW'P$0S *p T0TP 8 E'cP8 [EB&***1[@-&P@-L@4#S 0   p 0#S0 @f %0A-@P` 0 Q0: 0xtp0/א @$aL00S$`@pV0 SR$`*;*T*U 0S 0 0/ R  /0Sd0 h p@-0 @Q0P*H`0/ᙐ Pp0 TUp$/p**T0p@-P@ 0 Q0: 0|$x`0/s!1S 0p@D $P\P@@p$ 0*ԅ*TԢA-PM@T 0``p/VVP   嗑P @T@ۍVP @p@-/Po@P@p00/00@P 0S ԼA-P/p\0@oC 0T@@Do}XU pDP@D*XG-pP#`04PSpG @P`0PP0C0 T`4 $uD@*T*G-頁P6pS`  @Ptf0&(0C0T%Q&F( $06娔00vPPEPP EƇ @$  (@/ə峇 00 @ pP`0` P0@0 P $ *T*1Je@-@ሇ00$D *T0@-S@ \0S 0S S 0S M0 PDA T` R 2bD0&F$ ЀP 0S00vՉզ*Tp@-@`PP0S = 0P0 @/5PL>0P 0 0s00pO-2lM0pS 2YIp%PP  X T$Lj0`000@0 Q 0*`  0R 0?*A0 Sg @018 $1 %1 00`080<؆0@ Ք  p$1QlЍ 0`0V@ 0 0/Ⳇ 0` @T`$ {000 0 0($00S0,00S0(0 0S000$0S0400ᆆ@0 1S0 00z*&*&**T***;GC-30MS Y肟r0 P0 007000Ѝ !PP =* h d$ \8P . 8 ( $ (@0@DZ`P P!  # q1RQ rQT 0 $SP P0h 0 P X1 D1H1D10S0"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t R" *&u**T֏ 0&֪1 **B\***w@-@MQ 0 3/00؍/S$+A%%#n#<걮꒮0@-P S#L *ל&0@-Q 0@T0 R ||7 0AS@ ЍH0 DPI6 ( $#%**`&%mp/0/@-x 0 RS T0R H0P88"Ѝ Q *`I*&A-D@p 0 0SP(i ` `"z `*`$L0@-  Q0 0P ,0" Ѝ*`*>&@-0xP 00S@%*S` CP@` 40P , $  0"Ѝp*`*؀&i0@-0@S 0$P B5/x0 RP`P0rpqH0P@`ᛒ 0 ((@s"l Ѝ**`**ش&p@-hPh@4S 0SP LL!H0H P0000$R0p4S+*`*"**0s@-0@SP  40B3/p00S\0  pH0P`@G4 0 ((`"Ѝp**`**1&p@-P,@P@p P @ |p@-X0XP0SpH`@P .P  @p*%*`&fA-P 1 a051q0S :p嶃@P 00PP'P!Pݑ 0!lt!PϑT 0H!000@A(**`**&hٍu*C-`aM! TL H! F 08! T (A(~!08!Q 讟 0"Pp!/l!X, , T a! F 0`  T U!8#`Rp000F"J!t FF!d00@ L IЍ*ٷ&١*٬&*jٶ*@ O-鼣@0EMSP8a  !0 @ሳ00T*0 ?o2Q03S P30S D3 T@#@ $ 0S Eߍ0S 00p0"0S 0"p! 0 V- V V: 5  B B B 0 0l"p0S0S P 0P 0- 8PZ 0SF pB  B B B 0 0c!  B B B 0 0U!V! V V     \!0J(0 "S $`;q (CA#͡ 5/0(0#S00 #0Q0У0d[ (0S $<(0C5/0(0,0S3,0P0?0!#0,0@ #P Aۍ<ЍP(0S  ;q( AC#͡5/0(0;q ;#͡$ 0$0  BRʠ0@SP (0S 1 P@0S& 0$00S  BJ0S 8#S 0SR 00S \0l 9P tl1x3  P8P0S*Tp*`*%[**& 0 *n@-@0SS*0O-wM< 00 0 80 4 @؂ P 0 @00L0@0HP0D``PP:P S  S  S;  S 0 PPp SK  S"  S,60S  60S  6v0S-Pˉ 050S  Ѝ50S P 0 p<50S  ,, 000 %p\0S40S  i40S  P 0 8"" V0 00T40S 0 < ~30S  *30S30S q0/P6# 0? ssV 0 8N"K"H30S_ H [D 0 .(#p0 0020S  20S8x20S " P 0 ''V 0 8"!20S 0 o"p0 00r 10S 403/ !LhV00 0NT10S00S 0 800S 0 o4\  03/`V 4   00C` *&*;&***`%!oppL*|*bu 35<n**qsPA-1, 0  S !@ 1 1R 4S8 !4|q043@0t\a00S/ P0S  R+* RS-RP- !0 010  QP 0PU 0$N P ЍPC/0P;C0P|90S050 00Y0 0 @ 00 0**Tp*`*;[ @-|cM0S llLhChS0S Y^P0#0,,wp R0n 2r  0500K Pr5"0C590C990C9000Ph|n x0S \2d"`2Q090 9P 0S 0@TP0@-@w  0  xh0 dP0 P80 < 0@ ( **3<EJP*p@-P@P @0 4 0D !0R3 p*Y&A-Pp` Sy00CS0Bp@ T 00CS0B P yTnTyDo0 @00  0 0 S&*$-@- T m)L00S @P@0Põ_Ѝ@Ѝ/&*"pR7@-P@00S#| P n[0 G Ѝ0R00S PYF0 l`X00SD 0@P<#$00S $ *&*z&@-@    P   P  P  h$P l H\0QX X ( H@0R&=%5G\pl>'0@-@MPPPP8  P$0$ $Ѝ0P*@-0@ M \0 00U  kvH ۍp@-0@S g9t0P0Sd P 0@00ኄw p@044c000Sp p@Z* &*&A-/`/v@Pp/@DЍ/SpPP B 0  EP0000S@-0@S  0S 0 000h0@0S  P1 @044 000S @*A* &*a&@-0@S 0 000d0@0S 7 P @000,00S @q* &*&@-0@S 0 000d0@0S  Pԃ @000,00S @*&*&C-0M.S`p4P4A0/SS K0  0U ! ;  5  o  i  c  ]p  xWX  dQ 00@ <;Ѝ*4" '09@G @-:PA-@P`App` " P L:0 S000ЍU00*Ppp@-BM @P`0E CR V  hPŦ0FS \0 BލpAS tP0P S00@ M:⩦*PA-P@`t<0  ptW :A*P@-. BP: ^ 0S P    Pe:0-PP `@stPP 001F0S8 0 00T1T00`V!010a0,Q5 S:; S0,PP!0 0P  0 0  P 0  Ѝp r _S-S xJ:`0 00b P0;C*w&!* * 0@-CM@P0,  0  ?Cߍ0**@- @ R300*2l@-$M0h `  P!@PPDp$ЍPU D 0P 95*Pp@- M0P@H   s4`     Ѝp:* "J-\M0 P  \Ѝ?Q -CM0(  Cߍ/GOp@-`Pk0 R  @  0!S TPR9 Z80 T0 D00o d10p*0!p@-P@U U  0<  $p@u K/&=P 7P P Z/ //fsY-M M? 01.ۍ Ѝ&4`00CS`0 XX0 X /&hO-pQDMDЍOt@xa`lP !W200 u00020PS00C00@@ Rp@T3 W+X( U U L      0.      .0X    p8I p W& *0 **83<0S/@-@QPM PЍ@ p31Q``X00CS@@@@@@@@@@@x@"0PЍ@L !0S SL   d0AS&,X`phH 0S0PЍ@ҝ$   | x0J1hS fS501 0400030020dj0CS PЍ@=01 (0<00$0;0d 0:0090080070060 050040030020A1jS$ $95Q Q .+!$, xVPЍ*0 B4"  O -;@H\? P )O-@`pR X1L0 S vp   ЍO>E/00 ̙P*Dp`-P `V6P5 00 d ᮙPDpP ᣙP X L0S`_Py :VP ЍDp` X- R5*0%4!p@-P(@P xPp@%0S $  R Rq0@- G *ň@- (0 0 0 0 0 Ѝ?)P P P ^KT5E@-(M0@ #\S@3@#:@ p (Ѝ  <t7@-P|  @P .nPP @8xPQ,j Ѝ0*ƈ*ň0@-QPM @T 0d@Oo@' T%<%(Tr + U  @ @%<  P Q ,iЍ0U P Q%Tq @ 0 u  @ *ň| Q@-.@h0 \!@@QR  0*ň <*Lj0s@- @R`  (P.FnP ,ii0S ,bi|Ѝp l0!PU U 0< 4- Ѝp@!Ѝp@%*ƈ*ň@-@T T 0( (  ЍЍ@,Ѝ@*ň"!Q p@-@P T p@<W   p@N 0 p@H *QO-@"PTMA@ p` @@0@$(@gP PkTЍPP3 @@0gPt@UlT:TЍOM0 EW y R@x   ;y0P ayL  ,\100 0 S00C00  Q,4P `0 m0 0`g M` ` X`00CS`0 X 0@X0 X 2%&h@-00C Ѝ@-0  ; ЍO-@p P7 aTAD -QP  P PPP@D`FRPP00SP Ѝ@-@0 0 0 Ѝ@?@-{ &@-@-QAM`p0V@ M0d&aXQX!0T L0P 0z0 ,$Aލ ЍP0001!! ?t0 > !R  0Gl@Poz5 u5fz<T0 <B<@D@ \0D0X @ DD`*x-;A&4"Z*͔,@-*͔0@-6S {*x @-)z&z#zx zm/l`k@P" XBT= < <84dl, 2@h @*Ɉ*ɔ@-Hz F ?&0@-h@  0@ 0\0CS @C&00S/p@-  R 0@7   +000 Ѝ0@Ѝ/%B*Cp@-PP@ Ay0S 0CS 23 0 0p2yp@ hh 0 00Sp 0 0py  Up**LA- `(p 0dpЍ P 0@P  PP 0dpЍAUt01Sh0 ` 0X2TpT 0` 0S ` FP `q*% 4"A-Q@1(pS1S` W 1SQU(W1S WЍWx1x QU ЍA <1ЍAjW(QU0S) S S ywU    gwU  WЍA   Sw U Pw DDr ЍA+*% &Bq 2h(4 0Q 000/ *%A-|AJM1MSh=`pi0 `Pv c40`0 cp0S JލЍ;T P0vA7J.H0 0A1$HpL  $`0P0p0 Pcpw Li0S8b1!0 *G-xAp1 `S1SP V1S \$V1S VG 1iV 0 \ xGV\\0  嘠EPe0SVGx1S Q 1S  0 GD*&% Bz.rA-a0 MSP@@P0P p ppH0Zp 0H U*% 04" =% *B*Ҹ %)3 >:KUo ^*4%O-`ܯqM=P ``@Pp Up#*p0T?SpDp00C\P.0`0t/809` R  0P1SDN@`  fm00 14@_m0 ,@@<@%@&a`pP@ @WX0!03W00 SE00CSO `  0 8=@`P@8PiP p0800,0iP8@ T@puiP4Y =y-  0S qߍ,`0P 0 0T Bn 880S \ 0S1n0Sp;iPY@1iP,T *iP %iP040 iP040 iP iP040 xiP  d \h PT  m 8 Ṿ804S  0Sm0S h P#T  m 8 ᕿ80 Sp  a0 Sm0S 1!R00:qzPhP8TY 0`080 Rk aBQ# d                 (     0 ikklgjx p \ 642_m 8 ,8 0W  R0Lm R0!1S00: <04140k0S0<2   0H0`9XP) t )m 8 8 0W @ R0m R0Q0* 0%0%04140k0S0404@T4q^4^T:k l 8 8 W P Rl R `0 41 40kS0 S41X40Sx   0H0 4@Tq@{pk4@TgXaX41ShZ4@Ti{@pZ0P.&9008DApP8 BlY804@U08080S@00 @ c/4 4 6@ @X6p8 80 @ Y@0-1 `0400<0,0@ Xp$Ml: X0H?oT20S 0H?oT20S0H?oT20X0Ss1!0 x5x1"J04 @1@SP] co p0 jdtD`\5p`H WpH0SX ZjH-0A1 ^d! `0 D00P0`qWpk p1!0`100CS8$D$1"< =]@P qߍOdoob4S w043 (04c0(0003, pGWp;WO,lH RT=00D@ d`P0=S "8 R0  0P 0=Sf h"8 R @b  P 0=S 0"8 R  qߍO( TV0@40,00@pQVD@0S 1SL X* CPP `V--,  0 0(0 0,003Ap06/00`8T"X ](D,PX\0,S(` T'&k Xpq j0"S j 0 SX0T R: *%є H+<SX}ELQWo kr:XQl8 %zU .*4WE*00S, S S0h0l $0Cs" `B0P T0LP0PT0pNVpWD5h0l PK000&00' T00.T0hPyj0S @@T T T0P 00,0@L D @' 0`@0 K000.000h 00_PP \0pUp WqߍO/j0S \0,`i0 0 0Lb0( 00,00p @-i@P   x l ` T H < ,&;Vit0p@-@PT`d P  =p@06p@i *@-M @ P  `! Pۍ*p@-IMM @`PIލЍp P0 r0 llhP 0S 0S0 Q0S  P*#*@-M @ YPDۍ00 R   P**ĀH-p`3M|MPPWZ@PFdP <AdP@ "P04/dPV 7 ȵP00S , 徵P   嵵PPi P t dP ,Z[ /, P U( &P0S ƺJV! J1!@ J P RB PQ h 0 Ux堺tJ|!|1h@ x R$BP< h @4S J MP pRPh 0R :CoP᫲ c > cP00 S5VPOh0 xxLpGh0 `XDp*H*KUPg_p @ &O-pMM`;p.p P@@ p p p0Wp㼱0Z:0S ލЍ0 0W@P\ i@PLqLL?HcP  1pZV㟉 1Z SP gZ.pZP gZ.20Sa00 0Z0V9 Z-P g\Z.@)0T:Z^P gZ. d| Ade|*P@-0`0 0XPP 0@PT XP Ѝp@0X(PP DPЍp  O--tM< 8@40PPtЍB0P(0  (P U  IT T T;P0t4tT$0=YT6P0X4XT$01P0H4HT$00SZPT(4TP$004 0S0R0S00 0 0 (0 @` 0 0@TF*3#03  0303P0T0EP؋@(0P`,PY6*40S 0TS0[tDd  p 0`Npt 0+XFpl X `(Xm0P02R$0X 0BnS01 0<0S 08 S@ p?@0?D000S+ 竸z0相S 0P0/` T08  GP/0 L o`?L 0H g` {{'0{H 0,00@ ,0 0D0 @ PBn| 001 00Xp`?$ 0\`0 +4p  0G$/$+4hp X0 0T0 {{'0{0h `Pȟ 0 `` 0` $0plT @Y}m](3LV4"ð0SQ0兤d4 00kS& Lp p4X`p p+4`Wp}  0[ $+p4hJpp h0` XPp ǟ 0_ 0_$0`00[ 0 _$000$ T,0S0gd0kS㋤8 q 0pX p2 $``p+4p'  0[ $h+ p4p !@ !@{ {'{X0@0 T0 !@ !@{ {'0[PpǏ 0 {4_ 0 -_ 0 '_T0 @Y4"@-5e 3,8&A-@`4Sp  PT0DPEE$UX B`P00:`P 0-80  P $3MDPE@D* *p@-P@Q0  0 p`P @0S \K$Pp HQ0@ 0< 0p R$9$%x+P++\+X+T@-3400S (0 0 pp +p+P*O-\M0 MS1 HpW-Q`@`((Q(0 3X+ 0=P 0 0 zۍ Ѝ0 000nS ?S aS ppS qS x0  ]0 d0V0L00 8J++x+P&h+&/{A-X`0S L00S 08P8@p0Pp00++p++x@-@L0@13@00S?',0, 0S007'++T+t+*C-RP`tM  ,,E P RQ ğE R`S U0t`FQ ğR   TDR 7 4* CR ` 0S $ Lb ,4\ P20@04ßQ [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+$P`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0哑00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ&&+|++|+|+PPA-@@P@T .@ P`p0SlO d0 @ P ,0< 8(0@A%x  +P ++\A-@P@pP0`S00|0 R d% R 0L 0S @!P@`T !+T++%x +P@-- 0 D+ 9P@-- 0 8+ =&P@-- 0 ,+ @P@- - 0 0  ++P+ FP@- m- 0 0 ++P+ gP@- [- 0 0 ++P+4 P0p@-AM 00@0 0@S>- P1 PS" 0S00!C;P 0S0H>PP 0T00aS0` 00S0``0 C:PaS` 0` 0R`0 0@0S0@T@ @0 Q000S0P'Aލp+  +   ++G-1MMP, 84 1ݍЍP0$C:P @4@0 :PZ30S Scs 5@PQ j0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2&Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2& Qy10Su 1@P0001@h, _ 0 PQ0S0T穲 ,PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o2@&Q|00S  d0 0P000<0P+ + )*+T+t++++  ++p+ PC-p0JM M 00@0 0@S+ 1 @Jލ ЍS2 0S! r9P 0S0<PP T0  t1t p1 R0 0S0QY`% 41 0S (1(彎! B9PGY#P0͡ `0S q@$00 R   R 0 'l00Q@5pq T0SP00@K+ +++++P  + .0 0 0 0\+ 3 0 0 0 0R+ 3C-KM MP* x2 Kލ ЍP0\"C8P @<2@82000(ZP 2 0S@2,. JP0 "aQq0S 0S 00 3@P r.`1@0S p5PH1 \;0P 818!00,1 0&0S xP+ 00 000T   /o" $'l0 Q00S 0@YP0 00`0@\+ 6++ C++P )*+T+t+ J+++ 3+ .+p@-PAMM >* 0 @PP0 ` pF K|0p 0pppp0+7PAލЍ0S 0 `X++P o F+ 3 0P/UyP@-)0$ 00 0++P   Pp@-@P U?o20#pP `bP t]P )p0U0P0 <0 @WU,0 00RUy+P 0@- 0 +|+P@-) $0 00S/0+++P 0@- 0 ++Pp@-1 R   1( @0PS 0 Œ0S P b)0 0p`PPl@ \0 t LP 65P80 @0++PUy $+ :h++ 0@- E 0 P++0@- ; 0 ]+,+@-(@(0 0 00S 0 + s++0@- 0 ++P00P0SA- (0 !0ЍPAaq0S000+0S 0S16000PPbP00ZP ,eJ 8`0H L0<\04H ++++P Uy*+  0@- 0 ++0@- 0 ++P00P0Sp@- (0!0pP@/`PP0 0  00S00P|0x0 0l C40P T400?o2$ S0 ++P++ 1Uy P00P0@-S 0( 0 ЍP  6P 0,Pd00}S`00S T0Th0HP 40 0, 0( 0+ K ++P \ +++0p@-PP0000 9@Ppep dp@P p@'2@ 0S80 0l00&++4 ++P  P00P0@-S ' L0 ЍP 4 5P 0 P 0+  +@-M P' D1 ЍP0! q5P @1@G+P0P`p ~0@P4+0@0 S0 0S WP lP l0 Q 0S H0@AP000$0@+ 6+ )* +p++@-P8' 0 ЍP 0S t  5P 0S0T.P0@(P ,0 $ 4P+   + G-@`pFoᨂ@VP 10S 1ЍGHY(& 1 ЍYPq YP4Y! YUQR 7@P dPPPA @1 ЍG0V,1PP(qPp6U@0 000]#T5U@ pV(PPP 0RP:M`5|0@0 /H000 L03# 80,#++P +  J > N4 DwbA- MPi& 2 ЍPO0S!<4P 0 1CVP 00|S f7P 3P 0tV@h1d@) PP!@4Q# D0 <@0S 0S ++t@-0@-P000P0S # L0 ЍP@ 4o@P@$I oV+/ p@- M P" 1 ЍpP! 0P 0i#p`1`70S@1D0 0S 1(JP&P0 0S 0@T 0zs&`N@P LI d@ >0@ @D0 @ 0@3/H0T 00S00SL&++P8M`* ++ty+^Q+0@- 0++0@- 0+(+PA-PPPPU㈀ a"00P@lph0hP嬅00`0 @00CT,0P AC+++P++|7@-PA 0P00儅00 Ѝ0P&"0P%0S0P 00H0@0S 0 S  @H@00+TC0 S +<C 0 /P+++P+d+T+|+|P@- !0S000 005 0P !0 0@^P  0 0 00Zl00hKPL0H0D0H?P0 0 00 +++PUy+000 0@-S$00 00 ++++000 0@-S$00 00 ++++p@-@Pp@0@- 0#++0@- z 00++PG-R@Pp PQ!ЍP`P? P< P`TP5 "-PT. -@PP$$`. U(1$1@W 10SV U00@ $ $``PK0 0  S  V Up0l0@W T00S H0H 0 @@ S8  4o  Fs++++++PUy?{ @-j0+P@- x0 pP \00}ST00S H0H@P 00 0( 0$ 0+++P+++P00P0Ss@- 0 Ѝp0` 0S P@P P00S  L 0Ѝp@軃$Ѝp@+++P + %p@-4@PPR 0 p00WPp++UA-P? 0$"0Ѝr0S 2 剃P80S10S 1{@a0 ` A0崁S Cb"c! !    c#A P0U0CtQ00CS0< P?00CS0@ P7 (!-PS0p00 p P 0c" R  c&0P UR PE 00P0 0 Sp(0L0 0 S++ @+PZ++L+L+ L&hP00P00@-SM  0| 0Ѝ0Ph  p-P 0G)@tqP @0( $0U@00+ +PP00P00@-SM h0 0Ѝ0P | >-P 0g)pq L0@0Pk) 0, 0S0000+ +P'P@-8 0 P=:+-2@- (0@pP0 @+P:P00P0A-S쀟 00ЍP  ,P 00`P !PPP 0RPE@E@@.p @ DT@ P@E00+  Dwb  P00P0O-SM   0 ЍP  ,P @P@ 0R@ME`-|0P 0D@0hph`h@Р0000 0<0 8;+  Dwb+++ 3 .Pp@- {0 0p`@PP P P@O*p0 ` S P@@ @000 (0+k 7r+Pz++ A-p`P[ @Pd0 A\P U00t-4 0 RU A+P+ A-PP   R ЍAP  R  @0S00Ѝ@`p+%+P4"0A-p`P0 AP @PLp @AsP 00 i00++Pp@-X@PP D0 p<00Sp@,0,0 0Pp++++P5p@-0@p@SP \0 pT00Sp@D0D0P0,Pp++++P:glp@- @x@RP~ d0 p\ Rp@L0LȀ P0 ,vPp q++++PtO-MMPQ R 3 ٍЍP0 #C&+P S@p3`X 3 | PP@)L>0`t' P00S 0P @B0S000p@I2[2@0SP$S \S0P0" 0   0  P#"00B   BR 0 D )by>0 vC@0SPiR0PS 0 D)be>0bC@P1 d1 0S x10SL1h`10S ,000CS0.  5>0 03/00S 0S 000CS0 S0  )t>00000i0 X 0`S8 ++L+ @+P+^&+h8M+ty++l+|@-@P l00P f00P`00 -d0lM T00S PD 0d P,00pp++p+P*-lMP00S P@ 0d P(00ppq {+p6+P*A-@BP` p0 0Cs0SQ3  HPP 0 B RQP  00 0Cs0SP3 p@-`P@:5BP , 0S1PS !x,p@l,*`>)P %BP00 0,S!0RP|Yp@-@P 00PU B NPp00p@-`Pp@0P<0 y.0Sp 0h R00 Ѝ0 0S0C Br RQ"  +dP/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Br&G-`P(P @ GP  GPU0 00PP0 10S / ]APe )*P@TAP 0pS 02P p*:PEAP p*P :7APQ p000 SPA0S 00S1 @RđU0 pB `BGP0 0 U ))) 0 011 #2Ѝ @p) P< 0S000)0S 0PS S St0 0S 0`S@)H0pW ),p}++ +W+4" - BR0 R  P R ZO-0@!M M P<@8@4@@0D@@@FPm4` 0p 0S 0S 40S 0S H坠@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /RTpKX`V s;5PUp@ @l0S ;xR@P dOP TJP DEP8S (N000@0(@P4@P 4@P@(4:4 @P 00(<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU ;PPP @ @ PpW y;pPp3 Q  `3 M +: =0 080( S, $#(0 00 0$)0"0 0R S"  c`pPR  0_(P0 Z , d0%T00S9 llX% 0S1  + :=0 00 (00$@0S0S20}S-|+ @/E?P00Y@VN 0SK U +HV:+ H#:+H:H` +@H:=0 00P$` Q(0 A `00+S4:=0  0`0@@DcT@@0P/1QP0,00(S  Ya@p +V+ >+^+t+fe++& F++ C`+O-iM Mh8dLlOpt͍40,xHD@|0 0PL0.600K/p% ,A_'@0\'4QDX'8aO?ⰐV=HLa少'TU01d 0S TPD d0sh0sl0sp0s0St0s tU 0S V|V?0S '?0S0 /sPP''T?0S 00SV( 0 ^ 0 .<0S ~P' Vh<, `)0S ~OE)P$.=M 0 6)00 CPL /=0S-`= <`R*$` (`,`-0 R"GP;0 00|S h40S;0s bJ\M < 4= jXP[,8@;P0S00(  V =:+ 0S 00S 00Px 0Su P&p= ⸛PPP 0S :OPQ=X :HCPPW  xPx0SV x0SY \; 0 Pm$P %G=P  0`!U/1\1X1T100p `10T1S 0S \AT! 0S xsFP h EUV0 0*0S 00S P P%\K|04 msT0SJ4 0B ($0000Q$00S,0{s00Q 0 00& h50S0|0 5u<0vs5<`,0 RQ ;:0Sx50C=p95d R6&D5R P @6F! 6,6`l0Əs l0l0!@T? V  %PPF0 0 C 2 @R F0"0C?o2? F"0 "0A,K3000 R ;R 4AP h000 R RT 0S?0S40?'"4 00#.0S ?0.T .͡@!͡!..S l0"R0.͡ 0#PP#PP0S0Sp80S#PP B|(L 0 .S0D@0$.0 pww0PppP0 PX pX \^F\P #P U L \pWd90S X90S \9Xy P $90S @DT90S pYFQ 1!0S  PZ0S= S E#! : :` T00R0SE uPtxJ  $P   AP Ue g:0Sg*0P a** ϠP 0: T#`9 (;R0 sr ZO.!0Q3/P&p;@  +0 R0;J9dh lp"0S,(< 0R.K CA0S 000S 000S 000S ٺ00|iލ Ѝ0S 03/0S Ǻ00s@- P@==P  7=P0P 7Ѝp`P  $=P 0 FUpP Ѝp@E 0S S0S  =0PP}0@-Mh 00P P10S 0S00 0 Ѝ qQa @T0 S 00S 0s 0 :6P 0 S000Bp@ T d?P 0|S '00 0S00 0000+<+t *++@-`$MpP 10000000%@z60P/S:S y@P@tQVP $ЍUa6P@ W1  $1 N10/0[HPP":VHpP>@P/000 09@P00<`0@@DcT@@00@0CcS1S@r+ +VsPP00/@-D (0@  000 D@+*@-D p0@ `00S T0 0Lpp<0000S C@++p+P*@-C@\00S P0 0Hpp8 10 10S C@+p+P* d0@- T00S H0 0@ppl00 101000o++p+P*+ -X0lM@ d @~080 00ssG O++P*$@-0lM@s0 0 00 0rS sS ld dR0d X0P0 00ss,!d $++*+I:k+P*$C@-PP`@ @0@ss00V 0ss0000@? P UV 0A0T0Ѝp00CS0 Sp0 S 0 /O-pTM|0x0?X0 "?0p 0B0P`0V0X B@4 D000S@ H 8PZ0S= S DTV0  @P+B0S B0#S B|0pS d!0 R LaR 0# 76Btp uTЍ  ?$0 0   PPPB0S B0#S@DT|0S ld@"\6$0 V `~#O" 00 "B@++PO-@BMMV@ Aal]?0a>0 @@0P`46 pP,6P<:6  BR F P5(50S5V % 0U 50WU S00G00S(+ / 0S+ 0 S( Z000[9  BR $5PP00CS00 y5 @P00CS0 0㠴0 0 {P8$ ap0,TS (400  00BލЍ@3@30S VW@@c3!(53 0p330S' U U# fT$30 CRKH3000+ [)[00E@ 0A>V0 `W4$2 2F2 @U[2000 p"00KT1#0V CR@U-[ 0S ,2  00 020 CRUT<10S@d@60 @S405  [ [P [ 10Sʶ50F?oU20S d10SX1p10S} U T U00T0SyT} dT([@ 0S10S 3/1V 0   0ZR\@\ 0YS P 9/ 10 XS P 8/0F* T+++ H+++P+ L+ D+$ +&++-A-` @T 剒 0 ЍAЍ/0p0$ P ex)o4 h0h ;o0@S TP 5/y+ D+* |+$*O-@sFM M`  @? ? 0 ?0$0`30(0$ 0,@Q0P SC@00 & 3 Fލ ЍP0 @,Q(-2@@Ȳ@aGT   2 P 0 PD0P|2d -FP `"`d, L,0S 00S , 0(d  PP dY@0S00?o2 JP >0@6eP6 D01@p  d1 01 D0(66S0d00 0d0bA]0`PS 劑P \P X00S t0 |0n'P@ 0 @00,`@0?* ++++f+P;M*0+ H+ D)=0O-VJMMsn0p̖FXv600S00p > 9nPt嬮X \6  T60 9\P,嚮JލЍ60 0 00+97S 50Sa5m005ĥ0S# 0S5 Q S 5R "P 0S d500CS05Pm00@;0S P97S, 44 % 0S 400CSX0$000(00000 PF h40000S\40܀C XSX 4T00$ 0C h00d00`0( CP 3x4\ 0k0$<` ((0d $r 0+ <7$ &S \3]0 R0S R|3(0008'P 2XK0097S0000 0R0S  x 0Hp奭8'<P420 00 01 0 < 0pL 087eP,| 97R_ S㴁 0S [10S. 0S* ,0< 1, DP8!81 R  t 0 4 1Z&P 0S 0097S;7(0:70?70>7='<0S P0s00`X0 0S [X  U*+++,*0O+++P++t+++w+|+ Le {*(   % [*(   ! !+!;@- 2 Bp`WLM LЍ@( ]pPl  Vpf 00011 0S<0 ?|q0 (v,00 Q 00SZ=9Q ='/?@#b!"/p8<=0S 8=0#S 0(60 8%pp (=0S $=0#S 匬 pp 90S0 00 0 0LЍP400+++bM!*!u!R0A-H`D0 82Vp  R`RBR RB`2b  Q  ,)00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 Pq00S  <3Pf0W,,0SP 7 '0 R0RWO,1SC$x1P!7,!(087 87 (0xp(0p 0: S 0&0&0X7 R,L7L'LL@4$00|S 8$$4((0S$h6,! d6 600$ p((0S6$6R P ٫t6F{60S` 50S 50S5`50S 0CS0<0S 5  (p( .P$夥,0%p,0(0q(05`001!PM!60 SF4200S 00(3/0(0,,D0Sp$0 S<Q  X40S 0 4RM pq{ X%&0$Xp0Mpo4P@$PF  0tchBP$T<<0S s 0 P0 (P-P@ 0T0 0 0(0PvLsh( 00CS0(pj P @P( 0@#t)0 ? 0!$ S0 , 00CS0 ,@ T @0S  @(P!, 0@(00@ V;,00@ _50 SC1(00@9 (/T! 0 t, 00CS0,Kp@ TD04Q0D0 T V A, 0@$\1 #l僤@D `Tc <00S ,/48 (0S 00(3/,++/+++ .++T+(*$+$ P !++P""++ +V 0+#0+T*+X+" #/+"+ 0"%+?;#;0@#5;DE @!0X@\ P`U0WTڬ1PP1 Q IQ@@k{H{7{Z(0`0!dRYP (e 0 IP<(0@<e0  8 00S @ P0S S (0dt #@(0h dX A.++++4"+)Q))) )++)))+P 00pp(Kߍ@P%U[0DE:@-"1X @0 R0 @00S 40 0,pp̸ 1@++p+P-$M ?0 0 ~$Ѝ0-4M 00 0000P4ЍO--pMM$E$ "  4P p !PUp0( RPUp4$ 0R 0d*pğ^P $0S 0sX0S P 40,40S` $1\` $[ 07 ){@0 (@{{:?dSd0 0#f=3` 3R - BP  R" BRڛ \3\図"B P#0 f<#2` 0 $ß S#3RPR  !00f " $` Q(0 0SZQ=9 =:k{4H2@Q09ڼ@ {P!5 Q; %#3\PO  d! !00f!ƾ1@Q0G10 S`dQ 1*!3^4?^03/0l!P0⣾`1 000ss(0S #5; !jUp; y@0S00d p@0 00ppZMߍ@YA.++++++ G+*+*"+Q4" *) *3*@*U)+P+<*b~@)*o  Q!}0 @w@ k{I{7{z`0Wy0P  #P@<00`<pe0 @  @-;/@R7/@p@-Bd00` pd00CS013p ,P P00 @R0S"P8d`Qd00CS0+p "P \Pd00CS0p000S 8A0QPA p0 0 `Vрp0 c`Pd00CS0p 0@S P,P \Pd00CS0p `V0 0 )Pp@+%*+ A-pp@`{P@ ._ PP q@P PE &P@OoB@+O-$U0mMS psDPd w.0S ޝmߍ0P.0͵1& 4PPd'0P0S SUpF P`4P PP P0CS  \  `p, P P P0 PsdJ7)P P /)P d0ppiP 0? d`dp P 0Sd0ppJP0? p P 0Su0S dh0 P P d00CS0p\2\g\ P Q4280 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0\S81Pd00CS0p0 dL\0sp 0 p P`, ^0#S^0C0 d,PXX ++*4"+L+(**++P+JZ+i&+ L+L+++T+ @@-0 @0SP  %P  0 00@ x0 lܣP T0 LӣP 00 ,ʣP 0 &+g++֏+ - BR0 R  P R K1A-0aS0P0P3U $P 00.S Ppd1l呼 `L$X1P@  H,$P10T0!0!00 (1( U 0 ! p0Aq000 00000P0 0 0pS000P0T h0h0 @U t0oP$0`Z++U++ P+ L+P+,+TY++ 9+X+\++ H5,,#p@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p+ D+t++++++++T+ @ H0@- 800S ,0 0$pp++p+P+ @ S,*0 0 0GS$0P(0&+t++4"++/A-p`P @yP0  T  `00T  0@ R   `FVp`00CS0 X PpTD000`000 T00//"&h/4C-pP`@0尐TeU 堶 00@)ax0@P`0 \叶sL00D P 0 Ѝ+^?+P/K/g&h/m/w+l+hG-M@ ` 04P0 03`PT ,P #Th d20S+ ` Q `V` qpe&0@00E.002 y,P Eh"h=Q&E@T幕ލ 2p`0$T 媕 %p T⟕0q10@S K$0 0/" pO&0$S*F>C0S  1\4$`$Q(00SZ=9Q =(/?@#b!"/0 0խp4%0S %0#S Z%0AS  T0 0000 0p 0S %0% 0 ᴭpx0LT P%<00f+0///+bMw9p@-@Pp@訮ꂭp@-@PP` P 8 Pp0SppY }/@-@មP 10!@-GtP)0H@-@atp 0qP@-P000@-PlMQ@00 00 T  40S P 00 P 0 0 0 PACcpW' 30S @ @@`  L P |`_PJ P v0 S8 ۴0P 00P02 ʹ 2 PP T00 @T  # P E0 0@T  #P 6lЍ墴P 0S b@P@E  b#  P@ W#T T0S C@P@&{ C#0S @P@m 5#Tw 11@T  0P 0p`VzPP)K&000Fs0 0 0PhQ XP@+(+8+P+ 00&h/w+0    ++T+t+L+ @{+^+h+l++7@-Pm 1 Ѝ0Q0S 1 1P !80 CRhA R S0T!L1P 0S0,!S P 0S 10S 0 0@ @0 @0@0 @0 @0 @ 0 00S 0U++t+1 +Px+++15++1R =&+\+X+T1y++ 1+++4+0F+++00S#@-@0M, @" 0P0S8fu@0Ѝ0@+ -A-<#1S4!(R< 03/3CPQ2`P0R0A@SB-R@P; Rbp rP7@00S 00,S 00S0 `10 3/P00000S0S 11 03/0S1000}p0 P0 0 Sgn000 PTq0 P00 SK$R0000S 00,S 00 S00S 0 xp 103/P %(000It0 P 000`+++ 7`+2r%+%1++4VB11Q:+l0+l@- 0  <+d@- 0+h+P `00CS`0p S00 P0S X0X /X⋰&hC-Pp@  l1s0S `l ҧ0S t 0`V   Ѝ+l%+d2$+@-L=kh 4p( P@ P 8=WTЍOLX0/LA#P 00MN,[GN2;2A%&|2F2R0s@-@ S1`s0S P0S v D H@@0 Y0nS 央Ѝp+H%-+P+X2]@-PMP T` P H00S@0\A PЍ @!P僮<2o+%2u2C@-@800T n<1 +`22D0@-|AT 0S  0 %+l@07@-LAP/#0P00 5 Ѝ0% @-@0S S S 0\ \ \R@ R0 RG-P0@/00圀/0p0/x` 0@ QT@D0 DЍG8<s0 @T*Qs00!%$2*2AG-AMMP`PxB  d2d `2 `T2 Py 0 04R 0 0 l 0R  0 S!T`pP@D✡0S1  J1 0S00SR&@@T  T @;<1<1s0S Ǎ0Q \!n 1 3AލЍP0S S  S00<1s0S Op 0圠0CZ ֥Z <; 0 @+l+h+H+X++++ <(2%2+ +P20@-EM,P ⾦PR@P^;Eߍ0 ,PP ٥ ץ ťҥ kx0 <  cTP劦弥 0;ᚪ2222 <(%3O-`h3MP@ pPPhL`9<#03 ,xUPE `S00CS0%p00 R0ScP1s0S7 `$jP22l1s0S  G꼌0 0 Pp`1 Ps0S 0 ` 0D PVS,1s0S 8 ` 0 S 1s0S <1s0S al1s0S 0|0/d1  RGL1P) ! V 11s0S WpG'㈌`P<1s0S0 弤 "ЍS R   RWP00Uq QLLDJ:+H+l ;++X+%+l2+d++P+ 3,23Cp@-BM,\PP3L1 DwIF$!1 冤 @P:`0<1s0S 0Q 0 R  Bߍp P`⫵TPp0<3J<♫G2+H++X+2%3i+P+ +l3Wp@-BM5,hNPP3X1 P 0!m(1 $@P9`1<1s0S 㬋0Q A0  NBߍp ᔋP`ATP|PҤϤ<,ڨ2+H++X+2%3i+P+ +l3W0@-@pP4M \0PP <<0000<<0  4Ѝ0+l+ 0@-@DP4M0 0P88 04Ѝ0+l@-M, ,PF A f 0 001 _1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍3s%+HUy+d@-(@ $層 @媤+l t{ tz@-@>T-@1p@-@PPpP p0@-AM MPAލ Ѝ0P咊0!PPl1LAd1T@  R0!P0'jun+Т@ U0S S 000 ITL   T l嶪t  10D0 S B/o" R  0C3zVB3%f+&333+@-MP Pppp p凢l@PL\܍@ɩ, HP ǣ܍,0 < +3+p32%0@-MP MuP%@e0@SۍЍ0@7P551d dHPPTۍЍ0@苩@ 5$ , ۍЍ0+3+3344!p@-"P dd;@PpPP5Pp@4<d8P L|l1s0Sp0p@~+34#%+lp@-P MP(P @R0ۍp@7Sp`@P\ۍp@/P l! r R< < 5è ,=ۍp+45+4<4#%4T4\4y@-  H㿦&5O-P4M$`5~`=@Pu`0 `4$$p0Z$ dQ Y  Q$0 P0$40474t1h. 0X$XaP0PH} p@z <㋔U, U$$t @DOo0B$10<13 B0lS010S 0P   RH <tS)`S FSI (9S /S 00C6&`a0CS X X Y X Y Z X Y X X X Y$ X X Y X X X Yh YhES 0ScTPS2P<Py 7Pc 2PPO 2 PBd2 @dPV  LPR @P/ ,2!00(1 1 0 0!0S1/ P @=6,00 1 0 x,0P p 01 U PUP0 0  0@@@P 0 T0@0?o2VP0SVP%4Ѝ+++ +%97& $+9X;+++p c9}+99& N&%+d9&6-)8888 :899@-M+@-@M h \0P0 0D0@10S  10S0S@ЍP  A00S0@5P噇 0 00S0S 00NP0P@0 S0904 ,a [8+++p+l* t A-U0S7P@@P0Px% /Q4 %~ \`PPeDpMHu0S+ 85  05@,5 $5 5 R- + 5 400000@T ,} P004@Ѝ0400/S@ΠP v v vlditXi 0SQd0S 4p=0c ,p;0cs0S000S : }0P0 0R P T3Q |30S p : h}PX30S 2Q P So2: @}P 2 : }P 2l!: }P 2 : }P 2 : }P t2!: }P T2h,!: }P 42Lp0 00S00&h+P@-@P3 +G 5+  0+80@-M0Q00@ 0  P 0 @P00CS0p 0 l ih00S0@oЍ00 p0 P 0S*000+ d`*&h0Aq P/P//0@-^@\P0 R NQ | 0\ P0\R@ @ 0$R ^ ?+d:PP 80 dÅe"Å^ P?d" @pef"/++dA-|厤x@xPx`xp 0TS 0T `0h2So{ T 0T * 0q @;%H%;; +0@-P@4Mll ⯄⿄ 0<, p"lR < 0 2  s0-  ,S 0"!8 0r 0R><r> 034Ѝ0+%@-`0S@ P0S 0000q20\ @Z+; "J7@-0Pl000p@h R R  l R  R403/ Ѝ0Q P%%<+*p@-$A`1QS 0SP AP00p000P P0 P0 tP  ddc\ 0H@H  "  \ p%+4 N&;(&%+q,0@-1s0S 0P 5%+x@-(0(@  0@ %+X++Pp@-`BM P@0 S0`01s0ST01y0 #0Pn00x0 ޛBߍpB/ BR 000P y0001+P% +x+X 0?o2 0/%@-AMR 0b0000@000  ΊPڶ0 q 岛P 0SS WS BSs0 +⟛P  Vt0S ly1@0S0 pW `1s0S ؀0S R     |P W 0@^S00CS00  S00 P0S+H kH+l++%+xp@-PH@P@pnP P gP @% 0/@-饛o/A-@PP" p00CS" p4 p p p p p p p `V 8PPᏈ`P0 P00TA0 0S P0000 !0S0R 00 ;<A-AP00C!SaXp `0000CSP r q r| rd r| r| r| r`00CS`0p S X0 X 0 "S  H0S`00CS`0p SX0 X ! X!-١0 0P0 P000 `š0"S0L0A00庡0 0P0 p +|&h*<G@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 <G-@T P2 pqp =`P`PP2 00PF 0P 5 V @P @0S@0S/00@ PP?P PPP P 0!SP <$ܢ+|G%A-@MPP\1 ᚠ ġ@P `p崀  cPu00u0ۍ0 f P 0@ 0000S Ԡ  P00 Z%<;+ :<P! 81PP 0(0S$4Ѝ0=R呟00ES {t { { { { {t兟h僟`\XT HuM%=+l&=G==+=N +==>>@-0 @4+lG-@-ʁ0 R   ЍЍ/+¬-@-庁-@-wb0 R   ЍЍ/+¬A-ARp`P@1T ᲗpP.@`@DO-dM@P0P00P0 0 8`800,@400(P@pP@ `0`,0SW ,0S5TppW $ @@[ W  ( 0 0 ( (cxpl T+o,00,00r0o0T񟗾    $ D `  @ ( Q 0S0TׄՄ 0S ` dЍE 3  ( 0C,0L@ @( QQ h, 0C@( ,0t( Q< 0C@( ,0i( 0CP@( ,0aU@^ ( PE  ( 0CP@( ,0Q( 0C@T( ,0IU@E @B ( Q @0C( ,0: @7 ( Q @ @P /U @+80 "(0P5 (=10S! 8 R/ W (b0R040880(7Z|xp8 8 (b0R  "eK $0 P y8 Ï0000S(T7@SW ( 1P0C S,0( W@S( 1Pl0C,00 S( L>2>U>@>p>+¬>>>>>? ??2?J?k????O-lM($ kPhPU``+8@ p0 0Ÿ   0<02@02 @0` 00H@P dᖃᔃ@  J`@0S( P @{y` $0PlЍh@2 %>? "J@@@%C-阑0MS@p0P x*0` `00Epq  I?sp(;`@0 `@匜00: pppppW0@ @4O 3@Op`6t0` }>?@d 00 S @. @ C< 0ЍCN0%@6@i@@@& @p@-MgP* 0 :  S00R P@` tЍp Ӕp P @TPH0 0000TY+¬@@@O-0]M-SP M0S @p܄P8 00S0W0S' 0S"디` pPxh4P ]ލ ЍOv/L]ލ Ѝ   @piW ]ލ ЍO0: S  SQ _PPLu kǕP dt>0v: S+LJ$ 0P@`iP|  (P p  0 0)0 00 0S0S`- P`i`vH 0S 0` #P V P {z R+^R\ѓpPS >Px!1[Z d 0ϓ ?[Დp`4 0S!P0!0v0ዚ P: v?b  0S -v⑓pPv}hP-Hᖓ 0Sᑓp<j+¬%@@Bƞ@A%>UA A3AHA^AtAA A&h0 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ [!P U8IP00S D00S  40 #/+I#NN[ +++D%@-JC@-\Pp@-P@q{p 000/+p@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@ 崙 P@ЍpPU P {0P0%H+C# a@-@P @p.00S@+p@-@PPp00Spp@+A- `pP@P000 PP0 04"@-@P P0P00S@+@-`dMqPU< 0S9 WP0 @@?T-  ]  `00@ C : @ I  0*R /D/ZP10.HH>P  dЍC3 80@-@HP0S  p P%\%DA-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SP@u0C?o2+T@-dMwX*@PPLPHPDPT 8S8c(s0S3(3(!4!!!8!! 0 -R  UR +R  >Q @u?0:S m?w0cS .S bS S@ @0,S@pS wS ,YP ( QP 3svP@P@P@P0 0  Sx7LP2LP -LP(LP hP ^4"E4+X+d+p+|EEC+TEEcEE%+ѨEE+ѬEoEvE&EEEE 0p/+T@-p  01SP R t0 T!WP R HHo@08 ,@"P0 +TE+Ѱ hEʀ 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aqR R S R0/0 R /!0 R0S //@- @P  4 \  0#-?003&?=r 0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P pq!l? pPpĕ ?`llp@@`@@+T0p@-P@P QT4@pTT@DQ0`VC@S@ T0CQ @6@+T@-l@PXPHP <00S,P+Ѡ+ј%+%@-l@PXPHP <00S,P+Ѡ+ѐ%+% Q p0/+TP@-mЍP@EP @ $@P r0 T0tT! _P P0X!P80T@ 00 0 E+E+T@-,@2P-P+ш%00PbA@0CQP//DA-RPp `(@X@@Ѝ`>P@\@P, PP@@+A-P` @P lpP ` L@P  A< $@grT JpJBJRJZJgJQp@-Pl@P TPpDPpp@U p@PpJuuO-MM`p 0@P P0: SXᬌ"rX  NP  Ⱨ@P> bލЍ R R R00 P P@ P @P PP 0"SU T 0S0C0 6/ cNP 0mS PJ%JJ%JP P / f+s@-P@`2 "0 00 BЍpA-@Pp4` R 0S  p@J@-P`( @p0` G Ѝ+@-`@ (8R808Ѝ 8 0 CS  8 0C 8++p@-`Q@PRpP0S  ɋ$0Sp 忋p@0S S D0V@ ` 0V, 始U  p@蠋%eJJJ $0 (((( 80( /+% 0( (( 0( /+%C-@㼀`p0S Ѝ @oP0S 0S 0 ( ((089P 0 PP 0+T+7@-D@P@O@00S Ѝ0 7P+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08~9 80 8 00S08p9++À0@-AM0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS ڨ 0`++À@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00++Às@-@8 R 0R0` (0 RP08 80 8880S Ѝp0CR80S 00S808++Àp@-p@XU N8PE`V` D0(  p8Soppp+%(080S @-/+p@-D@0S PX* 8P 0( pp+%p@-|P`@l0 R(0p0CR0R: $0( ip00+%7@-@@P@P  AP Ѝ00P$ /+0S/0G-0PS`p@U @0 pP0@@@ X P005o3o @ P00+HP R/-@-4@$P(0,0P  $8 +%7O-0PSGp` 8(hS?Pp $8SDG(R008(h8! 0S0S ^ Ѝ0S08R00(hkP080h88S 08 ЍO`0F?oP20S `&0 S PpP0@S h x x ؐ ؠ \ < ٜ ` `  h   T وeP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)0$h48VL"3P( 圓R( B( ( W(PV  ᑣPPl?@hH80S 48PS8P m088T80X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0P0J``` P Q`*ZXP@$ 0P+T++%+J +V0 pC-@P M!00 0 B R   0.S 3 `! P`;HP P 7 Ѝp0 P`000C/ !GP00+J0(8R/+0$P00 /+00S/ + O-鬡MX[$ 00! 0S S`PO )Pg!@0HQSQ0Z00$@P7 pp{P0: SppV P)dp0 R'0 Y& @Y  K0H3  x*ᶳ al_lЍpP00+%+JJe J800S ,00S 00Co//+D+@+Hp@-|PPF@T p@``(lT0S S VS 7Sg@ @+8p@-@0S00S 00SP8P p@0pq  00S Rpll0P@ eP0PL0@p88 SP@3d%P++++++L@-?=@Q4G-@" e`T00P  00pတ倀 00ST  0W0 000S T28  +8+L, A-pPC @`0000  :P0;0 A9 D A0PP     P  5X A< +8Jp@-}@Pp$R0%S!S0C Sp S}  p p p < p p p p 0C Sn p p p p p p p D7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP k0S0pwp 0p@` 000Sp p@B0!S $P j$t00Sp$dP`p@&L00Sp7D00`Vp(m'p@4p+8++J4"JJp@-`@P 0p@N+8A-`P0@@@p0P/00,0S W HT T A,0, +8 =uK+?p@-AM0 70000^0  d0  _0  Z0 U0  P0  KP`0S1 0 ⫃=PU0 D<<2 40 Ѝp+8KKKK)K3K>KDKL +Vf+@-@0%0PiP/+8< S /@-0 0J4 Ѝ%KO@-@{0@ +8p@-x0@M@T 0S P0`P V@Ѝp`F0PS +@-@M0$ 00@S 0+8@-@@P@-@0G--e`㊋,B,r0(2(0@M0?000S0S  A10S z0S 0S4&5\0P P 1Pd0S P 1rP$0SX80S! vH2U80SeV}Z0PS0S\ /S US S S U U#38>P h#2Z 0S H:1' "1 +8++8, +++K_+tK}K+0%%P+K>ڄ++@+p*+ +@B++%KK++ KK%?+L%L2LAKW4"LRLe+LqL7S< iS0S P0 P P P 00[`P iV 0FcS񟗧  x    P   D $ T $ `  $ d , L  $ 0    H p    T   0 H  $                               00E.U S``dP ePdP= R0S`Fc 0SP0@_U0q ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  z@0#0P MP 0 a0CS00 0`/P  _ 00P 0Sa0@S @P000S BV!P '2,00 @0S 0|$ -P 0S.P ,Ta0ES000,P ,0 /UPmUU0ESe P P P P  P P P P P ( P P P p*U( @U6 !U[ Pq 0S US'T60S# PP pf0SL`960S 60S0 97R0<  J60S07S ;07S 00#0'ⳀD/J10@S0 @007S9 :<#0CSdP J=P 0 i0S e`p!S '0 0R0*?0G$80S  !S d(0 0R0*?0-  0R00 !ı 80S 0R0T  0R0 0!ı  (9 @9 0R00 !ıl90S  0R0) 0R0 0!ı  0R0*?090S  :0S `!S 0P:0S s!S 0 ~ "r L8G 0`jR00 !0060S0 !0<0!eSd0C0<0S d0 !0<0w<1rQ0kQ0 ~ b0S0 !ıd; T5 *N;0S0SSl @ 8< D @< H H< P ?<00 00R00 !ı<00<0 0 00R00 !ıJ 0< `0 0000R00 !ı4 ` `<02C!O?P`~ 0R00 !ıP? ,,P P  0R0>>0_?PZ 0R00 !ı P  0R0(?(?(0E 0R00 !ı?`P`8 \P?pq ?  0R00 !ı?`P 0R00 !ıP ^D3`P?P 0`0,`9P?)P 00,00  20S8V"  *0 P~P U U ?V"H0> <PkP U U -"80 P[Px U Uu M"q10S %PGPd U U.P!0P]l!% X(P0d  0R0L1 0S<10գ?0/!(!0 S00C0 0 4 0R00 0S00գ?0/! 00 0 00iS 0 dv,T00S0802+ +?]%LLLLL+l+À+@+  +00S/+Tp@-@P/!VpO-S`PpM`}`@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0T80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 10P R* 06P0   80 dP d [0J0C+T0   /G-pȀWY+p S@0!PPP @ ZPPE0S`0S P B0 0R R@0`Lp@-`R P@ b0P @@@ 0ppM-@Pp M@(p00`Cv RT0Ѝ0 p/e>P0/D p/>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#:  0 +D+8+A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ# 0 DPzdP fPP Q gR 0S 0R   R E0 i+D+8+@- @ @+ڄ @-P@,+ڄL @-P@u,+ڈLG-,2pW pЍtPP* Q0`tp`@P 0 ppqb tt? SZ  b0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Uk 5 P @U(X0jP +++ڌM p@-p@`PP<I,<0RV@` `<D IP +p+ڄM 0 +ڄ 0 +ڄ7@-dP@ PP 0S  P Ѝ0+ڄPo/@- + Ѝ*A-`QpP P P@P%U0P 0 P l @0aT @P 6/PaMIJpMY@-~|0p p0h hhP 0X X@0L L8P0@4 4 %%Ma MsM MMMMMMC-L1M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@+D+@+HG-@`M0PSS003 @ R S0\R% :R R DZ Pp P0H3/0S@@ R0Ѝ LP/@-tp U( q*>`Ѝ00S @  d`*\0PT T Q( 8(pq M*+MMN G-@P`pppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(Vp0  S bP 0F@@%%p@-@QP 20S R SppQ0 QA QR P/@ PRP/p@-`; PPp@p>p@. 0@-M +0 x@sr  * PP  000Ѝ0+ +400S/@-$@P P@++ @-@P  + P/ @-p@''0@-M@'qPq00S@)PaP DP OP AP )dP oPi|0t00SЍ0 uq0LP 00]pq~q00@#)+NIN%0NO-(M0S 0S 60@S Q v P 4X ЍM 5@k Pp 00o pPPP`TUP DPP  PPpPC0S P``30STPQ<PN ((@(!P3`00$P0`0 pP0`0 3P T ( i^0 bpPl& 20SP `JP   @( YP pY |2 pd T2 D2p@20WF0b,2P 0S P (qP11P +&0S )/ 1X P DP Pd1 ]L10S P] 010 (0 yq 000Sp 0 5P 5 0 R  [ R 0G 0P: l X + +BN+O$+*N++,+++++@%+(, %OIP@- 0@+ 00@-$P '@+ONA-P`XpVWPU@JTXlP0, 0 + @-zP@ @0 + 0 + 0 + p@-P@@P Pp@7pp@-@`P*PpVU p@K Pp PpA-@Q`Pp f\\U(G-@@` PР @PUЍp pP\7CP \8p0SkЍG+ @-W0@0S @y+ 0 R/%R %R0 sR0/@-(@0SP00+OOG-`dd@p00CS0 p PP 000 P U 0D IS  9WL\p@P@- 0POA-@0 0pR`@0S00 R0S@00`P0S U  ᪑P@00%%O-M@`|DPp!Q Z]`@pW*p%pP` P` X 1P UpV`NP:`00@0H0L 0`uЍ8P V@00%%O@-@*pEPPP Ѝ@م@@@`H0H 0P0t[ …@[ Ѝ @A-PPЍ0S `p@@@6ZPP D00< 0`tW mPZ[m +V@-@@ JpA-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0U@++ C-EMPPEߍ@0 @Spq `,VmPڬ嬐P ` P:T0S EmP @  =0pSC`P  P@+T+A-kX1@0SGk @1RpP? ,$? 1P````P0p000 0`00sZ밀P@pW UpwZW Pᜅ0SkZЍ UbZ@+OO%%OPp0A-0S@`@P0L s@p`P;Z@8Z6Z+P @-@@P ,P oBN@-M@P Pۍ@} {ۍ1O-0S# 10SPptP 0 `|R@0 -R` dP JP @$@ ЍRP OPP : 0 $s Y P YU @T ` vv`#lP T@@P@T 000d0@`P<`$@Ƅ0SY+d+LP N0A-`V8@PBpP0 PЍA#nPk`@@@@0 `r]Y[Y@VYT ЍA|Ѝ+P<PF-M  mP  @oЍ0@-@P0MSP @TbT lP2!@Ѝ0@T@0: S *{@S+%%@-M@lP͡0 00ZЍ0@-Mb0@Pw lPl0 0S\P0 S\ tu t0Sp00Ѝ0+ ++/@-@AP P0@/R@-@ (0@0T:$@+ @- 00R\00S@@++h00S /pp@-pq $@tqP PQpp+L@-P#Q3#0 R/  +O-q$M0S|10S%@-P`\\100CS0S#P`uv @@P`0S00S$Ѝ{P`@oy 0 R  0吠00刐 00 000 0 000000  0P0000`0F + ++À+8+ˬ+@O-M ЍO} *O-@P4M(0X0 ,0utP @4Ѝ40SX4  0/Q)(P@PpLd00$0<p P:C   `V0/ ;3p` P PP00@ἳ弃0v V ` VP@,0S4 x3X4 P @6L)X30pW0 0 `P20S Y Y` P P `V@Y*.P `@T_P @0S x20S 0Q (0 S 9 8&PI 20S 0   P @1 0R00S7 P Pc p 4ЍO V0000Q h 0P@ R ~LA0 Pp``rP@,1` !X$0e$0@Q_ V V]P@k P P Pe PQP@ut$0H$0@Q_{( 0S V V0$0$0S 5P@ B`0 ++۴+L, ++@+h+p++7@-P@{P ,0 R  000 Ѝ0+@O-p`4MV0 ?  4Ѝ p`30S3V0V0 00B(4(t30V8PT30S @ T T,CF $C0 PG0000PO00 0 P @,0p 200(00P P@0% 0P,0\" ,00H" RF0 0Rï[0 P P p| p}z0Q Z 0PO,0P!,0 R 1 P 0$00(0 ( $P\L10ST 0  $P @H X XX P P@P PO P@P@P P T0'I r0Bz{0 00S X X0,0,0S0S0b0 P$0 P$@++۴+h+, +@++pqp@-P@ SPpp P PL0L`P@0SV3 @TP@P0P@p%8%@O-PM@`<P!@@T 0000 00V `F@P0 @Y20S1 ЍO~#pP ЍOd 0s00 T 0Sq G W0!pF0x!0h!0 0@0Ѝ00[ 00S 1 0000@0@ 0UPuq@ p6Puq@ %P Q0@` 000CSed00S`H0`0 0`0@+pP+8+++@-p` Puq @uP 00S h0 Ѝ@2V0 @P80 (, Ѝ@ p` Ѝ+p+PP@- Ppq   Ѝp@-P p@`@P@PQp@0pq  Bp@@PQpp@P+8p@-P@` P P pP@000S  p@+p@-|P @,SQ00Q  B@Q+8A-pPpq\u>`vq@A410 `Q0T0A Q#Q>+0 R R /p@-h@M0M0P`0H 7j P*`0 /j000nۍЍp+ QX0+p@-P@@Ppp@-@P \R ^R3 R    0tR'jRbR< 0BP @R00 SH# 0 Q' !kB P Q\ P P Q, P P P Q< P QLeR 00@! 0@PS RQ0 p2 p@@p x2@@ @h@p@\@p@P@pQ 0xSQS DSo LS 0F ! 00 0R0S@@@p1S] BS03 C^R!iR C&R S Q Q S Q Q S0 Q Q Q Q Q Q Q Q Q S8 Q SP R Q Q R R Q Q R Q Q Q Q Q S Q S S Q Q S(0 @@ 0000 0000 00 000 0000 0 00000 R      R .+ %X+UG+Qm4"QfO-`PAM@ M\`p㼕Up!`*(p*0,p<00}*pQp `T4PLuK DjpPF!0 0$0P0  P   P ,00 +PᶖAލ Ѝ Pg tP \0`=V* !V' <V 0F^S0`͕0͕0$hL>V =R+` =R-`8 { Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =9PV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` P `` e0Sv} p0Ps {LM%`+ %&hQQQQQfQ4"QRQR(R7$0 RP  /+(0 14/+(0 Q/P/%@-04 ,    00++++G-P㌐剀L@LPT`ppP MT M g ! b M M @`匀+(A-8p@0PS` 0P0aP +(@-@$ 0 @z+(P 0 R   /+,p00S/p@-`@mPPPpP 0S8@pPp  ++(CU"@-@P00Pl0 0  ;D01(</(8-(4+(0)(00U*+(YU;UL+++++P/0/+(0p@-@00P0 0R0 .PPPPPPPPPQQPQ(H(D(@(<'Pp P0 Q00+(+++++C-頁@0PSpM`Mp`tt!0 0!0S0@ 0  Y@P$a00CS9 `P U9 0 Ѝ P -0!0S @P 0R 0 0rq U l Q H S  yPuP++h+$+8+(+4%@%8,0P$0 00S000/+h+4++8p@-L@P`0S0000p01S 0v'P+(Pp@-`0 p@X10S |P@@p(1@0PSP5pP/i`P0@@S  1CP0 1C#@)P 0S"000|  0p  0d  0@@PC 1CPP +T+(++++O-M@pD`C00wvP1S{0\P1 0S M 0 S1C10p&QH   0   PP20SK 1SH P"1 sr R0x2q`01UPX20SGXR 1R 0 sr0`pS`K e`0F[K 1RLЍ1S l 0A# R Y1S1S  p` 0gP  00KO1 0[0 `0S3& UzH& 0R 0çQ0pP 0C001萄 S lI  0+(+$+8++À++LA-pP`p00S HP `P 80@0@D@ 0@0TЍ++(+Àp@-P@) 02PpA-`p@@PGE$1S 0P $@@+D7@-PPP0 0 B01S0R4AB~@D`  pP@DT0CR0S*A8A@D00SV0S P  0 7D00S p9++(+++++@+++T+%  +\HA-(BP`Pp P U = ClP  U@10S ! RS0QS 0`E0 0S$ l10S 0SB0$1 01 08P@0$1Q 0S&0S# 0`00S R 0S$1R0$QʜPP E E 00WT$@0O0$10P0 00S $+(+++h+T+D@-(@0S =500+(G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000X0 0C0S )10S0 0S  G 8Y 0 0R  x00S U d00SX00S D00SX   +(+À+P+L+$+ˬ+˰+<-0 R!  ^ !0+(04/+(0 R 00S P@0~0/0P 0/\!4 0 / B  0/+(+t 0 /+(pq/G-p` @PpP 儐u U 0 0W 00V@00CS1P Q 0P@P+(, QG-P0Q`PpЀ@ 0@Dt P kV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB+(, G-p`P@0@@0W  S #R0C00C0Ѝ #,P  j F 0 ?pGA-0PP@q1e`EP q0 P 10+(G-1@`p`P0LL0 rS00TD`0PT@+À+8+(p@-@PPp P0S0>Ap P%@-0P %0 P/0S/  0S !/+p00 0S/$0$ R T+p+Ue+A-X@ 0S0dS 0p,0(`P` pU` r0+pU}X0QH0H 0.4 00/ 0 0+ް+p+A-@PU ^"04P4p 04 R0PU R4`40 0  P^P Pp0࠱`  0+pO-2P0sUPPP@Q0Сp`@` V 0R00 SRP@ 0 V 0 0 W0QR 0+4PP@` Y0  0t W`@TP0 00 0` vq &@P PP@p `W 0 0I0  0`yq @TP++p, Q0G-dpPU  0R0!RS@ U W0S P*P @P P`@V0 0 0 @0 00r  0P`Pl`@W 00 @0 00r  0P`V@+p, G-`8@Ppl0Vs 0S@P`%@Ptu TUQ+8G-N@P0pP`xx80p @ 00 0P` 080uqQ#+p, 800S/,00/QQ//++ 00CS0 Sp0 SJ_0 p/O-0P-SP Y   9 eVpVPV@P0S,}@ 0R S%t@T B@CVV}V:X   m  0 ЍO`P T@Q@ <@ 0A $ #]C?vU+ @G-@P $}`P( mpP ` } { ?" H @yz  0Z P p@ ;p Tt p@n  [ 40 z pUc?+C-`Ixq p@tq@PP.Y U0 0 Ѝpq0  p 0a0@S@-TA0@S<0'@ Ѝ'P( #P  P ++P+0U.Pp@-: $P# 'P> P 0 srp7 p^P 0 &- &P B06 p"Ptd0`TP@\0 L0Af&P,@m006pU+ +P+8+PG-@p`dP4T#0 5T Ta0'0s000Pp0 B@6T` P'0+@-o0@-MPg@P   rsЍ08!P B0 00&+ +@-GP0 sr@0 ! 0&+@- w rs @@@60P&6 XB0606Ѝ++ G-4@PP`j>T6k.sq 00P6 5B06PU p)`'BP0PPЁ G-P ++ +@-P ,0 0R 9 + Ul0@-0`  ^ @^TSa04S '0s05S #+ +0@- P@0 QA6R 00+G-[pP@P Pi`PA`Ap6W @+00S/G- M`p\@吠吐pqp6W @ Ѝ 0 ~ PU!P 6P P 0 [+<e+V@-000mS Ѝ 0 Q0 <@P 0 S#  PPP0`0 S  P0 R pV`PPp OAp00+817@-PU0P( P@ P0 Ѝ000S/@PP A]PA Ѝ0@H00S< Ѝ0@6 0 0$00 +V+V3%0VGVbVn 0 +<00S/7@-@( (P/@ 0 Ѝ0%Ͱ+8B@+@-P M# @0.S [00S Ѝ .0S 00 00S000 l YP0@  0R 000@0,0V|%ͰV~V+VVV<00S/7@-@( (P/@0 Ѝ0%ͬ+ÀB@+l@-P M# @0.S 00S Ѝ 0S 00 00S000q l YⴼP0@  0R 000@0,0]%ͬVW+lW%VWA@-@PP  @D ЍWe@-@PXP  @5 ЍW0Sp@- Sp00S p@t# al0p`vP p@Puq@ 0p@ j+W++P07@- S S8l0 Ѝ0ҾXP@T0PP ?@y Ѝ0@?0 00 %%WP/L0@-0@S 00 $0$ @+++ +VP7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@Pi?׾ Ѝ04@P,0  0 10 %%, %+*0/0+P/MP @P/"@-@| pl ᫻@0TxSPLHD@<8@X%WWWXXSXwXXYYR@-V0dSK@S!1 CRJT" R&0CO  R \ @P3 @.A C#R d  , | D d k Cr \ ,0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~+,YYYO--@N<M`00PP*0 S 000C S0/   00 Bp/=pU:Y U :TЍ D0!R1@0P S 0,ST00( @0D@D1!0C 0 +\%H%LC-PMP M 0-@ၺݍ ЍC` @80Sڐp吀吐n L90PUd`8_P0P <9 @@ ݍ Ѝ 9%HY+\2Y%LY*P@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000%%ZZ)@-PM 0  0 x0  @l(d P 0S>000D ;0Ѝ,0P +P+LZ3P @P/ 0 /ZK+P/00S+D0/@-@0S+@0/@-,@0S0 0j00Ѝ+8Z\0/@-,@0S0 0X00Ѝ+4Z0/400S/(00S/@-pq@+(+ P@- 00@ ^S00S00 Ѝ0@ (%ͨZp@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ V @+ +ZZ!L[P@-P A7 ЍRS+DSSS 0e C R   E C CS -S 1 CR 0CrS dSWS ^S0SM0wS     0  E000 0 FK N R WR Q S-00 0  [!+ [<800S ,00S 0P//+++ $0P/0 0 0C/++8+ @-PU  @; Ѝp`@~kPppQ 00S0\Q0S 0S@V =P 00$Q00[O+T@-0 S 0*( (.U Ѝ * &U[j+[o@- @ 7+[kP/0S/P 0  //foP@-/V3 0LP/+ 0@-L   Ѝ+[O@-`MP@ᗺ0-S0p00Cp S T 00ЍU TP PTU $PT00W`[z[O-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@s093@!+P0P0U0 P @0+S3P ;{;9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P aK[  0 p0 @ =RP   R R tq000SPP000p00CS ` 8 8 8 8 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S +++[\[@-@PM @PU@`p0@ mPzPU   c(A R  u 000CSc < x x x x d RyV)00SS# P|U  U Uc0?o20RP 2/ 0RP0 VW 0 {Ѝ 0?o2RP0U U U6W0 0S00S00W 0 0S00S000ESX RU U U , 0 S0R  c R U2/U~00SS 00S000 S000;S U000 0 \A\P\l\\\+s@-P`@y000C S0 ` 0 Br ^ ST00T00VЍp $`wS 00[z 000S/P/++@-XP H0H@ 0S0S  0  03/$@\+%P 80S/S/ 0CS/$%PO-@pM8Q 0S [= 0S0 0 Ѝ`V/$P  0P ! AAQ-P $ SQ@ S0 C0@@Oop B0 R ` 0 0S Wp0p%P@- PP0o#%ʹ/-4M D20S8塊P 2     J2 0S 104Ѝ001 0R= 08"$01S 10S 10S1 `11S(  J2 T!2 R (10P!000 0 Q R  RJ0 000S P 10S 1[\ 1P 0S} 0#Sy ,0 0S P  0!++, , +ި+\%ʹ+L%ͨ+@-+@- 1 Ѝ@-P{h9`a@^@@Ip0 `2Q Ѝ@-@[9P  (3o3,G- p$@P`0  )  0@@ό@ p\p3#@- d0  Ѝ(7@-P@2#@/ Ѝ0B@@-803?B3c/  0 IЍbMB@40@-0@@T IP  0 %͸,+@-@0@%͸0$R/ $儼,p@-04S S S ὦ0S  0 [Q0嫦0S 0  C 0Q/ 0   ^R000 Q\ S$R 0C 0 N0P0000\\   0C R 0 C%, O-pQpPpMW My@xcPJTpd3dC  \\Ls PZ PUA (3T aRۍ ЍpPS@DT2P@ ᖣᓣ @@~ 0 j"X  '| =Q@ 'T@"0S000qP ;04P ST@ *. Pp 0Q 1T  RP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P0/ T0p0000,, %&h, &o o0@-@PP |P lP \P 8P8%pp pp@-@P @P P P(@Spp+pDO-|1M0S" @`0 ЍO^pP400 0 Ppyx@`00S 000S  0P Ѝ 60 000 { % % 0S @`, , pU++0@- LLPR^0S @T 0 B, %0@- LLPR^0S @T 0L B, %0/, 0/, 00S /, @- JP 7P7P@-0, //@-L@ p0 P~S0PЍ, \ QS *0/QR QQ*/0000/@-@P %000000/0S0C 0//@-0 #3P Ѝ@- R@PS/ P >B`Q  c$` PЍpA-`pP@T@  A-P`"F$@p PQ ,0 0(000ePЍFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`p?PP@@%?0P0U0S P@s@-0P00`a0C@S                         PЍp  000@@0 0 0 0 0 0\/\\A-1!0 Kf \[Pa@1!0 @f[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CqQV 0p@]^S @p^404 0 4ep\00,,pcoppp@-0Pt @R RP D D <@D@ p@, @&,,pC-1`pMQp@P0᠁ `0Y 0 ].PR l1@d1`0 Le\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . Cr R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝ,,,q ,((00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0 e0IS@P R00ۍ Ѝ00@00 S00@,,qIq O-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `db`0V  P0 0c"P, ,(`,,qkO-`M@@_.0 0\0.> 0dd S \|.t>0 xUd Q \ x $ L      0S 00@0!000 0S 00@`0`S 0S @p#S ;S 0 p00@\ $P  P 0S| @,Sv p0S 00@P 0S  00@[VXO~,$, *, w7w@wiwIw_ykw@-@dP ]wP@-@@P ]wp@-@PkPp0 ]w@-T`@PP  0[#p0 S# Ѝ,(@-`MQqM0S000@03 0@0S  0] 0 0S S ` 0l5@P *0 )5 Pb 0Η00ڍЍ,(,, @-@P  0Sxb] p`\0 `  60P S w H]ЍЀ,(wqG-pA嘁!0`PU , R:(,>0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P     pr  Ppu PE ,  R:(,0(0   V 0 ,(&A-@P p0R`*W00 6 0P P 0O-ؿMO00PЍ080?PU 0PH0 \ R0S40P 0!Q0Q0 0\1SP R 0SO00C SQ0 0Q0=0C>S 9 ) ) ) ) ) ) -H ) ) - - ) ) ) ) ) 1 ) 2( ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ,T 7 , -| ) ) - - . ) ) . ) 1H ) 1 2 3 3P 7 ) ) 7 7 8 ) 7S4 0 PS0@oP1  Q Q* S  H ~S 0Ri 1cQl0Si0H0Rl0S 4 0 q1S Ps ^S0@oPfQL0 R: L `0p0080S8<;8 00 \04 0<0S sH0S[P80S4PU 0`  E⌗P0800A E4 0T P 0  004 0 0  0;S00z040 0:倚R <00sd O0P 0S M0S 0,( ,P2S 0 H=` 0S0`V: $ 00@ 9@n0S iV 0 [ H0$OP x0 0H$0 $0 S9`0V: $ `000 00C 00P0 8 0R:`8 0 `S p Lה,8 P0   R: ` 8B 8` 2'1 01S:` 007 20 S0``78 00 g04 0ڔ<0S Y gP/0800 WP80Sg04 0崔<0S  380S0p4  HV`P <000F400<0嘆04 啔<0S V 0400<058 00 8V04 0}<0S fL0 R: L ' `0pQ00pY R  Q \5 0LY4000  P 04`Z Z 0Z000 G 00 0 0 VrX4Z 0 Q\ 0t 0 |0  0RQ7 p0V`XCcH0p0<Hp<(0000S s04 0<0S bp PA #000Q 0 D00 p0V`0  `0P   P\  p0VX`0 0 P[80S0s T"Tp)p0 89Y04 0?)40P0 7)P 0S 00Pw80S0s!G)p 4 0)40P 0)P P R0T 0`pL<0p<e80Sb4X_  0`Rl0#0VT*0000pW(p0 1(W$0 p09,,(,(D,,,(d&%\CF@th Y,  www,w,(, *4"&p,(|,(,xH  !  R 0gP 0 pW* 0$ t(1 0X`pH0`0h<Hh`<x0h00 0<0 0R0((Q 0{Q  ,4",(dp@-@P`Tp0wS {S sS 0p (P 0 D:X0`@p v(P `*G-`KPPU00Xp01@ R  pҍPVCGXpp0!S < CrQR2 ; <0 < < <0 0  W0 0 00 00 00:S 0S0S W00 000 0V 0S`: ̑P 000BS ,(xx p@-P0@T P P1 0S- =t = =T = = = =0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@,(-!2 0@-MMP'@P  P]W e'p4UW+ z' P'ۍЍ0*x*H0  BR Rp R0 p/&h&@00CS0 S0 / /&h@-,A᝕0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@Eb,)1@-01\ @T P#OoB\@T P P P QQ Rr P\ p\ P P Q qR  -&H,)0@-  `Ğ\ @ T\    %R    ,)-&HA-pA0 5S$\! R  (P 8!傠0  ,P !y0  4PP6 A <0S 00 <_P`p夀0U00S 000\P P D E000 ?PS-&H,) >&,)Kp@-@0` +T  .td l'P`PT p P000ST @&h&x:,(xOs@-@P 志P 8@P @0?SP@P` pp Ѝp/P@KP 0S S @ڝ0S֝00U $^xx|x_@-骝 -*x&@-0@<TQ T00 -0001S R0Slp@DTX` T@0$ @H4x-T(8  @,o-,)xx&-&Hxxyyy!@-` ^-W*y&7@-@Pu  ᇎ0S 0@T g00 Ѝ0a0"S p`@-@P  p TЍz<0p@-XPP%0ATp0 "R   DS " @DOAp%p 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,H0P01p,,01//00/00/00/00/00/ 0  /,v0v 0  /,v0 00/f00/z~00/z00/}00/z00/z@-@⁗,|\00/@-@s, 0  /,\f 0  /,\z~ 0  /,\z/00/00/00/z00/z00/z00/z00/z00/z00/z00/z00/z00/{00/{00/{00/00/X00/a00/ l00/ 00/{rN.gb@-0  0Ѝ@-@ +@-  ,q 5@-0S04c  +@-  ,j @-0,, @-  ,O( 5@-0S04c, @-{# @-0,Y,|\ @-  ,{[3 @-  ,~Z ( 5@-0S04cz,|\ < @-  q,< < C@-h,y9< @-  `,z\ < @-  W,w; @-  N,w;  q@-E,d e@-=, e@-5, e@--, @-  %,v< @-  , @-  ,x: @- 0,, @-  ,< C@-,y9 @-  ,z\ @-  , $0Qa @-, @-@D⯕P d 0  4" 0@-0 |1师, p@- pp@-P᳍p @/͆p@-( @$PbЍ *@-P@-40, @-@0@2,0@-@0@),0@-$0 0p05 Ѝ{7@-$0 0o05 Ѝ{7@-$0 0f05 Ѝ{7@-%@0c 5{7@-$0 0h05 Ѝ{7@-@@H0@-@@A0@-@@:0@-@@302@-@1@-@i1@-@1@-@@-@@-@@-@,700@-,!Q, 00@-,!@Q,00@-,!Q,00@-,!Q,@-2@-2@-2@-2@- {<@- {J@- {X@-8 0@- ,@-3@-GS@-T@-@-qp@-P AN @H4S8% 4# p \  \ @-PPL04S@ <   \ \,, @-PPL04S@ <   \ \,v,|\ @-PPL04S@ <   }\ y\,,@-<<qP d(0  ,,4"@-<<ZP d(r0  ,Y,w4"@-<<CP d([0 y ,,4"@-$@‰P I,A-\`)qW H5@P |A50 ,M00/00/00//A-P@`100# 1pS021(S%0pOu10#1Ux  Uua r wRbFW80S  3/1SAAuL0p(q S0jF`b ~p|{h  O-Q@`uPMPP%TJ S`PP E 0  08pW 0S  p1 v1 `Vp@pGqS100C1ġ`F10Q@aQA\00Q0S< 10 \`(0 p0 0S1S1S  0Vp! I10 CЍO= G  up0S 0V01`Foa 20S2 0 0` {mp@-@` P  0p@E{@-@Q7 ap a a a a a b b, b 50S04c @   ّP X03S B \X T T L0,< ,|\ ,~Z ,{[3,Y,w,v{#@-@Q: b b b b c c( c4 cP 50S04c @  呑P t03S B> pl h hd d`00S  0< , ,O,,,,x:, @-@ Q? c d d d d, d8 dD d d d 0 R $b @<  C  7P \03S B lh d d` `\00S  , , ,z\ ,y9,< ,,,,x:, p@-PQ- e, eT e` et e 50S04c p@| | / @`P 3S/ 8B A. p ,qQ f f f( f4 f@< <4 40 0C( $ $/, ,v< ,z\ ,y9,< Q f f f fD D<0 0 0,00S  /,,v0,x:, Q g g g, g80 0v( (C  /,,z\ ,y9,< Q g g g g g gH HX@ @< <8 8C0 , ,/,,d,w; ,z\ ,y9,< Q h h0 h< hH0 02( (C  /,w; ,z\ ,y9,< Q Q Q/   , ,v< ,Q Q Q/   ,,d,q/00////00//00/00///00////00/00/00/00/00/00/00//00/00//00/00//00/00/00//00// @-@0@,0@-@0@,0 @-  ,z\ @-  ,x:@-/0, C@-r,y9 @-  j,< @-  a,z\ C@-X,y9 @-  P,x:@-.0,  @-  ?,< 0S00/ @-  1,< @-  (,z\ C@-,y9 e@-, q@-,d+@-  ,q @-  , @-  ,v< A-T`)qW @1@P |A0 媄,MA-@PP 0S d`/P  .`1S0RP /P 0p RE .`@-@P=F P x i0 0b}i000p@-P` A Q 2@D D"nz<0e#Ap RP*U<0p%p@-%@%@-@@Q@-@@R@-  &{p@-@0S*CP) -]^P I 㷍Lj|PcrbrnC@ .P < 0@ S< 00ppp,*- %pO-,M@0P0 T; R0AT 011!0 S01  R01;_P },0S  R3/00S 3/[1P  SP \0P 0 0S^`: p` 0 011S`@S0` $07P$0pZ$0P``Pp1U00$0PeUP0!S$0๟000CAP PCڰDPA_A$ Q!@ Q(_ 1  pP$HH "0 `p0C0CS0V`0Z `1Z츟0Z_ 0 000 0!0 "P P V`x 0CÀ  S CUPPEPE_P0 wP ^ 0 0@0 PQBP vKj1 0 v | Q 7%w+눷PgXP Pl7000F<0˄! "1 "0S  SP 1S b !ġ1S 0C" !s0R11$PULHfppp0 vP $v=|v1b!`P 0PSY *D 5oj0 jj 弎\뀥GX P|500xPF qPC >P' dP% <P  SuP5P 0CP  @@PV 400C`F V$P P P0S p400C`]{m1ST !0C B/!?1C_xP00 S11X@zP`PxP@a@1S50200D(PZ) @@P v z zx0@S z v {H v x v v< v v v v v v v zx v v v v {(L3P#0CP?P* <P >P P10!1 NSPNQ0^ B жr0s0Ɣ P P?@ "0C S񟗊 vH v x z y w{WvPr P1a-C P uVz1S'ʰ1 C P uGzP 00P1 RE40S 3/P\f PP Wf P,ЍPR0j ] 0Sp0W 0] 3/pW P `B P nu .f `z)f00x00A>0 b02P `00P000`y f,*+{&|=|m- RS&- |& 001/,*P0 R0//,*O-p`*@PP [ ! B0P @ Ѝ0\00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @,*|P/D0 R/0@-A1 P e@< ,*O-Bp0  W 3h0p 000f Ѝ`((0S 0S nP W000 @  S! S0 30S znP W W 0 0 0 R @ S 0 \nP W0S W0 00` S P0PS PH0SPP:n0 00=n0S 8nt0#?C S WPU  j0X!0Cs0S;3PP0 PEnW,*&@ UUUVO-$MHZS  R0P 0L`Dp? =0Y0 0S 0g u{ngpPmmm@`0l@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0gmX 2 rg0  B‹bNU P0{ P>  PN P P!VUA`E DOu@DP`0 g gg@`"PD P AP;  JR !   ` D0'u0@0!P`1 V0p00@  \n`Zx`F`FV0p00@  DPEt@DU`E¨` Y @ z@T`— R    B^V0S 000 0 0z$ЍO0Y S ,* }G&&A-lP`Pp `l@l@0T `P@ P P,*@-P@p 00T0) Cp@Ѝp0 00'0 h` 0@ k@@t 0WP  %,*}ǝPp@-@TP0Ps D` R :ڰP 0S@@Q@p%,*@-@?,*0j,*0j,*-@-@00p  Ѝ@ Ѝ/-@-00 a Ѝ Ѝ/-@-  ЍЍ/@-@@*@-@*@-pP@`M,0 0(0 0 00`Ѝ@- Ѝ4"O-M P`@p l@lUjT0 0cP  0MD0PSY 0SV L00SRDr~PPL00PTP]y@DO@W =p 4~PQWpV`KЦo`0 S`K0 p@PC@0 %;PT0 0P00L00$T ?Z  q eb:v`b^bЍ00D R00S 0S ~L0X#3pv*qP 0 vq똰EEDdGd >!0 EGpfP`EE`*d-d,*}- @-,, ($ +Ѝ4"@-P@`$0 0 @ 0 00`Ѝp@- Ѝ4"@-pP@`M,0 0|(# 0 00`Ѝ@- Ѝ4"-@-00e   <Ѝ Ѝ/4"p@-Pj@jp,*@-_7@- @,ABb$HcXPU ^% P~+H00h@PU N%T @~H00000S$$ Ѝ0,v4Jp,,*8&O-DAM@:PP4q@ &@   ᨧ@|Pࠟ   PGAߍ`V } $R`PX Y  ဧ =R@x@0L `wQe&{ 1@-u0O-MM 0p@|`P2 ᠁PP* P QP 0S0 0$  o l MPP̅P 0 Q0 0@P zۍЍ40P 0 50  05  +V,00S/ 0P F@-`,,$@-T.P AP <=AE(?"P@Jp +VA-@M @0S0{1%P,  V0S#M|P  c0Sl Y0] z)Pe,B@PaD'D*%B^&'ЍP@R<v}P'P'20S $AP'.dAp 0$!P<L} X $P 0)AT 0PP ~AP p`PP 0q+Q Sp 06&V`T(p`AT-}@p0T-:W?"Q  R@4Q p0Q  R@AP`003/P 00  h0S  R l 10!@@P,,,|*@-MM+@(Mv+(vB+(DvB+v(3@PލЍB*@P 0 T @@@@@ @@@@/'B(?b V-MM+ v+L u+ v+0u ?P  >ۍЍb V0@-@M ⽇1@@##P @  qP A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*@P3%P/[P+W@P'@P# 0P{ 3;{  0S 0_ Z'P @P4o0m&(]*00,,ait- - @-@M ;0@@ ?V#P* @@b  q{P 00*!R00$Q *@P  }0S 0` 'P%(*Ѝ,,O-`M!  0X#*0S ` 0 SS 0zp0 S00C `@ z0 S:$3PP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 Qt&7@-@ PU F! zD00 Ѝ0llBP Xn .!L h z;(( 0$[*, Qp@-P @<00S   0 p@5 0@,,v47@-@ PU  zC00 Ѝ0PP | vzd00S L 0H[܆0 ,,v4 ,Ve &s@-8Q`@9iWz _d}_,dy _ dc5!d_ 6ye 0 A&k@Pxx4m 5P s@(@^^ yЍp- *& O--{MpP`| 0p F 0S  P R  0S  됵P y뀥P ykp@T Pe DS0B? 01I*P "B@P "B00PP^; P  lY; ;0S ; P ; 4B800&y4"0{ߍ4[.3 ,p0z"!`׋؋ 031,0l0,0L,0   L 0j P600Pz?"!!0 # `  PV  YP*U l @2 0S h2P F =`0S hPU WDL 2P0   T 0  SR 6 4 1P x 1 T 0I2_z?0YC 0P0SP @ 0V0 R0SQ ᣳx0S/ P ]xk  PS 2  ,%tptbT@f,v4,uWef,x:i5C{,$|0@-0,MP0 00 0\PPP@P DDD@0Q ,>w,Ѝ0@$ 4%&,v4 -O-piMs?!0>W P 00iߍOЍ/l|j@PX1P L!L0J0 $@P jZ` tPPW0FSV030#Z0S 00W"A!` P Pp0W0@U80P , 00$P$,v4 -O-p0MT@X   p$pL `V X @M'U` uPPuP@P ;H E0@PU 0'SP0U*S/ ·P u [ u0@ 0 0H0 zP11Z ) s0.p`PUQ S (  2S022SP0220C2   S`` v$00 00( 0p|W  @0   (PU bb(c0U 3 x\W 0X0C?o20S 4\`$1\`cv@0Uk'\$\v00CS0000M@R0U `Y$0S  r6T`fvi 0%S @SJ B* B؁D0 0t/00L 0.RP 0 0.PH00Zp@P 0A0 0XV3 4Q5!fSBv00X (SBb@:0U b/vz  0UX ~,`[C`vKkNR 0PP*W  $WK0ЍO Ѝ/ )r>  @th- &hA0@-CMl4.PP 0S .QVt@P 4yoCߍ0 Pro ,*<,+;G-p@ 堀堐PB`AT:00Z W ,/Z 000 "tP EQ 0 @H&A-`Pp r p@  ,p'o  P+ @,,:A-Pt@topl o0S DQ0Q.SP @$ $n n,*< 0,+;@-M 00PDP  n 0PDP x  n  p@ ( ╀ n . P Ux@&  n```p @'PPЍ xn tn`i!,.:i%,.X,,:(i8,.l-O-8MXd0 @,nT400%s0 ,@,P40,   -8 4d0 w=C$ CTrPP, 0.̟ Q(]?P 00 ( 0 0uPPPPP;@<,`0tD0D,Dq,y X\<I /  0p>0a Xvm +PP\  +PP;U 1sS 1lS;"000 XP p@ v a! H]dH Qp0PKP[P{1@+0~( {P {P  {P {P {P {P {P0:4: @p A*30p 0HAqp H0Sp:K10d*dM%P 0H0 H0Amqp ( APPH , $U s XPPP@;={P@- , m)0xV)0wQ'{P\8 0\8UXDy0 y?T. ()0z8;{@PEPSPN X0 "\6SE p0 6@P: 5 |tl `[7S'  H@8w<(7@ P 0(AqAP\XP@Ps:4S 0 zP 0'APpOP 6H'X0b@Pal\804'8\8P$W 8Pl8 "qP0&08P 8>l8 qP0060&S\880\8P 8&l80S \&8P 8l8 pP000S\80\8*P0S\80\8P@sT %0}C\8%0|;5T$A Q0:$R$ Q9ğP \0şW|t^H4   3ᆢ4SP  0@?S @P k4{ 0Q0:$R##TğR#$R#W%HR $ 3   Ts0S1 `P 2@T R)NHHh#00S "0S 4#tq#;3S3 TE 4"P0  0@F0@P]cP$A?p@Px080Ca@,0,6P pDT0S ,p X >0S@0 <X+4AS< ". 0 0S DoDW5S x!"o0 0S $oXiqXz,*<a,v4&&% ,,8,,SO +Vi,.vW   ,,: |,+;,.:,/u,0 CGDbmy2!,/!,+,/,.X,.L6S^,2m-P 01/ 4"C-鿏P@,MpxP3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ ߍGNV@-p`CM|@/xPlP#d0RXPP @ W<0080 `0(PCߍ4"c,z8,<g ,@-@ @,@-0  0 P @0@ 28 0/P $  Ѝ,8 ,x:, 0@-0@XMP0  0@ P x x0 t0Ep@1P0/Q   LL r 1 0/R@, ,@h Ѝ0,*< ,8,,x:,8 ,|-MMpTPwP  mi ii0 00SލЍ\0\ \VP L0 (0< + 0, & ,z\|,8,y9,|,v<,~,`@-RCMX6S P \8lP XoT20S H2\6S 81020" (72`Pr\8. T^Z10 A>:4S !74\@D10 +:4!SO *00 0 B ptt1@P) +1d TL < 0S ,!,$!$0S   8HP\6S V r8;oCߍ 0 B,*< 0,,,:,,8r~G,.v,.L DG,+;6,.:N eR,/_@-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0PQ0//!01000/ 00#0//O-`$MPA@T l p%P00 K0S 0S0S$ЍP P00 S uS, R ,0S R : 8 80R:P#3///@-@MP Mzp" :  *`:p Wd5\\ SS=S 8 d3R 0 ,d0 _ڍ ЍTTey@-`QM p@ P PP PЍfuPTP0 p2P@$U@@T @ @0 @a P 2O-Pp0@0Mw'9PP t`ĐĠ0 R PЍ 0L03/P  0s놁 0 s  @$0S P @f @f`,p@-P`40@0S 0 p@(@-0MQ!p0`L0 3/P< 0t@T 4/@0 p0us 0ps 0@q$0S @\f$0 @WfT `@Qf @Mf@zk0S0C@ ,$@ O(Ѝ,  *0S/p@-P@I 0000p@O-p@P|M Y0P,0+`,P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p`h`P 1,0000U/0 0L1<00 00RpP ,0<<0@D*@0S P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0 դ @-Z P 0P 0Pp PQ` QT{PQH "P <080P/,/(// dw"[p@-8@Q0@P@DPp -Pp%8p@-P@P  ee 2e00pp @-  p%L@- z p%XG-@PzMP N/ w 1S FoP j?$0`J?@pp̠( <`:p$p ` XC D$0-Y 4 ⲿP 3S4 c ~v zv0000? `܀0!Px Ru'R 0z76`z?0`N C(Q0BFo Q? C0P P 0P  ,4101PŸF "`fi2P  @000@A0"4E0N?P0(S  0C Q 0 z?0 C,4101P刀 "0!`9J` uIR u000`011!10100%F! $ X48ap1P,a( s1S%4 ∐0! 0A 0z ,001 "P `H0  ,001P "`40\ n  *6D}U,3Qb4"&'`Q@-PM`p PP 0rbp @P  xPP 0ebp Pb@PQ 7/PЍR 0  @-0 0P Ѝ @-0 0PЍ \O-aM,MQ 0`aݍ,Ѝ@PP oqPK pjqP0 QpL4PpUu80$P 00S 3/p0$Qrbb>0Eo`YG_FPE+"b+bb3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3   ]b b0 0y`PxqxxU" b +`P  P|^P"+"6bb+ "`P }pP# xpP spP npP ipP dpP VxT b  b` (pyP +V 8,(, E*H 00A-p$[?p@` PAP0 @ p> C 0 1/@P00pЍpP@00003/003/$AO-PUMM.\h,@4Ps.zsQ`x(E1h =T`V`(0$S^ 0(0(UݍЍT   70.07 00P00@P#Ppύ\40z(Y^ 4S = 7h400C27\4=1 V =6h400C26\4=1 0 00  000000pp`d , \044040s -1yv0 00 00000 0zp` 0440_40s -1ଔV3 `v00. `lE "a\5@0[^ =2XL=1pP0Nόgph \  v00$? 000,0(0S00Ӧ?$N?@/&#`<\T,0(04@S0S N?/$$04pW$4 0}10  A ` "` `4!0p 1$,01(,L!!H48> C6$1^(1)041 $,!0 (q,! 48qHL1$Q pz \w^u 2Ÿ@p"0Ÿ$1H0!$+ 4x2P p>ؠC\ ?$10!0$10 0: |0G80 ,! *6$H,@JS  GPq<PM ;KSI 0.$10B04!8C0(1}1S0}1$1S `4@@,- &h YW*%`,,(,zX,4",v4V^PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0 k  /P s Pp ,}*'0$0 Q|$(pP d4\,H ܍Ѝp 84>`0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕 \ 0 , tSn "Se S P0~  R{ <ptWv  &P d0S P"8H8 M8Rd0S $"8\0S  "8`0S !8zX0S! S! 80#L0@ \Q\0S ` R !8~x8 lQlh`Q`\TQTPHQHX @1R<0Q0}P00P0)0YP0 U @& 'pPv 0Q  c, e +V :  E5Y΄Lek ~v,O-UM0M*a8V"e&B'@o& pepV pW f&0 T0T AQ ,廟ލЍ9 )qWd ^P FP\' YP # @P @p`H吴 XB\T0SYd \ T 0S 0$< 0P00,0P FaP14s10#5:# )&'&%&0S  && o-8d kP0@DPd@  pg `V  L `p80  P 00 ,0ST0 S00 P0p800SS 04  0x; 8:/P00400ST0(pp S S x Sc  SV 0 <0MkP<0PL!@  PP ,0$  40|( P2 } 01PT $kP 0045S0+4^\14  u 0R0s  jG%԰ 0Ȱ 0,,v47S4", l ]    ) 0gͩ +V D    =vO-@AMT MXp P`L b@P`T $WP```PP@Aލ Ѝԃ̓C̳ @3 (4@$80DP@<@T@X &P \430$3 00 2 $02(408@Y P i딢娂  t20[8@d2@DDAT P2P"PPl#P <2 8%PI,2 $ *20)ATp !0 xP&!,%0 Z@0S k#P 0St H0@4 000@0x;8 8/P6  %P !^%@P 0  p @$$0 L@pW:p@ @ 9 H  4&w Z l r   ,m  T ,v,* :4"a0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PB,3,5 $0@-@"!Q(@,3@-$@2S 02,3O- @P@B/`P@   }PP@ _@p0Ec#రPU*p ЍI  5P  5P @BI    R0S Ip&@-@00 YP Q P 0[Ѝ иC-`PJMM⼂```p 8hl@4PT_H)PeP8_ Yo`GFWI hP 0 000!00P < 8<1P#<@XNo<0S0 0< 8 `PV 40,0F= 01@01A0000 h@@@@,z@0S7 0S(8JݍЍATP0 8`$!QQ@0RT<0P 0 003/@#S0 S(0S 0S8(0S003/@#S@,( T % 0S/p@-@P`!a(0S  R 0Q003/@Qp@X@-Pp@`4M0S4Ѝ0 0L03/P 0 0@P`180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> o  0@o/b0 !!/,910/gp@-@4P0 `_Y1111p,9O-P@p`ԐԠ԰0/ C !  !0  P k00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ,9  8  t0@-P@M/.j1, 00 0d0@00 0T0@@@@1 0 000@EP,#ߍ0 p,9O-P`@p4M 0Sp)P pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  X0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- 0R 0  DQHa@1QRpB   !LAPAPH0 \AF0Q     TTAU @@,9x 6O-`BpX1MSL2X\1S,2j\X1S \QUЍ0C`1`1S]`']1PS \1 XX1! 0`1V$ 1x C H0C 0aP 0 S 0.S  WFp `Z!XP cZ0X`0 0XX"i\P \!i000: SX1x 2 \1` 0 0 X1 ` SX10 2 $ eW,9% ,: ', +Vp@-MMPjdPoۍЍpP@`+W P*+p[W P*+UW P*P⏺Pڄ +Vp@-M&@(HI`P5 g<0 0bH\ P (I5(I gm] <)@P 7ލp_ ?a, `  @-X@01SP@0S01S0  ,9  O-p@MsP! c0   0`崢Y p` 0 0GP0SߍP X%]P0P0 a0CS0S  %PU`08Sڠ0S) R& S^0  0 a00 p 0h1劅00 0s0Z+ @Dp P` 00P!h!R( 00@(O d 00O0 0S* ?0!C h 0: 050t00 00S 0vUa0 4" w : @dAde,; ,9 C-L1 @1 R0   A h9'Q   R 0<1LPDTPapHZLP ZU `1DP1 ZU `1TP1 ZUP1 `1ZUp!00, p@ ЍC c i,9 4" 6@-M@ P @oЍ@-| 0S lP \0 T0T 0PP0L004 80<( Ѝ Ѝ, ,`,z\ ,8 ,y9,|@-p@Mp)t90 0 0T00.00 0UTt9$ p0#:! Ѝ,9 p@-L6@0P e=p@ -?@-P @ 宅 R , 0$@HЍ0@ Ѝ/  @-0  0o P L0L L@ 0< <@ }0 $@Ѝ,8 )D,x: ,8,|-3M M T@P0  44cP .co3ݍ Ѝ +Vvi-3M M ?P3ݍ Ѝ +V00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD@00( (0P,,,d ,`,w;,z\ # ,8,y9,|@-0  0 P <08 0440000 0 Ѝ,z\ %,8,w;,y9,|0$ 0!S/ /,:0$ 0 S/ /,: 0( 0S0 10 1/,:,911<0@ Q !@-0 " !/,90 10 1/,9@-M/.f, 0l0d 060 P000@ 0@,eߍ% p,90D D /Q/QQ Q/,9%@-@0@ 0 0@XPЍ ,@- @0S00,` @0@-pAMjhPN @S  P<04Px9娳/X0Aߍ0 W,9 S f,@-P@ 0P  Ѝ,-@-   Ѝ Ѝ/-@-\0X0@P D  x#Ѝ@Ѝ/ o |-@-\0X0@P D  Y#Ѝ@Ѝ/    o@-4P P P   @-@^XP@ ~-on@-4@uaP 0 P Ǩ,z\,y9,@-4@aaP 0 P Ǩ,8,|,QA-@@1@#PP1P#Ttpt` >_P t u`c>`>66:YA7Y- ,7@-@*)P @ f0  Ѝ0 &&  0@-EMs`P@ R WP0000U ($$0x:@:Eߍ0,f,9@-pM7hA RWH1^  P0x ,! )He< 0P H ` p 0000`0 0PP`P +eߍpb02 ex:X JNP (iR((J M,9,  ( b P%  W@-@P !0`Rxzu`P PP xZP`h 1  T ])01I@0Pw@T 6^X Ѝ,9A%@-@<2 0@- 0H Ѝ0@- 0> Ѝ@-0@M00  0(Ѝp@-P<@0/SpQ  `Pp@%@- 0P,<,z8O-$M@<p`P 0 P( 0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ$Ѝ |4",v0 , ,`,x: vO--,M`zV$MV@op[pPd $@VP@bcT00S@ YVPPEUM P1P!PP b$00  @$0VSS00Y00S ;V 0 C H C$ V0 0$0  0 $ VRR   Q # 2R @D -c0@QV `P$ U@,Ѝ  A-`pPB@P!c gPP 6/iAfpO-@ M$U`P Ѝp0P 0`ZVPPTP$U-@- 00Ѝ Ѝ/ l-@- 00Ѝ Ѝ/ A-pp3`PMMP` psp@uD FpV '(($$cp&  0Su 0CS2PJS0)  0 0S8 0S r0S 0S QN@|}P$ 0 \,0 L@nD2P 00b0C?o270 㧏0\(Gb0SލЍ!7SC^P1Q! F?p@F{od!H1Ph0 D 0L$%' + 0S q0Sv 0Sr 0So QN@S P  00 @PYF? Q. QlF2Hmo 6 E a T,n l ,,d   ,0%c4" k,,v<  -MM P  P  ۍЍ -MM P  P  ۍЍ  s@-eP' PaP l%P0S 3\ 2 2 3P @D`GP J@TTOЍp 0 %x0|+R/ @-d|+\0XT0PL0HD0@<08~40,9 @, H, R,, l,v,P@-@ MH @0DU,p@-@M L(@H@`0 #,0H ,0@@0M@h@Pp0: S H P N N܍p,` 8`Q @P@Pڰa <T@@O8 1!y_|8 <=DQi T1 08808PP oQ P00S nw < R t00 00000 00l0p@ m(t(0S!,z\SB,8,y9,|,E \ '  ,,`,E0 O- 0CMSP3q ` @g0!`/0`SPW!000 @ @3/@P CߍW! 000Z 0S X 0 @T W  00 0  0S l00S \  P0W0 ! !  000,8,x:v, m * , ,97@-PQ@0 SS 8;0 000] Ѝ02S     +VO-(UMp !4Q T f_#ß0/SCP3c0ЃC0P/UE<# 0SPIW|C1 dp` PLP$ 0RP EP T=^ 0 10S 0S6 0 1S20S lP`F $l2loC1ZSP!0 a4%0 0J 0R RP 10 1000`zRP 1R QA  1S Q00R /RSR UߍP 1 0000$0000 Q1 PP 1 :T1 0P  , ,%,9  +V     _- - ,8   8+ q   %p@-Ph`@TU^pUP`CP  up%*O-`MMp`` `T |PP0P  V,@ڍЍ |P |P .P97PP .Px@P8#D @ {0 Q & P0=S`  : PV P P  +ꈠlP@ PP0@PN L~ o*2 q  3Q/10p@-4 P@]0 Pp@@-G-`P4 m]@T$ `V! p0F&04 p0RSP pPp Pp40Su p ]Pp@T/0 R/@-p`0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ P]P  p@D@-@ (@A-P@p`p0S 0pp RA05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-8pЍP.@,` <p :Ḵ.p 1᯴ +ᩴ 0`ᡴV幾 啴t@ lP\婾P L奾P Y@倴T  *6D}U4" b p@-PMM`; p  @p ]Pu~]PۍЍpmA-@P %\pP` P  0QPd| @dz@-PM Mp;P ` p  @0PQP1U7]Pۍ Ѝ Ade! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP\00/00/40@-\80S0 S0010\80S  0\\@!SR0(SS QU S!0$0S\  0 1Sp@- l@$\ 0P!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X  40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 Br Rt01 408 00803/P,000403/,, H0 , 4 T 8 X  000/O-0@p 4MWPPp`104ЍO$0 L03/P# Ѐ0 \ p!ФZ ["H* 0*P T P , [p Z8``pp 0SQ0P 004Ѝ0,,O-P@4`崁崑崡 Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P p  0!"0 0  `0RPH P00P0 < Q Q  Q R Z _x H Hl \$ H H (O-0c(0M<00PSp@p`00 $ 80s!3 0Uh0@l0lS@3` 0L@  <3rR0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00D0@00t2 p 00THL 0T  (, 00  0TQ23U 40p0P<0SOP0 L T00SH0S000q p0 j0 0 000000  T0 u0 00000PX 00808/L0 PpQXQ Q(00,0p 0#O ^p a X0S l^ 0$0p0 0(00,0  0#4p. = 0,L`, ,Ld 4" C-F`0pSPlM^t3L0SX +L0 S #L0S L0SL0SGL0SHL0SIL0SJK0SK0ShK0SaK0S000$ R(000 "0A W(40S  0$S $SS $S)4 00$0 40S0D( K0SP4 PQQ008Q00S (4Q (4 $lЍCrW2W/ Vl V V UP Qb Q[0 L3 0030GS0 JlЍ\3 00P307S0 0HS(0p`@ -0 +SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@0 8", P0  R>0 H0L0 H0L0 H0L0 H0L0 H0L0 hH0L0  PH0L0@ 8H0L0U lЍC!SH000050PpG0  d 9/ 000(0y0,L`~ Z H _x (,,4"   H Hl H k  k, ]L    & / 6 B J R W \$C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``o0 0pp07/@-M0@ 03/P 0 004000 P003/ލ@-`,MHP E@0 0 0PP@300 RS THP pW SP00P00P0,Ѝ @T@0/W/0  0DH P00P0&0@-$M@D0X  0P 00 00,0PH0Dd$Ѝ0 G-%p(M@PV `\a `T`|P08 ,`SS0 Q "S `P  P !X$U0T$U ` 0 )U0 00 00 0% 0MPP(Ѝ I  `  k IC-40PS,M80S,ЍS S S !S S x@P `p䐟`o`X 0 000 00x 000 0 00 0 0MI`P&r l K| ] JO-P@0p(AMP U  0唂0 `!"300(p1 "(UP 4P C00 P P {C00P0~[@!kx 0` 0 @ABlA0  0x!fCb @0  P!\-X P0  (!RDN`KpkHP@!@3P@dHT -`'UT@D@`0@@< 0 0K-U0 0@`0P $ت.h 00@p `DAߍ #"0P0RPP4",,L` O--p5AM0DpP$mPN @@]`PD X- @D0 ,`4 S00,0ñXT, 0 $0p0pC0@ :x  Q * Bq Bq BQ B` B  0`S 0@ X@@p0 0,(0 @@@@@ p@@0`PUߍ 06'0I pD`∀ H(00*80A-0<0@SH0`4 pNV09N?V090VP:0Ab!r0S/A-@P0\03/0 0    `0V R!  B B" G;10C)Rp0!P! 0 `PPp !@` B"&;000>000$0 01P0100Ax sO-P@OM H(Ra1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,pP5Oߍş[@P LşT0@0C0p0NC2 VH0 0$ 0 RĴ V 80L0TX 3/P10 00H03/ 0T 0000 3/P#%#& 00t80x 3/0lPp BR̍X 0 0t30l3700F00, c@A 01 SH0 V p .4tI` PP00P00X00 3/088q0X 0L03/l 0 , t T x X h H !0T`X 006/P d0 !Q`0 00 !s"D  V p0 B9D!2 B"91ᴡ0C100C0 Q `V`s`V T00 03/P0 0D 2#4`0Z3 $P0a d!0` !p D00C9D!2 B"910C10 0?o2100C0@ !V ,, Z X S MA-Pp`@f!0P  p0Q pb9p P`P !@ B"L9 PT0 01`0(`10q0000᝾" m( 0S/ LP0 05/0P0 8

0=C0D00 ^H$x`U 0S  T0Pk0 000D0P0 F0PT0S xIP 0S00Q00`Q0S 0L0 aA3/P 0̀`0`0 &003/dP`p E 0 g&` @o/HX` X 0 Z0R0 ` <0@ 000R<  0S8Xℾ) a`v0"$0$0,0.u0,0$0'$0倒 Dݾ0 G0 pxԾ 00 G0 8ƾ0 GȐ0  Ἶx0h00l010h Ht0pL+D:+ :L GL0` S*pV 0 T'kU 00 0`Tk0 8TkT0P0'$0, Q030#Q0S $0( A(0b2FTqp0 ` &?00`P3/ ``0``P.VNPZ0G X 0@4`8T(Oލ Ѝ, a f k, qh( {h t@-@! "  0 Q0 "ġ0S "O-Mp P$ @ `|1/0PU0@5@[0Z@0 0F pP 0FPUp TZpP 0 F X00(@400,80(,U00%000004p8P 0` r S00 $g00$DD0\00`04O0d0媿\ H PU P㡿\ ?PQ㛿\ 9UpH 0 XH%j52p/4P0PT0"0h00<040080#0hwX, 0S)  H0Lj0 0<0倀L0 F0LH0P hGPHЍXD0 <HiH0L0 0S! 0S00Q00`Q0S 0L0 aA3/Pu 0PpPU0 p0%PUp@gppL0 Tp P%@\003/%C^0 0 $ PY [c$ S \$0X 0$ 0R 0XH$0 S 0 00(0,0 $00S,0 00(0y00P3/0 PP0PT P0pXQW岾20S00c + EX0Iÿ 0/E0X XS 0$Q 9",h( a f, 0@-@M0@L0 3/P" ! !DP 00!SS@Ѝp@-`MMMP;` @P *J Z8 _MލЍpd{@-@P DsFP 4nFP $iFo +VU p@-0@ 8M! 0`P@@ 0 6P8ЍpGFPUJ0 00  0 6P@oA-P1MMPL 8a0P *1SC$A T )1S ݍЍ Q 0 1/PPP@ 0S0L0 3/P ,0pW0wP 0pxp;H 7/P H}@,,m@- 0P,v4"@-0 /PR ЍP/R0 R/R  j0  ,m@-@@@-@@ v @-@KPQaPp50S  >uJ00 ЍpJpP#0S  =W L" X @P3P  4-ế$ &=,v4, e& @-@ @0 @-@P@@-M@  7  7 <܍ 0@-MP@q  6k  6 '0TsP <ߍ0 @-@R@A-pP;`@P P  H0! 0PP @Ѝ0$D ,mp@-@P4Sp@Tp$ @Pp%Dp,m G-pt`DTP DPP@ 0 0PP$0R04,m A-TP4SAp`4㺽@ 4 0e6 a6 D,mA-@4S0tp4TU TU T`040 EȾ0 4,m p@-@P0 p@*p@-@PO@ ^op    @-o@-o@-o 0P/,m0@-PM  0xPP4 @  0PPP4@岕P,嬕P0Ѝ0@] F S,q@-O@pA-A0J?`V=p$X"0 8PPЍ p> C 0 1/P  0R$LH R>0$0 R 0S P P 0$003/0$a,#0pQ@-4崻㯵 #"T R0//s@-(@T@ЍpH?0P;0 0003/@Pwㇻサ/@-tM`P @P0 p@@"P  20@Tp@tЍT0 @T|0t dl0l p s`P L s<7,8 g +V p ,q y ,v /@-w 7@4 r///@-0@Q T@o?0 \ 0P000@-P4M0 FT0@T [B 0 ! @4Ѝ0NB@0,q//G-pP@`㈐VT0S0S BP$1L0PU+B0 0X #B0 `p@ y,q\R0  /p@-P@DA<0Q"4` 6D0# A@$!:p,,A-<`P@{BPp( L4 A,q@-p@-@M @F0 h哺0S X`P0PP0^V 88 0" $܍pbcz,\  21G-1`PM@PN/1!1|  tatayp @Ph7PrP GL0 [ߍ BvcB?8 pP0=SB8?q@ B?`@P f BɘPp@p P 0 PM:@ G:9 oXRQ ?,v4* T M [1A-1P@+PN/1Xp1T P`P`  P  <x : ,,d,v49 v @-0M02000`00Pp0@P @T 1\ 1T1H 1 1P1 1 ЍǨ Q:; 0@- P ,0C-`CM P@ `DP pܐ܀0 `0`N0S1 1 Cߍ5S   |p pP\ ``X0S  @S1, 1,|\ ,{[;,  - < a ~:Ip@-P@1 1  p,1p@-P`妸@P墸0 p@ p@-P@P 1P1   p 7Up@-P@1Բ1(1 P1 1 p U@-ĸ@ C-@[M,hLDT[BP`᠂rU U.~20P$0 dPZ `"0(@80ZPW @"(PU ( V7 0G(P@M7PKκO?PL0P PN?10PU)!(`pAhP0S7 S1  @C 0` 0P@PX1M7PP [ߍ@`0!YPW0 (ꂺ0P0@)8 B!8 0 0 0F& 000 h ,@ w%T,v4,q,   j9,{[,|\,,  57- - PJ A-P$p2@P a-@T ' !'P( 0 !P  018 P @oЍW\\6s PrO< 0  ,v4  M ]R    Ch//O-0p4`@T Ѝ@T@T' ^% L U[Z [ԡБ YZ PUPE P$P P@B0"/,O-4Mp(t$ \ ZX0,@P @ PR00d``p ͱV0 0=0 0VP @ 0=PU@U0@P!00000 00$ U0 000Q0#02S 4Ѝ; 00 0S  R% S    0@   00@VP00VP @ 0x=PU@U0@P RG RD RA ,( ZQRZ3UU  Z 0S0 0P@V00VP @ 0==PU@U0P@0U00P@U Q Q0   .0@-4MP!!0  P P!P@4Ѝ0@/@-@ +@譸 kp@-P@/3GP `@ H:0P P `Ra BQQ pQQ 0@S:p @-H0RH #@-/0@-P@04MS 1$! PP Q*   P +U 0@S Q 0S4Ѝ0,0p@-@ ^T00PUPU' \$ST |p 2@Q.^U@P@$ @  $  0 00C 0p0 {}p@-,@P?A0P ;pA-@p```P匀0ST 0@P"Rp@P ,q 00S@- /,q,rXC-麋X@(p,P3`$ 0АYĐY T  T: X0WaU|U VP P 0U Ѝ /V0     w |@-@P 0  ?}@z /3  p@-P@0S|T0p 0 Tsp0"S @0<00Rp( T4p0 ,q,,G-lP0`Sp@;S S 2@1+1:X 労p  QBp\T.@T&RQ00 00(Q $,<p Q 0S T v{. 0@1 00 0TRT0T"1,zp@-P@q@op1O-0@Sp`P 0 PQQQS SK0UȰБ r0 $0 ^ 0 "90(Q $;p0, 1QX#  E vQ 0.0  R [ R pR H0H H> R# Ѝ 0W1Q:P ,q  p@-P@P0St!U 0E p(0"PE0U055403 0(2#p,q,,40@-0@SZDP0@0ӕ,q A-AP0`SH!U 0E p0耟@SV Ѝ 4 U(@0A`P `4p00 0@0X?Pp0P dH p_ `00 PZ0'p(0,0`,q,, r U1A-0PSp@` 0 PQQM SE0 ? 2  0 !Rv?0r00  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` ,qD@- @00S T ӲЍ1sO-X0MSM2"=\0@S2"`0Sb2|"d0S2d"|h0Sl2H"hH ,0S@*80S 8( SRM80S 壯, 70pHPASTPPDP @{@`P- @ \00`0d .0xh X hd;S XGH!H@0kP@_oRݍЍ 0:S 000a 1 0 0 0 0C0 };0CS||vPp ]   u    &    ) @ Q    \ t Yp@-\P@0SK 0R;)r00 S0@0 N Dp,O--BM MpX\@@P 0 `^ ;`( UpdBލ Ѝ<0 DPX  Q 0 0d!`ppr0 $0!`4X00 (00Cv$0;S P t奺PT +RQ 0P \P SA0Rpʩ0S S 00S 00 0`S0S 0 ű0000 0 P 0S  `+ 0 R$ ?!"S0S "m Ade O-4&"R p 07`P0+"R 7p0 d00\ `0h0x00Xb `$P`Pl0 (04H000 00 00p; @-`X0Sg0 ;\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S0 06` Ѝ ]  u   O-Ѐ0TM00 0$ 400 ,00P(0 0`800!0 @ @zP$0SSDp@p Q 0U U L0!<01PSPpL7PU<0pDPH PU@p p0S $Pp40S0000p$4P S 0  S PS p0S ;S S 21+1:$0S D$0,  QB\X:X2RQ2ȠP,$0,$0(Q $7p(0 S  0S H (v*80ƀ1 00 0"S 00S " TЍXRX0H"1,zO-P0M@GTЍp`ȠȰ@D0S W0@  0 0 `P1/Y  S      Q R  0@0Q0 0`Pp1/P , A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-$㙯@P`p1S 3/P @`VTd0@@ႯT0P0S@000S4000S(0000Aı ,, !! p@-@4`4P0Sp@贱10S 3/@, ,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp `^$ 4R R0 0`40$ Rp `083/< 0 2 P   ` 000 0S0\000 00//00/00/00/10/Q@-@@ 0A0003/P@$m @l *C-B`0SPEM;0Vw-0pSNo-0 StF g-0S\?`-0S 8Y-0S(1R-0S*K-0S00$ R!000V F 3 9 &>0!C> f`H'0 010@0`4"i,sx, *O-PM0@ 0` P("  `b0  c000 3p!0 003@!00p@ݬ {@|~xxfp+@gά 0 L!HŬ @p0 $!$廬!p 0`P0 R & P&FЍ 0p!嚬0i ` `&OT 0-00@p NR S3#:@`04",,  ,s  ,si A-@0`\03/ pPW@@P@έP< 0쀟DW  \-W0 U  .  ! 0 n/ 0 00$ 1 x    ]/  C\  0SJCT H0H HH70B@@ Hq,s  Ͱ  y ?s@-P,`@屮01Ѝp,sxp@-0(M0P,03/`f0@ S:0 00 0 0 0 Tp` 00A0ᛩz(Ѝp0 h O--PM4,@ 8PЍ pP 0p @r @< 7 PZ0H03/0S`@G`@@00`P p" 0Q!d2A 2]? 00000008"  0$0ƥ30S ("0 L0P 3/P \0T@P`@X0`0 S8徬PZ 80 S ,1 0, S001{40P ≡0L0 3/00 P0O-UM< SD [/080844@`ħP ῧpP Uߍᴧ0P00 P,P3, 040S 0R? <0S5(1SK!L ,LH S!C <H@$+4  0@P P} @T "2B 00P 0S 3/P,00,02, 0SU@`PD`D@t w X2RեO Y8N Υ$˥ ,!L12HPH@"J`P`T@工P U` $@ $,$,00 0040 @4 $   , ) $,  3$40P1: 1 !  _0 @0 000000 0000 00p` DD0U0 Q[T Y 0v `,, 4"o  mn   ?O-/<@JM M`0JPP+NP) 0S% 0l"`!`\r\/J60P T  0CT *0C/Q 00P82@'m+ P:-2?0  hP+0: S `V2>00ꨰ  PJ>0@0/SI 0+  S P+  P*2P 0/S`0oo`bS #p#0&000 SV+t P*+ P*ἺP1@ẹ1@]ᵹJލ Ѝ 0  +V@-M @P(0  ㊹@P  P Ѝ蒹P0p@o O-M` S#PPp X`p㴠崰I(P Ѝ0S @ ~P0  NpLՠP Xp0  @EȦ   @-))G-|M `P`P PP<+q@P@ 0 @ JYO@P\+JUJ.0M+JFJ.0TT>X ެPP~D54 լPPu$J+J&0J.ŬPPe:+J J8` ᮬPPN#+Jtpll40 0J>wP 0 .⏬P UT kލ˹P@Y+JwJʹPPp0J.j@+c _P h lJ>XPR      &  O | [ n {  %H *  0 9 C/00/00/00/00/0@-@0!$Q4M0 )P\ P0T0670 P @P እ4Ѝ0,h(,,tO-AAd2M(0!0PB(0 0000= 80s#0(0p`\05 0)%500%`⯾0$0 0$0S000a5`` @@`@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ `0d P[ T0 SW`vp 0 ` L$`R0$00  0 0 0#@4P00 0`0000 0帢$0Sr DN 3D0Sa @Z%S[eQ*%0C?o2 00;0, 0H03/$0pS`, LH0I #"0V 0  (Y 00;000P0 pX00 00 (00 P0 0 0S { (0 7DP0v1$ 0;$1 ,1X2@t&L"@(@@,0S:((0"P@P  00+0@080s=0 0( T 凣W|Ѝ#נ!@&(Ҽ00T1 0'X!00 1.:0 05Ѝ0!0P8q0 S+P ,P > $T, ( |,tA-@  "(0M+( 0PdQ1\2 5  D! n/ 4!@`, 1 0 $!8 0$P p"PUp 0S0p\(pP,P(FA9(00FC0Ѝ0`0 PCp0 L03/P 0 0 0Pp 0  UPp0 (  (O-p@`700Y)Z]p "!]PV p 0  0 P0v+Q 0S  008,04p $0T0 0X05p0  P,[.[ P Q  0'P0 8q84p T$Q[00 0  Q QPPZ 00 00 ЍO-`2M04p@$夾P `ᗠPP 0 Sx 22@|]? 01Ax00 00s@lQl徜ᝡx0SR(ᷠPPK p(P01ᑪ!P嬠0P@ x 0`(R b ",0/x  B( * * 0 8Ph l"040x0?o21000Ѝ0ҾϾ, $O-p@ᤁ夑夡,M0 S0 0000 /00џ0S,Ѝ/S  /00`pPU0(4`P p呈!-PP PP%0(` 1`E* A*0 `400,08`a0100, &P 0 02 P4Ӡ`,V{O-P`@\M4 ‐儰*!SPV 0 [ 0S  $pmP09\ЍO*.**y Q:0p R  ,pWTp W 00 8 S0p0000Y%(0Sp p 0 RH03/p`0[   80s @P000  BR0S0Sp 0[p08 r  * * W0#0W  [p R 0S 0c$p 0 p 10 p$P"PU0p[ 0W[gp0 PUp[b0[* !Q&:p0 0 0 00$0 0$00S 0X 0$XZ 0 P 0 pZ $00 S%0 0S 0#0   2 Q(S  0UPpZ 01Z0( Z#QQp 0S S  0 S 0 000 00000000 \Ѝp0 0 ,4PP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 , 0R0S00pR  $Pp $P 0 Q ppT R T  R X p( 0Sz0L0( 3/P <00S D0SS000(( b L0( 3/P 80<00S "S400 [0 0 p( cA0P\0f0[ W0~" p$PPUp 080sp0 :  0 W 0c[p呀!!QQ 80s  00UPpp 0 Q 0S  0 "p 0   ,, h,,! +V O--`M,p#@PVY ppPT Pp0Z:`PU`J6ERUA |6|&||Z&00#h R 0  80s0`F`pHU p 'h0S 00  80spHY pPp 'h0l0 0L03/, 00Y:pPpp0媜0P80`5ЍO60H03/,0$, ($08RPp0P(p$P<00XN:< R0*p,0$ `$0 0S`0S<  `S p $ PR( P`( $0!PU`P!S_S Y0S 0`p8P0VR:40S00000040,0(Xq싟8`0[:pp8`Vp0< p 00<<( 8`q ,0,( 0L03/0 000 0V`V0$0( 0S ` ( $0!`V`P p0r   008,0,p(p<0yS 0| 1/0 0Q  RS 0 ሰ 08;/`0P0H03/pt0D08P 0@00Z}*p0 0 `<080s`00] <0 0RW04 pD R@ 000 H3/PB $ <0 %Q 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/008 000` `0W `0  0V400000P m !] ,, 0 4 0Q0 0p0 P80s00  h0S~ l Yz* 0L03/Pm !0 儐X09/Pc 雟00040$0(00$0 00 0S(  0H3/P, X$ 0 03/p7  0L03/ 0pP$0( 0S pP( $0a 0W40000 00040(0(00$0 00c<#$‚0  0 00 H3/P0`q 0R04($ R ( 000 H3/P* $ %Q 0 0X 0T80,3/00T00X S \ $ ` ( d , ,0S~ P0 P  R0P0v 00040(0(00$0 00c<#$‚0  0 00 H3/PP80sc 00` Q [ 0 SX 0 SL0  3/P @0D RP0 RP0{0 80X T,3/00T00X0 0\0 $0`0(0d0,00S` 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQ@Pp`,0 0U?:8p" 0S p ! Q\p™`P p0Pi"0R[p Z[ Yl:PpW00 U0#S~ ٚp`Ѝ茀 8/ #"08,00,L0 3/P 00p开8S  8y\  WX08P@DH0P00 00 80sp8Hp0!8p 40X 00 0S 0P*p ` $80s0 L0 3/P 08400H0, 00,0+$0T00X0pPq 00 80sh p #Php@-@P(M(0S(`,`}0 00P0F0 P P`0(PP,( (P(Ѝp000ȑ,5(0,`(P- $`R,tO-|X`M)1$qS W W (!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1S<1@1> x.؀BCPp C( ,H3"0@ 78 7 0 W &%, 080000, 0 L00ݖ80000  0'FP40͖0HɖLH0P (P0"W0 000p8500 %  % %P,  (P 0 %<  ]? 000000 000 0f00pp ,5P,0ՐBXpW* 0GSC0.(>P C$ 00S H @3/Wv@DpH L0] ZYX03/ 0& 05@ 0L0 3/P 00S 0SpW+ WP0pH03/0 ! P7/P%$%$)@0 Q1LYK@1003/Q  01/ 0S 2" $Є  0 <P 0 ? Hp0  @D@0 ᄀX80X> Pmn,0S pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,p\ 0,QQTQ D@ pP Q Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 0008,,4"4p80 , nH +V !( 0 @-@P`#}4Mp@0S $ 0dL03/P #` 0 #8PUV`4Ѝ 0R00S0 //O-Yp@P` 0< # 80s#   002   0 S R( 0S%   吁( R Q0 2 T 0 < {+800 s"000S   p 1 SR0r01/,u!0 /,u$1p@-S@ x1SP $003/p@/x1,P$1 0SO-@0`PKMM0((0DpH0S >I @W 0 0<0o- %#{ 娻 KP@T8p]? 00 0 0U0000@00 @@@@0,⹑ppK܍Ѝ(⑎(0S*< o #8 ;c&@@ O-`0@PMM,0d1d0p 0S (0 S> 9 H  00 0 <0.%#@~40kP`0V,p]? 0000000 0 0U000000 00bp`ލЍ,:᧑,0S*< #, 00A"X R00C0C0000S0 0,0A$P,u @-@-0 !<$10(10,1P001.@-@0 0! 0O-,MTTpPP`0 R嘾,Ѝ "P9 @@5/P`K h` V`G2 ^ 0" ( 00 0ѐ`ᯍ0,ЍO/@Z:p@-@Q-;;$;<;`;x;P; 0 P440 P. <0`p@,PP%80 P<,0 P(00 p& ' )*+p@-PBMH`@ &  V<4 P 0P Bߍp`ܒP00S֒0`ђ40P`˒80PS<80  ,X0S(!⼮@巒 0P寒\0 `0S ⦮@ `垒d0Ph0S ▮@l0S ⌮@xp0S@ ₮@T`zt0P] %9 /:;]=> ; E?2ABC@-PAMH`@`   V(>? ?H?p?0D`qK0 @0S  ;   7 8`V@= 0 P5 04Aߍ(0S p )#@,0S H @@00S ( @ ]  . %/21 E20@-AMP@0Q*@,@A8A\AtAAAAԸ     q0`N 0S (0S    ,`V HAߍϑ    q0`N 0S (0S    ,`VP寑 $0P妑 0 P堑0 P㚑0 P\唑0 PH厑0 P4刑 0    * I   60S O-@MV M>Po 00x R# S `^嬵嬅adDp80  @Q D0 Pj  ePD  H/   ) `V8p00(0S%*$B 00,0S$$B 0000S$$B 0+ 0 p0B/#Ppὠ C"U0S1 `F` &댣0p⇞ 0S    `,pYV o$ 8 0` ⢷0`0"  #ទߍ@ 0  0S   `pV ܎ 0  1 PS0N  Lʎ0   0S @0S@廎 ߍG<0040!00⮪@0Fo$ 0DL03/00 Gppqr0S !0┪LD` 0S { wp8` V0 a xQ0W < 8 RFO e 0@ /.@Y 0  f 0R0Wp 0K   4 E G   P%* V dw l- @-x @ ; @0p02d @! v@-D @000(0,0000d @  p@-XQ`0@sJM]/   0e1S:PtPPQ$Q0Q<8Jߍp0 00@ @@0"_(@0 (̩0 0(0000 0(>P(>0P,@(P0@00%|32560p@-QPM,0$0`s@]/   0($1 SIRR(R4RPR`RRRRR 1$ чPЍp 0 ,ȇ,0S$0pP@0 0c0 000000 0妎0?>P0;>LP@!^@8P@0P @00%|,u2O-P`0I1P/S \(;0(0 00Aa0SvU (n k0S `Pp~ ]  1!5:% 0p PP p Q 0, ($!p p $ <P] 00 8a4Q101S/,,<,( 4"  +V n z 0S@0@-S@00 0S/,@0O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X أ@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 岏pPP2@0S- $P* 0 x0D 0d,|T ;OH3@-P@ML d`P<2P0S%  (hP2 00 BP P< "0 4 P 0! ЍH0S10S-  >PP'a000C R  R41"$0  000xpP0` 87/0P0 00 !`0٠] U00S-   P'000AC, ^ ^ 0!P^ X^ ,0SP\ $0⩠ ">S,, ,E,<,l,x A-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 ,,,,x,,\0p@-T00P SDPPp0AS@  1SAD,zX,,(0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^ @^ T 0S",p0\ Q0/\ P@ ^U Q0000@-,0O-`GMM40X2@T]? 00 0 0V000000@@@@ 0hӀp@c<  D G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 t0@W 47 `4K}Ḁ4 VH0 <0G, ,,L,( ,u0@-PDM@T P08 @\ 0@  Dd  0 0DЍ00S,u0@-@DMP/ P0, P\ 0P  0T   R X  0S0000000 0DЍ000S,up@-@Q`P@M<̂@P   T0 0SP@Ѝp@ 0 @00 D0~U@Ѝp,u17@-@SW~~p Ѝ0!|P4P P<<0 P0<0y P0<0s P0<04Pk P<0 S, 0<0` P<0 S@  0"b|080#\|0,0$V|00000zzzz@-@PD  x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍpzXzz@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 0 $<   <Uٺ ᄰ0$巼P 0|! ㊬|Ѝ0,@-80@SP`4Mc00 0rP 003/00$1U Ut  4ЍS0 000 0xp 7/( (0n  wk & 0p@-PQ0M0@$ 0x`0 6/8 O`Px1σx1a1S0C€10Ѝp 0p@-@P 0ZP  4Pp0S@}p GP !Pp0S 4! B! 2P   Pp0S h"P R 0L  4Ppp BE Rl bF p O-uM Mp, Z- H0cS_ C匫0SSzB0S PBԒ0SzIJB0Sz2 P     P x2@    PP2 HD     PY 0x0001 @@K @P @ PHPP< ,> h@ ,D@+1K 01R010|100P Pd0}p@  P#z} 0S10$1S10 0Suݍ ЍㅁPaH~PkwPj1S |!R |SP  %|,u,,x,,<,,,,,\, ,@,,|5Id5d,,(_@-@ᰪ00S @P, @-@PЍp$QU0 [`P PP> C 0 1/P ,0 0L$H R>,80S @-0 x /C! m G-`@Pጐ匠X0r2 S80S00 00S80S0|1 P S$1S00 0UOp@-8M`@8  M T P $QJ$00S U 0 |1 08ЍpcP P P Q ᜭ  P ٭ ! ᠭP ,uA-M|P8  U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 p` XEH2 08 8/PD?0 !! `b7#Hp0  3/P"#"#00 03/p p0` L03/ᮾG ჺ⦭` 0SWp`?`B414!44 0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 0 `04dRP  v00`p 0Sv U 0 |1 0?!<C!  ,uG-`RM@Xr sPP <$P`, `RP P8  p f 0S zߍ<08 0(0`0,0 000040!04 04$0D0(0P #bWQ  h嘔pK H咔p  <8-l` 0   S JS FS BS >S   Ep 4`?`a8SځPb 0  00*0P0 Ĵ 0 *0 K}@dAdeK@dzLLKKKKKA-PCMMPp`;8 .p@P  P0>PỒU 02 " CލЍ /O-T  0 _Y Y 0 0<S, S 0Xpp ͱ @PS ( P#2Q<ЍR <00$Q*P$X( Q   T0pTp 0pW W0 0Q4<0p8 P 0,4 W\,Z7 SS  Z" 0 S 000 TpTp 0pW W00 S 0 S\p\࠱ ؀0@-4MP!!0  P PP@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-` U! b #p@-`P Q@@d`Q8M2"€ 0)r000% 0S 0L0 3/P 0  ** +"+s  S   "S2006 8Ѝp,p@-@^P8Q @ 2"p282w@-04Md 90 Pil@P0 00l0 S` 0!0Q "<0?020 2l00 2嶚P 02020200A4Ѝ \! ~ #! >p@-tP@0S0S 0DHSTPSD  p# @0p,v,08S^*/,,¨ p@-@ 0(  P0R0PS 00Szj ppC-@`PNMM< ЀuS0 ` P `P[000 ;@PD ܀pvNލЍq b JdyG-xM` @pᜐ壠LP! |!0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0L0H 3/P H L0RPP T 0$RP0 0   x@ 04/@xЍY Y ZL   YZ( ( υT m! x # : }O-`p@BMMP/0;@ E0P0p@ X h4   d P'  ~y BލЍ iP 0 0  fd0/SX %l0H, l!14"?s0So[ 1 SR 1S  RS1S1Sr`2pB@?↟0Q 50YTm "0Si[@jpPc P 0 8< 4V , ( $ 0 (,$E , ( $  QR@ Q  A R !Q Q Q  "r    0  ĥc寥00 " "Mo@ U01U01<31UXRA-00MH`LPp p1p!ppP-j@P( T0000 S` 0!?020 2002p04 p8kP0Ѝ 0PS"$ 0Q00 L03/P Q P0Q    R D0QR003/ \!  #>,P/A-2u_Svwo10000B“TBpLҁ B D',pA- @P^U PP0 8^ @T *hP ` ` `b` ` ppS` 2 q!aPaa j00`U08fRfP08}/ ^Q 0Sp`82S011111111108 p2aq40S0St  P P2S222*040UP 2SX O-bM M 00 QP $00/;,P`bލ Ѝ$ ~p y?`00@ s2,(00S 2S 1SP2P"PPO0@?0 Ẁᾠ  '      @Tp!? 0 Dᣫ 0JeD U G @($bP_bV k|i ( d (P T&RQ 0 0 xp$ s W p!p'q ?p? @dp ` W p!p'q??p0Qg@P   a?WU E ,((  ai?W U `@dC!  #Us@-RU0 @`d0T `Š#+ Q H `04 oЍp !  # @-@ T  ^@ @Pp` ^PPVPU Sx   D L"<0"8 0"4 0$< 0$8 0$400 0<<@0,,,O-P@dM0p400 5Q 0 }Q Xg QP08B^  RW* 40'D0Q   R0RS 0}υ^ @^TX 0SQQY WvpdЍb400@F@  0 @TT0 @04@P SD 0`P P\ X 0`VBT`@00T04R21 SR8080<0 0Q80$02ơ 02< 02S01  (, ,(0 PH W2r`!R   R 2S SX 2Ƒ1 0 Y   ZW1Kt "QR 0S1!a02#38P0WZ veV,0$ S <02o(0 0804pPC @0 Ă2Z02HY PY g ɝL0S 1P0S`10T08<  01Z o 0;  RP   0SD0X X2 P H,  (C! T #8! lO-@|M40H0X0(S S|ЍS S5 p( [\8\(\\D S0@ }(0$00,,QT@ R (R$  Q000S 0[SX v?70QP241(0$0(00) 0P00U00( 00 0$000 0 U00040 04 800,00 0, S0 08BX6u?v? ( $R BT@200q? r?`h0 s?` 080S000T0S,0S0v < epP< =X50E\0o_P0"H``V PV fᢜ0( 8 @0o/O @0S U SQ0.  R0 000?01o?0R㴲<0$ 0 ,0S00AQ0P0T00TX2{" S0 ` 0  @D @0D`7PpD0S0 00[S@PHpLP 0K0000 0A0Q S 0$L PH0`U PU0P0TP04"o0H{`PU a<PU eᗛ<@B3C H41P,02S 02#38T0 Ro_PkPU e1oώS U 0\ ` \V U 0S^w?0 8, R X00, o!  # ,,U8A-`M{@XpP08 P34`0 P(0 0 !!0"0 "U 0 0 =P" "#"#(1 0D00 P 00S&!003/00S(4`0 |PX`ЍX0 0  #1/P0(@#S 0P 0"P25/0 # @1/0,֔ s@-@P04P00 o0S  `VRUp Uw0P 003/P8odUdЍp@d ! k #@-@0MP M 003/00; ⒜pP pic`P  vdwۍ ЍO-p0\M0SR `H@b@Q P0} P0Bc0@>S@ P0} P01c0@SP0 0LH S  0/ 0//Z[d0Q @10`d! ἐ 09/0P@\Ѝ2,G-` p0P@LHR0418 S ^ ?Y R  `0 dX0?Qࠡ࠱000^ 0 G/,>0@-@0M 410810!ra0 P0T0T wa0 I0PU ! 5/HЍ0, @- Hw@ 7v@--@7 0  &~{4" z&@-<@0siv(00pp?]0Co%,-$M ?0 0 v$Ѝ0-4M 00 000P4ЍO--pKMDT$w " wh4`p p!`V0 R`V$ 0R 0*`ğ $pS0S 0s 0SKߍ0S P (^30SP #)|P|#[ 07 M{@0 (@{{:?dSd( 0#ea| 3P 2R - BP  v BRڛ 2図"B "( e"2B|P  0Ÿ R#3SPfS0\10(0eL")| PQ 0 0SZQ=9 =:pk{X1@Q08@{P!5 Q; %#3\P/  d! !(0eP!{$1@Q0& d( [P Q * 4"%+0!V5 {@0S(0d {@0 0(ppt@YA.,,,, G,*,*",Q4"! *)*3*@*U*b,,~@)*o  0 Q ƨ0@ @k{H{7{j`0V0P  m{P@<(0`<pe0 X{@  R{@-@v@SRG-@  v700pP ąP:<`X:00X 0%{P 0 @-P@`pP0S -S :S S  000`  0 90P0 ЍU0S T  x\P&p@-@Ptp  `s@ tU700@pp@-P 4`sp@  sPs@p@-M@ +up$ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝ +Vp@-P@@tpPppA-@Pp p` j 90W0 |0WxX Uh0X`0 P  0h0H 2zЍU0 P 0 FF4"' ! ! ! 0@-`0tM0F?oP2p @1put Htp1skt@~sp h2S/tp L0V#4 -  tЍ|th"_spp@-@0  s0 S " 0PUPUp@k`0S   0 0S ``^`0S   0 0S R`P`A-p@PMU `0S@PE7  ~0P00(ۍX700S @ Q@BPE@C0 00 pL0S 0#S @UX !  ! " "@-M@ H brp8lۍP  ! %p@-\1@0S`M @@@P`Lp @ p0 p`` P09p @ 40 pЍp0! r "P p@-@PqP  bq01pP`qpI Oq0#1pp@-pM0 p @0 4qp3q@pЍG-QM4700ۍ   Y ' @`V p@pP`@-`R00 Ѝ@PTp ?]@P  Q*@ 0S0S0 S   0 0S0 S*y]P ` Q^O^0ST   00000`0 @@P0   @-@@ ! G-`P0H0$:@0 D  10 D&00 0 sD00"4S4 0>0S0&0 sPp0P W  g0080P040L1p@-S@T1S#d1S.RU9lRUppbV:l]lbp1C]L10CL1L1PSʽ]0P11C]T10CT1T1XSʯ]0X11C]d10Cd1d1hSʡ]0h12,P0C2bV]bp2,P0Cp27@-@0 PP! H10 D1Q8-0@@ CB Ѝ0@y Ѝ0Q@-@  G  boP p 00`/ Ѝ@ Q @ 00 pЍ@ Ѝ "*!  "PQ@-@    oP p 00 Ѝ@q 1S70| ]ZP| 01@ 40pЍ@ Ѝ "*!  "P@-p0M0@M0$f+p Ѝ  ! "d0<1/@-@d(L0S  P 0800H0S S@ ' " "=@-p!@RM Qt0 pl Ѝp1S "0@-800@@@G P@-@p t10cSt14s Ѝ@ @d 0 Ѝ " hQ7@-@  ,,\ _ Bnp G Pn Ѝ0@ P 11P,|1@ R  |a'^AQP |`00CS`0 X@w@ T0p 0< Ѝ0@ X0 X Ѝ0 "*! &&h "Pp@-PDnp44p@ @]op p@nu "p@-P@ ` 08 l, 7>U\)' 0 0 008 , <1pp@8 "z "p@-`81P:81x1S0p0@Tp 0S    0@-@T 0S  @@- @T08 0 0 HP 40 *HP%p@-8A R>  **X  0S 3@0 S   000x1  @  0SP P0 0 S   0 %5 %L! %U %k0C-MM000@"0jp%00+P؁+ iP`pQv07S 0 S W h0 0\!`1 `Px1 (ލЍ Pp P  R쀟쐟PU Vxx  x 0 S   x0  pP 0 Px1p  P  0S 0 r0 P! % % %.X-8Q@-@  \\+p?07S@Y80 S 40VS@ "*! A-`R@p@M PP U70l0h @ЍAm"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *P 0S( <0 *j  <0` | 0S 0d  r 0S>0 P 0SV>P  *@ЍA!  & &2 %O-p@`,$MPP   P 00A $ЍOPy P000 pvp XSP  d   _0pG 0pG0 ZppIU3#pp pp ~Vp#3s <11<100x1Z* gPx1C <11<1kP NP  6Pp4PpUPpP xP nP p 0S 00 $P  YY \ p 000 0SZ<11<1$Ѝ P  YY : p 00`` 00T0 :0G [W 0 b00x1 Z R& ` @P `[` @H0` 00 0 W W W 0S 0`0 C7 0S [ x<x0P 0S I[{T0 xr &O &Y &` &p & && $!$ &zp@-@>Pp 2R0P0N(0000> *J> 0Cpǒp@-p1PSM"`! %@P T 0p1!V T )0S X\{:RP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   0 @ lP 0  @  B.(0h%p ,*l1S ., .@*!X .Z .} . . 0 R/ 1/, /A-@P 1 !  WXSpR0 qP 0`0S000S \ \QP0 S   00S000@00P10 paU0 .!aG . /"0P@-p0p pp q ^00P RS0 U   .!q .p@-T`P\@0^0S\*\@\0 0SZ0 5Qk9 <R0p@-`pM@P*g (0l``FSЍ R*p 0  B\  L *R B  ;G-PP $L1L!LLY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@P@P0S 0S0 @@ .! . /?; /P@-^000 Ѝ ^   ;@-0 Ѝ@-@P`p, 0B0 0p"#k ЍbMB@p@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ .! .P)@-0 0PT0/ .! .P@-0 0T0/ .! .//P@-$0$ $$#08D0 .! .@-,MP` 1U0@0$00 0p@000 0<0S dp,Ѝ8010C>S00@( ( 03(00@000 0<0S80 p @A .!Y .@-XP@P epR@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0QPU `0 P  S   p0 Vd00C0HQ0HPLPU0 P(P0P0V00 S   0Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM pbȂT0SY 00C01@0S D3/2"(PU0S Pg0S R=0 S ,  003/00400P4P+1 P0V0U0SH. L0 S* YP& HLH R 0|S0   0    @@U 0 HUI0SPp0S| `Ѝ\r P RUj Yg T0d0S 0S   PE  \P 03/, .! .@-8 0=(@ -p@ t@Ѝ&A-`M4PspM d0 ip@ b@ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   #R%&-@-   Ѝ Ѝ/@-MMP`@p0  iQ 0pۍЍ-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/% 0p/Q%p@-MM p \bp P@;00 dSV u00@ۍЍp P0 4Od%*0/%0@_Q%p@-@PPd; @功, MQT EV00pp%&BQ@-@P;a@@O@-q@ b01p b01@p"pc@-@M    0 `cp1$0Ѝip@-PM@`   0 TGcp 1@ R! 0 p`Ѝpii$0 /H0s P/0  //A->PXMUV0P0XЍU700p@ `R0 PU B0>000 <0  ,> !PP> * /i@-@T>@Q/@-@T?@0P/ R R /0G-`P M]0(0S @ >P P 7P: `P 0 01 0   08S0 300 Ѝ080 00S # p`P `P0P 0iS.S  `P04S 040:S&O-YM `F/@H9X0LP=Yߍ0p0FN 0S 0S iPP@ Y P @T0SL0P 0@S0@S@p@T1S X1 ⬍PAT1S@p\1S`1 ➍P5\1 S S R@L1SP1 ⍍P&L1PC_oSRPU@]!P08S V0s0yP8AN@$@ppP00SLQUd ph1^pP P U pPp l^@sLPP<O `  0[$0C  H `0 S 9X001H \0map X0 C000S0 35S S  CR0TppW L@S y r R 02 > 0*<1 T48#88 S R p +S 0 S T W @@ 0?D0 p 0L0D0}>D0 @e 000H0PPP! / /i 0 /0@-@PDM QP@T 00+p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S Q 0  p<@P @-P000Q/Px1P/$0/0@-@PM   UP 0 0 pЍ00 v`ꀐii~A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ S @`@-@p !p !p`=_Ȁ@$0R* -  r @$ A @   + "*   )  Q%£ £   + "*   )  Q%£ £ /A-`Pᾁ@P─@Ѝ P\KKP0 q`&P pP !A-PR`@ M 0S0T00 Ѝ/pP P'0 0 0 0  0S TT (8PP/00T 68 0 05O-P@0"S0Z"SJP Y ppP w70p0 ЍT WYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8fg(g(g(fg(gdg(g(g(gtT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: E U*`XJ:0\S 0}   0P0N[ SP0Sl  lEPTPp@]p&P /0 S S /S/P0/S 0 S S/0/O-P1@P ЍO@=`P hhC ЍOLJ U qW?J@P  IP 1 A Ѝ=}0@S- P'[ `PJ ``*IP 0 0  0 0! 0Fp@-@P I` 0SPI$` PP(0S $I0(0$0p,e P,e PO-4M10C`@XPSh $$$$$$$$$$$$$vvwwx@xTxxyydyxyynTynTzD${ nTnTnT$x$$$$$$$nDn\o0oDnTnTodoppTphpnTq4r|nTrrsst@unTvPv$m0nT0l$$$@n$ ,dxDXq$Thsx|$tpHU- `Pp $wP@T XDP7 T6X T&$ !P`0@T\0S @U0 @4 0H050U* H0?0P I0 @PA t01t4ЍFP 0 sp 0S ,PH01H0 00U  CjUH070 0 LpP! .R 0R77@0U ` 01pPD H RU H0@1Si~@H000zU ,P0H0p ,0 00 0 G,0S ^ dyU ,0 01 0 ,0 S, H Ut 81B8hvl0b儒000 0 PPP00 0 P  p@0  @P t UF 818hvl0b儒0p00 0 PkP00 0 `P  0@H0:0H =P0<0UH& 0S# /APp؀  %P00<0//`P 00 /0P0 000H060U ,0 00 0 F,0HS  <h?t 0 a.pX  P ?3p@H0@?U ,P 0S UA 0 A p H0@50e h050,0@$ 00 0 ,00,PYP k$@tPpgW700@4$ 0A;C @4p@AK0BAP@,@ 0A  Cp P H0@40U 0S 4S 04S0:006S 06S090PU- ,0 00 0 F,0HS =U H0P SPH0;00H090U ` dn`,/pPT D`P 0$'*` CeFH0Q7;0UlQ ^P0l1 WP0l1 PP0l1 P pE0Pp1tH000U10H 2y-P0H 2q %P 0H 2i P PH [ H000UH020P0hU3 | 00pP`] 0 S;70;H0206H0601H0;0,H080'UT 81"8bhvl儒00 0 zP000 0 pP0P0P@U0 818∂hlfr000 0 VP00 0 LPP00 0 APp@0  @U =2P hxp q{PWH0p000 SP0<00  V{P WH p P  F{PWHp   9{P  3{P  p-{P  \'{P=WH  BkP  ($p 00u ,p 00pPi $@ (= H,89   P= B8 TzPWHj  B' $up> pP: (( ( H$8  [ P  B 0\%!u 0 0 0L 0 0 1 1A 11 1; 1U 1 5 1 6\ 1k 1 1 1 1 1 1 2 2 2 2C 2< 22 2/ 2K 2e 2n 2x 2} 2 2 2 2 2 3 3; 3K 3q 3 3 3 3 3 =Q 3 3k 4 4* < = E =:u 4Q@ 4n 4 4 = < < < < < <ɭ =- =& = =2 < 3k =? =H# 4@n 4! 4 4 5 56 5! 5&B  EzP  4?zPW ,0 0= ? C,0HSy  #z`PH8W  i/PP `+P`,0 00 0   pC,0S@0H +P01@ pD  U/o"B2 ($PI/P0HL P(0FP9 L6$ P! (0L&0 ($bP+/qP0HD H(0(P D6$ H! (0D&0U# H0X UXH020H0 000H000H000H0 00H0 00(07600R 2  *450S00T045450H0U 810@0P@(l6h&P :0S t1U H\CpyP\xU <1 800h ,0 00 0 B,0S 0 P P0 0 P 0 0H080UH010MH010HH000CH050>H0509H0004H,7+,.U,ZH090&AK⚿O0\ U0` 0K ZAK'OAK➿OAK⣿)N,U8 \0@T$4(@# `PL  ,00B,0S PP upP0:0AP  ,00 A,X@DPaPRpP`H=Ph*DP`JP;pPh DP=P.pPj DP/P pPf DP!PpP l 0CP` DCPi XCPl pCPb CP`Y  D   9 :lw X 3W CPc  CP CP` 0CP` DCP` XCP ` lCP@` CPh CPd CPe {CPe l tCPe nCPl hCPg bCPg $\CPl 8VCPl| HPCPX ft oW ZP0$, PP" AYPJP00,CpPb wpP  RZ  RW 0,PS0P , S%00 0$0(00XH` p @ ( dZ`0Pz ʎJZv\0PsZ Z nU `P00,0 00 0 {@,pXjPP 0 p`f 0St %h*?P_  0 PH _P 1v`6 &!vaP(U FSH606H0"800H080H07 00H070 U6 ;6P0h2h2SH000H070U `P 00`HPp P $PV LP \|P10̀H040H030H,0$,H020U 0 >pH`AH000H000H0@00U ,0 00 0 ?,0HSx U ,0 00 0 ?,0HS|b U ,0 00 0 s?,0HS(L ge 50 57 5P 5jO-pУ@`P8 P P `kV81P ЍO.R$ RZ0 ,08 ЍOX Ѝ! 1O-S$M04 @ 0Q`P  8p̀z⨠娰81H0  00@p0   h    &P U (    $Ѝ& $ & &!$-)A-PQH 1`Sp51Sp:x1pS> X?H?\?hfl6S?h?pft6S@p?xf|6SAx?f6SB?f6SC?`?A?? 1pP??1pP?X  /P T0 STl6,`0Cl6t6,`0Ct6|6,`0C|6n?6`0C6q6,`0C6O-MPx<eX0 3&70 0 + 0+0 06}06 0 000 0@:0030 0 5 p Q ;(0 0 0 x00 +,0 P#Z 1H0E,=P0hl6( 8mP,:؍<Ѝ80ؔ$080,CP(/p,h6p2l6h2lt6囗 SJp,p>x|6囗 SDx>0&p6l"&t6x6|6p"66808 p,20! (>(P 2((pW 400000(0 00?@(0S 0 S S0P\S @pp8000SS 038 P,,00  CP 0?o20804P0P$0p((P ((0S&0' 6 PP(PK Z6 pPpP80,CP(0)S Yr N000姺0@(0S 0 S S0P\S 00@0:0P0 d hPP`(hQdqsPpdq P @P0S (P  P 0S (P pPP{ 0)R00S wP W400000(0 0  0m~0S D4* D000{!!,(@ !! 5Q 0? 50Q//Q *///G-p0@0P `<P Y 0 0 `R:S@C@3@D"X HGU( HGA-TpW0 T`@V0 H0HS @sP X X| |00 S DD0P 0RS  8B! 8V 8p@-P @Pp=@-SM00`"P!@03@000C>S<00p"P!@03@0!T!0!L!P-3@- P ep@Ѝ0@ Ѝ/@pA-@RP0p`@0S p :A-0Pp`@S:0SS 0  RS* R0 卿`V1S* [P a 0@DpR: Q  ; !h : :O-A 0MTP`0 zy'<@PAP @S0<1 0S  up 0 0宼PĀ 娼P 壼P 垼P 噼P 唼P 叼P 劼pPp0S p Ap `61@ R L7p 0<1#?P 08а00&&&p H0S& S% p D p L  p $ p~  pu L0S p0$0M0p T pc t0S@0 lPG0 ddd$k唺P$ p) :Jl p,!p]Ht p 0S P zQ  ʽZ T  Pp  #Pp嵻PO  尻PJ 嫻PE 妻P@ 塻P 圻P9 X00S 2"Q`` Kp  Ep 4%P K%P0 x1`$0  0p X00S!XppW" b a!<p%P `V%R  p0S0S" 0h 1SPq2ᰳXp@0vi   pa 0!hpYp  D pO 08! pFpP@ 1 R0S  P2 Ѝ0Sp pj! ;O ;J "= " # ;Y %L " ;a!8 ;n ;z <+Cx ${ ; ; ; ; ; ;! ; ; ;; ;C ;*  ; ; < < < W F(p@-P@pp p@RRA-P`@@pH0s  S  U@ p@@@dW0S R H R U p " ;Y=Q/p@-P0U@ST` g00p jjP@D@T:p <0@-P`1pSMAT  p@lЍ TBjPЍ@!R 0$ 0 0 Gp@ t@aV 0 !p@c`P Zp0S ltR00#40  LLQD SP 5 0 (! <5 <:! P 40iP 0  .߯PP  =G =P 0(ƒ -\ lp Q^ ,\ ,@-QMM@pPVp000 /LQލЍA. !. d0h "Lp`0SPE@Ep 0S:0@0D &Y ,3 =[ =aO--,Md`pP. uh|`  0 @P2 0S  +hP@ %heP@,P$ X]P$0X2y200,Ѝ P,P, R  P,PE0S h R* 0Y20 [1$ R, R P H1$ R R ,Ph!@P !!! =p =w P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@ZV00ЍPWP"0$?S 0[ PW RPPUT  P170 ..0 I@0 0IU:D X0 0 `TT  DSPO-`@P0p 00900W*0S T [700 Ѝ!0 *00@KP  00T [ 00 P     @ \Jo"p  & Z/Z#T [\*00 0000K@Pꓻ\ZT [T [ KP|&!C-QM MP<p`8p; @7pE <FKp V= p `74 5KpTG    0 Ep P; EgP E/    Qލ Ѝ   EP20%V0042 0@E p  @pP0P@T* p0S4 ~ p`@tT*T 0 hJp @ f p 0 Jpv @    @  LE Jp^ @  .0E/PS E/JpM 0S @00S@%<~Jp=ꙺ009*  Y 2A- PpU@M nЍR` R y00L0S 0 -0 0p0#0M0 XV 0 00 0)IL0S 0 = ={O-4MX@p 0S\`d` (0S:0 `p20"4ЍO 0  ,   pp0,0 ,0SPC<w ,4xp 0!00n,y/4ЍP V0 000!0   0,pmp000H!\9 `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  0<,P! = = : = = >p@-P@`P 0S P$`(0Sp,e P,e P I 0ZjB0@-MMP+ 7p P0@ۍЍ0;0 C@P b,P @- PΠ R:00\L  ^@-Q#00P`PV0 V=`V xЍp@@T   0x@ `DdPЍp`Vx1@P 0>0S *P PU@SP PbPݸ`ڸ/0P@-,0, ,wQ 0  @ɷ >)!!P >5 >d@-` ,M00>0@SP  '0x Bgp \0pt0 0 0S00 0 0S0S|0@0|0 0  X40Qx0 x&PT ,Ѝ0 8 0?0S b0xPTYA-`@VPPFP|P2Xpx`E,P x倂|"x20 =V0  |20|2@-`@MpP! ٶ (ն (X( 8pmAPU@ T 700@Ѝ i///0@-$!M@ 0  +PPЍ0 3"Qp 000)00@p-0000@ 0@plp 00 " 0@p< p  >!!Z >p >~ >p@-QUp@p ?-0x1p@ -p@->`FMV 0P0Fߍp@PF/ >9  0lt01 0 `z0 HF?@P 0> *l0 F?@ ii@-@MP4@ $fP P@Ѝ!!lQ@-<0< <<0SSL`/// >!! >5$0 /Hp/@-M @ p000p0@0M00@-P@,M(  ȵ   Pa@p 0 00S p,Ѝ0(i8p@-@MP ᤵ ` ⟵ ϣ  (P7@PЍpi:C-PQSM M3#vT0S2"`V2"@p@"r0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0t 0`00p0H0 L00$L0T@%120@ 2gT@@D@@0@L0 X9   @L0  LXH@L0   @L0  XP 4UPPEPP@ D$r =p`Sލ Ѝ C XH@ 9o!! >5 9[ 9 C-0@"M 0 @@ 0@$@寡p P )PP @@  0⠡p `@`$L+Ѝ00V :0 ( P| pPh (Ĵ ]W 0@T*x0V*00+T!!@-@P`DM p@  X  ሢ T0 U134  R2$ (@0 pDЍU@ii'@-|@QM  .00p |2 0"x2u>Ѝp@-]MP#;=p PP -R T000S0S S SS wR0S Hvp6VP}S CQRS@ 0`  x@P -$0 Bp 0S$ H 80Sq S} S00,0S  R000@0S  R00@ H @ 0夳 Hԡ150H \09>pX޴0S ڴ01S XX,0St0 0 000 0 0`IeRj>S S^  D]ލpRZxW@PN _ GPD 0A H&==To90S6 H⒳M P N0\+00S%@i!! >@-40 000 0,Ѝ!!2S/2S00/@-@@\V002@-S0@0 @@NV0002S T{/!!G-PM`p (PPj(@P. PP` <p<00 B ;pP0S p g=p PU0S hp ;o)@! (( M=p | PF=p 7/PP ;=p &P Ѝ@ > >@Bq ?BlBp@BfO-@p`0M00P U ;0S9P 0 0 P  R P崡 R V 1!P P    ᔲP0 PPP0PU:000y Ѝ@-  < ЍBgp@-0M2S`P@x (fVP@0 \(<O00ލp@ !!ĀB-$M^ * ! :$Ѝ@-@; (@(@-@pp ^<p` B~R0-0 P 4s# R0p0p@-A^ T00p``0@D^Ѳ"000œ\p@Tp0,QRO-M@@00`1Q V00ЍP0p Q :8Q@SH ᙱ딂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C &P 0 B0 ] 0 S2XN00cSc@-@ 000P 0S00Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S00Ѝ@-@\0S \0\0@-@`q0`90`0@-@08\@0p@-800@P >0S0&0T0T0x1 RpR 0S TT0Q  0800 >0S  p@! ?:p@-`PK@%Pp00,000SA/00/0KpcScO-ᴐĠGM@ `\p 8    00KC%PP 0 d R FQV (P Q dPh  " > BQ * 0` 0 2&  QR) ~ T   K$Z $A\  D^V Vd^ h  \ P)/$  H\G@,ɟ`$\ D\V R < R @HT36    < @ VE0HS 800008 S0@0(1S p0 H0S=00(  (100@0SJ p ?0B +R 09 F Q'% 0 qp Fr 7rpVf@$Rp#  HR+  @$A @ 0媯 0V@$ @? WbV J@$R5Vp p  2 RP  HR3   000HS 7000 0 "@, 00 2S48h&, l QrLp     HR~2   W @(1S[Vp 000DKPY*0W(1SK(, 03s0 PV:0BSTF  0,0 0 )R\ Q: (, q  P V:@QT    ,   D B  r W   HR 9    @ B D?#R Y  HRM  ?# 0ͮ0?30@(1SW^VpW08 2S i( 2S P0H 00PQ0 0 2 0000 00@VJ VpW@ A5S 0 HS^00A% A50@6S* _``'0HS|00006 0vp6Sh@W08 2S&V0<1 0 Z00 HRp P0@W00  ^00HS_t000@0D0D0 HST<0 0 " + 2V0@ WhVeS@Q0000 00@0 0P0"9y 0HQ *0   @h0HQ0p00S R]$Gߍ0  000 0`s,  ?RcSc25 ?n ?`?A ? ?7@-P\ R&@P\®0S x0x08  Ѝ0PP @ 40p & ?!"= "P@-PR1!8`0@ 0p\ 0? R1 0R00  0M 30 0 0LP0 0:0 00BP00;0 008P0060 00P00 ЍP 0000t 0 00pc0 00p0 000 ?!"r ? @0@-p0i0 MSP`$M 61!pp5p@ 0S i [p ۍ$Ѝi@ 0 Pp O<1Q50 00pP P(/ լ @&h$ @%!" @;@- 0080PP `V@Ѝp0S  @P  ᵬ00O-IM PpẨPHLL `PR  @P0IߍO"0,0x"600 0G400` 0 ,p00,0 PS2 V30a2@0 0 ,0RT7`0 ?P 7X@PIߍO@70 Px 'VT` 0X`0T70 4`7P @S!"ʒ@ @X @h @{O-@pP`QP,b尠,`2S$P㘀U`,@ ,0<P)<, Q 0S ,9 < P,`0!" @ @RO-00!`p@PT:Vp T  X ⢱00U *¬"0 Ap Ѝ0R0  ⲫ @870 <p .7  <p 9! @-RM M00@P0BP Pp` 00 pۍ Ѝ` Dp p @6 D<p 0FS*@- 81SsQ S0 00 0PЍ 0SO-04MS@ h@@ ԁ`P_0 o0 00 0`0P # 00 y0U0P|# R @ ^ 00T0 @P0g 00 0:`P^ 0 $ ( XXV.pP 0$,0:(7,84P@ Z!\*Ы"0 0 pP 0[ $0*(00 0, $0 (,8iP@0 Rh0` 0h0  0304Ѝ$ 唪 Z0 j"( !0,  t  00 !0Pu @ q Zp0$00S,0 pP@,0$ S S S0,00(0R41S 2S00s(00t0$(,8P@00 @4" @O-P0M040@p0` `2''pp'ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,08h0噇 8l6Sp,0l0噇 p"R000, 2hvSl~l6S i5 0P pߍ00 `2(p (  0 p 00 `2,p( @5 0 p (45 0 wp,(5 0\ kp'0}0,404l0{ 40Ypo'0n@0!04,0i 40Gp`p`pgpn,0 !P ,: 0,00lS  R0 `"pP 000100,0H0 p 0 Y00, }R0SP 0I p p  00,0 !P !0 `"VP 00 0H0p0  0,p @ @ @ @ A  A"@ A18p@-PUp@0L0pp@- P# Mp 0` 0 ` 0@2p1@ Ѝp ` 02p )X` 02p  z00D0 U1002pO-`@p 0崀SPM$H` 000 0 0 `00`0! 8Р 00 `  $4  00004H0<1v pH'ЍOD<0 $3 4000(4@0S4H000s$80403 S 00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!3 00DL*S:kG{{'{*zk8 S zkg{{'{* z]$3 00?H0S0SY h V 0R<0S 0Sl2h2H000s8040 PH24 jP428 dP 20 ^# 0@ 0R0i 0.0 0Rp 0h`Ha  P0dh0Ѝ0SP1P1 P0 00( 00000S  0R`V {dp`ЍOP 0ptxЍO?? AC Ab ;J Ai A A A A BP A B H Bm"#D/ B B B Bt B{ "!"@ "PA-@PT R0A 0p800  l R 0i0MP 0S <0S $2  P) 3`0  `y ``u0Hp00` 00`8 0  d00 0$00A80#d0h0 BO-0R\M@`pP 0$P X0 #3P 0 RT0l00 p` hPP. aL0S0 0@S@0#/L0}e{?H00P X0 "2P 0 Rzgjzzz{T0d0S  $ P $[ <X x$ 8"0 0"  ! ,  0  <  @ , D  <H  $P(P Q48`LPPPTP /pX ~pQ  PPH  C0 0h1v`00s0 10 1E000z@0` 0`#P10 0\ 0`v k04S"1S0<10  \ЍOlp Q g 0S @z\Ѝ7S Dz B!" B CCDC CF Cn C{ CW !l@-`@pP`0 oh0X \6S R @`0A0  `, ?1 0 Ѝ@4    C B FU Cp@-P@ $ 0 00L0p@ C "p@-PUp00CSp@0@  $1  (000L0p@" C #4p@-P `@p800  B\{000D 0<0L00p@8 # C D#" ^#A-P`@ 0h 0R0hP3 _0<1HAp` TP0<1( AqFP 5   E 9P)`0` `垣 0d 0 2P $MA D< Dn Dw @!#, ? h00h0 C-p@ PR0  R $ RP508̀ `L0  iS@0S PP  P0 H lHL<18!4?788'00a Ѝ@ 0 D #e!|0@-@4M<13(0P 0S 0 0P00  000 0 0 4Ѝ00    y/  4Ѝ0@ D0p@-8 PR@  r P   0f,Hp@kPpp@ D< Dnp@-@P (Rh00h00L0p@7 D -(O-pPx0ЀM m F8 8C0@2spЍOFP 6/plp<0 2s 3p PU P 0P`00P 05iH00P0 00`0Р  N(#0(10I Z-  P(\ pࣣ0 + 70F (PC  0 , `PF-L`  ``H ? ЍO8   0tP() (1 (1  0(t!p>``v`xP( `"(1* (> >Q  0*ͷ    ЍOl  ЍO80   0S 0 0e0 #QA  $  S 0 0 00 R* $`0u0@00S( AP `P#  00h0d0h0 2 R \0 00 0S:ЍOS 0080000s  ic`PBpq 00 Q R   *0 00$0C40 040800 080ꠑ0 S0&PUS 0SP 0p0x0Ѐ60L  P8 ЍO`0l0 $ .  =0S 0S 0 S&$-  }0 <`0  @ R |0@ ЍOA H0@Ѝ!#8@ "P " E E!#D E/cSc E= #l EZ Ev(\/0p@-800@P  D{h00h00L0p@L i E E #e\/ R/ (>0/ d0S 0Q/ #eO-0M0000PSp0T @R` 0 ЍOw> R*iP 0S 0L6SDƛ PƛY  ST-  hH!  Q  0 S:500 0ip00 0  ЍO Y 0 0Cs0n0S0 S0L00 0!p 0 # z00 0.P0 4ZYA060@ 600 0(p0 0  `P  0 S 0<1pi@X6P P0S0 0<S<0P0Ѝ0!0 0 # z00 0P 6ZY7Z00Y[0S0 0  Br~  Brz0 ll00 0P0 RS0KSK?305% 000 +Y0S0   PP   ЍO3viV0 Z P4@5Y Y0 $P0 0 0 Y  0 , 3@ $ 0P 0  S 0S0@00Y$00D0<0<0<1(?00; P0 P4 000а 00 0 0P00 S*\P *   p< @ 0ЍO600 0<P0 n0S * 1P j p `<1 t000H 0 000 `0`0\0S   0L!YP 0 8 R @ 1[ЍOY Y) Rr   0 P0Pd0 &Yk 0 ?<+ t ЍO GN E E F F, F< FN FZ @S Fe Fa!| F F Fu #e F F G F!#N ;J!l"` G F G*A-h0PR@+ 0 DA0BS`pbp /0 Ap$ GvO-`Pp 0x1吠@ T ЍT 0S R T0 S> R *agP j0 B@ GC-,M@P`P Q0 ,ЍCPE OUJp0@SF \C0U@:p1S< U9: !R1 U.:!DR+  $   P` 0QU q `q`  U l*  <@,Ѝ  B!B0@!#^ G G@-` MQP\@M  $0p000 p 0S TH  ۍЍ 0a`V \@T "*!#j$A- p`w@PpAPU* 0 HA0S 0A \0S 0A!#w HA-0 ;M0M`pp@P @ p00<000C$00(00$0C,00@pV004p8  XXU0`$0 0'p ݍ0Ѝ!# "*  p@-@P.T  (@x1S0pSq '02p '02w022p R Rp07@-PX0B @P 0S0>0P 7P7;020C0s0S0270 00,3 Ѝ0@}r zgjzzP;R, @ 0> Ѝ0Dz H'(p@-@P0( GUph0Spp@\(O-@`PU Q Pd0S  0 ,0d07rP00Q 0S 0P (  0800 | #봀8 R0 , 00C0 0800<0  jP`00 0 0v0S $0 pWp1s00 2   0P C @R 00pwpWL0H0H0p HK #e Hl Ab0P s/0 @Rp@-00p0`PQPE@ `㓜 @d@$,b pP/1S P///P/P/Q 0\R/ 0\/P/ P/00S/x1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScO-` x1@TMT. 0S pW$ P K PP@0Sh0S d0Sx4x$xx噚1d0 0S )PPTЍ|0d 0|0 00-d0 00'090 ܙP p8PP ᶛ |g ⹙PP$0 00 PP 00d8dXA, ᒙPPn Ⱉ|0d 0|0Xx U 0S P 8 P  PU` P < 0$Q S "  Q  RPp h % <  hzkpPA t0<0t0v0 0q0 80ldxQY Xb P <  U  pP +ĠZ 0$8 0  h % < U  $(0<0|! H!#* H ID Ip@-P p`Û01S 0S 0S 0S  0 @T 0Q0 PSP 0U d0S0h0d0p@ Ih!# 0dP/ (0 /00 0S/p@-@T PP@0p!#G-Pp`P@Ѝ0E @P00 4_@P 0P000000 000%90  )$00 pPP%0 @pp0S pk0 ~9P  0@R 0 0000@@!# 9!rb I Is@-@0T  PR8 :*SQ h0S RH`Ѝp$`  P (0Q,0Q  ݿ `P 800000( ,0DP0S  0h dd0S  $0R  0h0d`O0SH5塴 I Iո0S/0S/   O-MD08PRH 0`xPi00ЍpP P^0 X@ XP R R R0 00Cs @ЍOP 0S4Y00 0000000Cs ЍO46 @PЍOo p    @@0 0$ 0 ( S!# 9!0S/G-P@M T 0p `xC#00 0@0 0 @^@ЍP/@-@TP@80S   01p@-@PPP (000p蝋 P 00p0000 S0 @00:S 0S @\S000@:S @,8&0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO4E`VK `0P0E@ 1 PP 00pCލ Ѝ@@e ;04pW p40(0= zP  0 `R0 :R`00Fd4@0  0(880P4 PF0 {0S G p PP ;000P6p 0S#0 0 0㋐p8`@[ +  0P R 0 0SJ @럘@ { 0P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ U G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S  y  00,  @ ` P D,0  ,0@PE_ P0S $ D0A00T*q PPJ 0P,8&@-0  0 Ѝ@-(@ P T0 0,80C-BMM00pS 0S`! \0S)  R&    RA^0C R[  y0Pv Ps @ OT Q0'P ލЍ x0P P 0@P4T0 PP U L^'P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  ,8&p@-@PDp@NA-`= @P@ d PPd f 00@^S0S:S_ p0 R0S@Ad{ PJU \Sp0S:SH 0C^ 0@0LT1 0L\s0TSpASBC\ b$b`a bXbHa a a a a a a b@a a a bPa bh0bC|^ 0 0 00:0 0Pd @0:SS0AR0@A  P A-p= `P@ d PPd0`Fw 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P &P,P IG-Q0S `pʯ PV00Ѝ  ὇P00CS0R Pp0  W00S(@ P   , P P00SW  X  R00S 047σ,P R   S@T PR   R ,P,x,X@0@-0S yP `P,P,x@-@WP08G,Pp@-P@PPp0RPp,P@-@AP M 0@87ST ,P,xp@-@ PS P@p p@-@P & 0@87ST ,P,xO-pWP`@P @ ЍZ K P $PT  RT@ Z //////O-Dr@00S `P$  4PV00 Ѝ  ᝆP00CS0Q Pp0 0 { U00 S ̏P  P P00SU00 Y00S P lP00S  P P xP \|P DvP ,pP$~ :(Py,ڄ0@-4@0P I$P, IX0@-0S ;@@0@00DFP0DЍP,,@-@`0P0`Sp 0`+P PP Ѝ,@-@P08D,p@-P@PPpPPp,A- P@`pPЍ0 `(0P84SUP @,@-$ 000B;P Ѝ,A- P@`pkPЍ0 `(0P84SUP @,@-$ 000B;P Ѝ,@    /0A-P<<`0@ >0p0D0& SQ9M 0@/0PA/A/O-@PDpDpG``b0Y:0z  Z# 0@@D 0DA\0:Z: [=0 S: p `$ Ѝ `p,A-@`Pp    A 00@-A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-p`TM00`< @P!qp TT0 pؒ@ 儊<0@尒404 4/,00S 0TЍ& J,A-`@ 0s P00p0pGWp0PP @P @pT 0@@PP @,p@-@P?@0 ?@0R:@@pP p,p@-QM$0Sp A1` 6/`1!6/&%!Q10P! \`6/*)x!(Qp'l10Pdd! \\\^`P 6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/Ѝp,&4" J8 JYC{V| J- Je-q J5g J2V J/ J~ J J J J6 J JO-Q<08@0(00IpPR @ph`,@480T:(t(@#0T(:(t(#0@ (0T: 030H,@`(4 8 00 D3#00 `@4 ԍ#00c4 0300 `@80@`000 4/0SD0p ,!#!#&4" Jp@-@0`,0DPSp1S@,0D0P/,O-EAMHP MU=Q`0, 00PP}p0,0v0@00`o`L+ pp A>0t@lTllH0SpW W D͊P KP 00PpXA C9R񟗈yzzzzzzyzyyzzzzzz0zzdzzzzzzzzzzzzzyzzzzzzyzyyzzzzzzzzLzzzzzzz0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0^ 0  ;/Qy$0`S 0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 00:w`| nj,`PPDAލ Ѝ, !ю4P 0H0, K & K* Kr!#,8,P0H0S/,0Pi /,A-HAP|0`S@M*0S'0S S f0P 0P@ @Ѝ pW*P 0 000c0pp@ h`0p唏X0 T7/0S 0SP 0 P0@ЍA>,,P& JG-\qPL @0P12C001b5R 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rᐌ000S0PS ⁌&0S,P N,@GH,-!\  0L0#0,@-p0M  L0@31 ^AP 0C! 0ЍlV,̄ @-L 0 0@11D ^Q       ,A-@b@0Mu L0 @2# p PW%cP_  Bc p\  Zဍ$0 HD@,X#10000 2R01   0 0S0" V00 S ؋ ЍA X 1(4/00~X0威0 SV Q`ЍQ0S ЍA`\c  Z# l⭊@l▋%0S Z b0@0,!#C-Q`0MS 00S` R@P: 0s%@Ѝ HpᄐW   @? ^0p0|0S0S +@Ppp00FV@@P 00T p@bp\`W 0S:S*  %0p0pp,,PO-`HqL1P0SU#,@T,P@P5 &0B1 `P 1`h L0C R P!050%Pd @T:  G0 p[L0CY1T*Q@@,G-QT0Si:\0`S& 2 c@Oop @d(0d$00@X1 0S. S0 P B H %Q * RA  0<408@S1:X 0p@D7C 0p03 c0?o< @@D@  SP  qOP ` @!0 a`2!! !00p30P,&A-p0@@ `P PP0`0P P@l❉%Q *0S  ᫋,$00S:@-@@X,@-PP` U(0SP@P )@T \0@富T0T 4/ ʌ 00'0S 0 (( @Ѝp,&4" K`O-$M@PpD00T0SdS )@TPY P3@}H3H 4/׼Y(0S p0dpY`WT0W$@p pp0Yk0 # 30f*[`C`fQl: L@P7W KL ) D2 10Z 0F30 %0S6*0S  0@P1'0S 0 0@=$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@0 f`[x [`K``fpP @P0p0 KF K0`F@  L @u%Q *0S  @,&4" K K,8@-M@pP,aD(0SWTP )@T: 0@卋0 4/0#880 0P0U: @P  K'0S 0 |( @Ѝm@P %Q|0S0S Pu 00,&4" KO-@QpL$M(0S@ P x`(W .0PT\\0T**P* 0`0  `?oo 0c `S, `P T 1q*9M'0S l p@`-$Ѝ4 T$P030#P0S X 200301S%T#2QZ E*0T00S  D้`P 00P`P0 0#  0|0S0S @ @p),`0<0 0 p`  l`P% 0   ^%T#2QZ J*0T00S  DeVvꪊ 00FP )0S 00@},0, 4/׺`P,&,84" L(@-L0@'0S 0 00 0T Ѝ@Ѝ,J////&/&0p00/&0p00/&0p00 /&0p00/&0p00/&0p00/&0p00/&0p00 /&0p00 /&0p00@/&0p00/&0p00 /&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/&ptpG0 0CSp0 S P20 /p@-P@,`缄Pp@ Tp!%|0A S010//!%|0P/!R/P/P/Qa/P/0p000 /&P/ 0S S//@-@!h0p00/&0p00/&7@-@PD@P 40R0PPK80 $ Ѝ04"  L{&PQ 0S///&, 03P/E4"0 ACP 0ABs0P r CoSPS//00S00/!& L00S00/!Ԭ& L///@-@H,@P (  g@k|&X-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P u@p@-0P `| @P  \*. Q  Rp R  (  p 0 B &,dqA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00w Ѝ0S/1>3 !/0S 000/,d0S*p@- @P\L P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!n0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ,dA-PRp `@P 0!ᙅ000A-@Pp`0 SW' WV00S񟗋,(V VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"1 21<0S 0R0PP0S! !x000S!!!,p (;J0PA , (0 ,P&p&&A-Pp0 R*S\ ]\ t`@BX T 0PkwP`&L R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00,d 8 0 s000/`Q'Q!//&p@-P@,`9P@tp Tp!2Q 010//!2,1p@-0@S0<QP 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`&p&&O-P 0R@M / P&  / P 000Ѝ 0@  !IPP ЍO 0 PS@ E 0 00<00S*^Q000800R ]R00-R f0S* ]R Q-R\T0]Sh-Rj0 Sv:0S0046000S8\ 0000050S0pQ_S ,0Sd40Sa$0S^<0S[(0xW b 0(`c0@`F p@ ɂUh 00C0c-R [RQ :R =R 0pS:  0Q00`S0`000-S]S0`S0`0h4 R*000pBW R:0`S0`00 S=*R: :R7 ]R400A  ⭂0p pBwPℳ 0w S0<R$ HP    qP  p$0  0$ 峠0S00``0Q00`S0`000-S]S0`S0`0= n R:0`S0`00 S*R =R ]R 0S0 -RC Q@]Q= -Z00  W2 0S- W0`S 0`00S ,Z00W0S Z4 0GP  pwp400!0pᲠ40 P0S 00000 P  P{  [l 0]S!`R& \0s0 0 0 EB#ЍO L L&p,d&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@&&&C-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  tHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB Pt p G 0D OX &(  RPSxPA4#X z 0   000`020+U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP   B   B0  B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S `^0<0S 00$000*Xe .X< 0e,d)>{^ ]&@-0@``P?Q $0As R SH^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )w V 1L   0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030` 0V:0S003000 <Q >Q q`xP  &  R  #+S  *Sg 0S8* *B?RP {R1 Q. 2000' C#,Pt 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   f0 S*}Q00 0RX}QR  Q +S ( 0  BL  B   B0@  B~?S {Sz   B0.  B 0  B#  B  B " A 0000S 00000,d&^ ]0S C- `M pQpG bqpL@P 6W: ЍPPP P $PPxP @ ~P0 uPP 6   00 0  $ ( , 0P4 8 < @ D te000G R:0S005000 S3:  N 0A0CP  #00Q p0 P>3S! 1St Sq S <0RpQ00< 0o (  ySW S<0RuQp< 000p000Q S S SS8 S S4 +Sm >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  N0S DPR, 0E10S*`P 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7Rl80SD 0>Q Q QS 00 0R 10C/UUT\ ,dEe,1p@-0@S0<QP 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0ZP`&p&&0p@-0PSQ@ʡ@80P p<0S P pL0@0t@@P(00Ppp@&p&&O--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T +P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  BP?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O& OPO-Pp`0,@Q V >\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0_0( 0(0 000p 002   0 X @ Q  0 R)  R # `Z X!,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(q P  @@ $ X0  QvW PYst va  r _V R  !    _X RG v@(@X 0x  v% YPt P vI_Vxtt xLt v _`V `R`V t@@ v(  P Px Ptv x N_XN 7@Y (@X fY0txPt, xt v  t v  r   _X_V Q ( X 10 _X @jth v xx ,    R (ZS $X $ 0` (ZS  P 00004Ѝ0S0 0x~ @P &O-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 c800@ 0 ZZR  D>sp 0 L800@ 0 CZH  D>3 1> Q p0p0800@ 0 p'ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  >>P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O& OPO-pP,@ W`> ^* +^` ^g ^N ^_ pP ^k ^Y  <P ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E 0000S0R0SpG pGPx0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F0@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPԦH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T @P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0h30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 4Rs R>c0G`T R 0 >c0D0H0 00 P0 0 >c prR pRd[L A T0F  6P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D/ H0 00 DP0 0 O& OPO--lM%PQ0u @%Qp ppm        Q 0"RS. 0 YP,Q 4^ 80S 0~ <``F`Z01S` 0s vQR\R 0C1!S` `0*a0 Q[0 000,@4H80<@ C PP 0 TX\ L0`m Vd 00 S`FY1`0 0 0`,P XD0S 0 0D0,`PD00D0 0R < 0JS : 5P Z Z `p5`XD0S[ 40S,0@440S pi, 0@ R0%00D ;0$0 0D0,-P5DQ/*0 F00,`P& 0 0D0,WP HP 0000 0D0,DH0SPHDgX 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XP4P HP PR [S. 0 Y*,Q 4^f 80S 0b <``F`Z$01S` 0s vQR\R 0C1!S` `0`0 eE&p Q/0 000V,@40H08 <@P0T0X0\0 00S`FY1`0 0 0`,P XD0S8 0 0D0,`PD00D0 Z ` 0R< 0JS: 4P Z`XD0Sf 40S,0@440S  p4P HP lЍ, 0@ R0%00D ;0$0 0D0, P5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0StPHD^X 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XPpS4 0 Y,Q 40S 0r 80S$0n <``F`Z#0 1S`0s vQBo \R $0C1 !S` `0^0Q0 000,@4H80<@PP 0T X \ L0`kV 00S`FY10`0 0 0`,P XD0Sc 0 0D0,`PD00D0 0 S` 0P< JP:$0 3P $0Z`XD0SY 40S,0@440S , 0@ R0%00D ;0$0 0D0,GP5DQ/*0 F00,`P& 0 0D0,P HP 0000 0D0,H0SYPHtDiX 8 D0`F0C X?4@0 ` ,0@` V 2 1(1( XPppq popm-Ѝ///@- // //0p@-8P00@S PpcP p,p7@-4P@0S TP Ѝ0P ,p@-@P 0S ]@P/]P0 0 0/ /0 0 0 0 0/////0P P@- m / Od,p O\P P/ /O-$MPpWHLm `d@P1!$/@ @PT0030#`W00S 0)eZ*;# 0 0 0 eW0! 0 $Ѝ  0e $:60 0%$0 %>Â!!!0C @T0P%"C $1?"!dp@P `p0X P 0@$Ѝ`Pd@$$ꙙ ӐQ\(\) Ҽ\(\@-QM@(p,` ^00 WP Rp0`bЍ`vpR0p`NT-00Ѝ0 0s ` NG0 0s p` ?0G-M@0p`W PV P%Y P.X PmZ PNx P4 P jWWf  cW ^WV+  WW RWY  KWt FWX5Z! L ;W< 6WЍYXZ-  %W  W  W WЍ  W WZVY  PЍGy и а Ј Ј H ` ϸ π ψG-PQ00R0p`ᤔ00M 0 @P @0S nS a0CSsNU2  0oSm ePN ЍdPZ V000U000dP[Z V070U070PdPZ V000U000dPZV000U000dPZU000V000zdPZO V080U080i0@q@dPZ: dP ~dP xdP`ZL V080U080?gdPo adP [dPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000ldP T dP  8 ʹ h X ̬ p ` $ 8  ˈ ʤ ʤ0 A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  p, 0 hp@ hp@  tp@@@dh0 PhhPh0 P`hP`Ѝh00@O-1MM @PDX D"$ "4"(0 Zp C. `pXd@D;@8 (0Sl pp  ` ᰑ 00㨱$ %0!`0p@ t0!0 PP 20S R5h001ݍЍ.h0S 0K0S R5 Pp 0 8D<4! @ P0 0d0Z  0(+0h,R <R1ݍЍUp P HtF H H 8tg0@-P@M 0  PLp :Mp@ P Ѝ00 0Ѝ0@Ѝ0A-@@0s/ PP0P 0 #p` ``0`0g0ppX`p g``0`0g 00p@-@PCM2 /@YP4 ,ZpPC ` M@pg000at3 06{C.@ F {P4D@ @F*^0S VS00 SCލp|@@0S'g@d0d 0P@0  P@1::g?00@4g00@ @ Hp@-QMP4@SMY TE /XPB QP0s+ #bP kQaP0 `#pG @0 @^pq> D p7 ۍЍp)0si/1p0 +Sf@0 P@0  P@1:f?00 p 04f0#S @f@f@+p@ f00x( @%T € ˆ@-qP`O-$p(PW,0-R`@/U'Y1 0/<`Z0 06`Q :["J? P5#I x@t4 2px 2@zPYh@sUZ0J[% 0@-DM@ P, Ph+ TeT0 0d0?`0t00T0?P0l0D0?@0p0<0?80h0L0?H0?X00\ 0 00#$Q `@0P"R" " #.0\ !#/2x"$0S"x`@y0`@0s `@ 20$P :$(\0<Q0(0 =S%0h00( @D0c0X[$0 l!#:6$00 0.$0Ϡ.>D!! 0!!!0C 2^!>0$0.S0( /2"́ ?0 0 #1?B! ,  ,$0 0S (0^ #0`@0qh8,""Xl""""'%.Q\(\)(0`@S  R $ R `\I!:6$4&60 Ϡ $0! >0!!!0C 0Q ,"΃0/($0?,0S00#0S<,000, ,00Ϭ8(<00$ 0 #1?B #: 6 4$&60|!$,$0!,>Â!!!0C 0R!,"΃0, #1 (, ͌ , ( 00S$ %0 00D2kZZ0`@00V `@h2p0 P :Q00 <S$0h00 0 c0$CZ 0$"#:6 00 0.$0Ϡ.>#! 0!!!0C 2^!>0 0.SX3($d/2"́ ?0 0 #1?B! ,  , 0 $0S`@ 0 P0Y*0^R*{ r0s{PT 8<0`@0 dS2  Q9 ^ $ Q*&$ 0PT80<`@  P0000  R00SPT8< 0`@D0`@0  0C0  CQ $0 h00$%`@0 @0D 00 h$%s 0Sp 000000i$0`@2t rt p p _`@ 0  S  0 & D%K`@ D SQ#=`@!D SQD# &-`@  SQD#`@D !0 `@ D!0 `@ ! 0S(0Ss `@70P h: c0 $Y$ ',:6$00 0.$0Ϡ.>(! 0!!!0C  0  " R!Ό "$!( h(\ ?x#" ?00 #1?B!  ,,$ 0\ (  R0004  Q#SJN S  PQ%8< &0dQ(00 3)!:60 0 $Ϡ0! >)0!!!0C Q/ 9 #? /" R  " R $!$0  0#1@0L h0 0%HE 0C00000S P 00W CQ 0_$ 0 0 0 C00 00S ^ 0 0 #\ bh+R" suO-M@p$M^0`l0I^0T`0 W0 0 2c1 0008 PP/ 0v> 0d0?`000T0?P0 0<0?0 80 04$$%"p˟$p 0000  000W 0;0d0PY 0TPL dPJ$`P0Sʼ Rʨ R ʰ R  0 0a 0S0`d@?O$@Tȏ(ET0}N0`d@00]Dp@ 0G0LP\T<00 PR\p|hPv^DR PE pPQI d4 吠lpptxP[@SRZ Z00d@x0Ut0Yp0[l0Wh0 Rd0 Rxt [)[8P0>C 0C 0t00@p0` VP x0S T]0ptp0 00@ d0 0Pd xH( "ό R t0"! R RWv 1p?'/!! ԧ#./ B pW ?,?.P P00#1 ?Pv.C BL\Sx  Ptp Pp\ 0 "zqp 0pq\0S@T` VP|0 ?oR20S\00ߍ 0\d@xq@0 Q Q"10!Z@%NS" \TPd0 P0,Pd000 0  ZR 0S 00@ \0d` px\0S  0X0ZS0 `ddp p0dT0? P00d<0? 800dD0? @00dL0? H0\$XFZP ?@'\0S= C-ßs"bW2&:##c2S P#m8PP 0 hß0dT0=L30@8[ 00P` d0@rP ?/' Rß&0Q| 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. W0mpW!10'/ "#Ό Rà3\"= #30, S0AA^ B0 0 0Epq; @(@A[#00[0SA㴰@0d0@괰[@0"c01 2c1@TÏ 0b[0Q  sPT[T00Q[0S!10'/` "#Ό R?[00@o9[T00V5[T00%`|l \)P\( ɚv $I%@-@ LtpT taX00 R 0 R 0Q/  /   Ĝ  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/T 8 (H  Q j.0 0#  Q/00Ɠ\ 0@-pPo> 0@" \ 0 /HA-@P `p@P@0% LP PPA-\@`@P pjNP@0& 2P PPHA-\@`@DP pH@P@0& P PPO-P M spP9 谟P n`P P @@ % P P0S z Ѝz T W K  A0p0SL A-pPQ `@Q P 0@DDB(000S  w@@- M`pPPp) Y 0  0@0S Y0"S" 0p000S0 7/ ЍY0"S1Ds\0pT000S @ Ѝ1Ds$ 1T 0@ @-@ @O-P`U M PP2SpPK P@N P K <10`0@P6 0nS# = KPP00Q Q P R  \0  KB" 0 0Q@00oS@d000S p Ѝ4 }zx dO-BMM@pX@0  0PP:JPP  PPn00JP PC @@`KN#0 PPDp 0P0 0 PPDp \@P! H 0dSPkPU0 P p` p}  0SP ^@PP0 PpS AQ P X 00BލЍP/U ` P Mp@iX0SQ  MEPBލЍ CE0H0PP0 Dp=  EFX00 P 0(Ed! 0 0 02X0<0  0E&X!0 ̤\00' X00 P 0D}X00  P 0DqW0\0 P 0Df  @dz d $  -{M 0 { CPЍ -{M 0 { sCPЍ >-{M 0 { ]CPЍ ?0-,M 0 HPЍ --^0$ S   0/ 00tp@-P[DU@pjW?( ( 0P 5/p p@-PDU@pQW?( ( 0P 5/p @-@P 0003/h @-F@P 0003/( `p@-P7?oU20S@ 0 0 03/p p@-P`AUV00P00S@p$ P05/ph p@-P}?oU20S@ 0 0 03/p p@-P`@PpV(@0 p@/ Xp@-P@P p 0 0 03/ph 8-@- M  sp@(0(003/ Ѝ@ Ѝ/ @-sp@0003/ O-`$M ؤP @IM0Sp$ЍoV0,P@@  4/$Ѝ$ O-`$M ؤP @0Sp$ЍDV0,P@@  4/$Ѝx !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// ///////////////// d P 4 0 t \ H 8 h l \ H 8 (  ހ$0(- C^ 0CQ$ :$0S3 57 $05, 0(0$00 # 0 $0 0@-@$ MP#055050%A0!0%P$00$0Ѝ0 $0R  S,3 5,07$050$0/S<3 57 $050 0$0/0S/, p@-R@pP$(ASp0$ R>3057$ 5 $ !PpO-`@VPpDM@P؆, Sp0@ U p 0@P UK UK T,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0 @V@B 0S1 `@@0 SS( S R 0C#@ =0 R,0 Q ,0 0,0 R<@0S80S ,0 S>3 57,050,0@q`V  FV")VX*0FSTRQPONMLKJIHGFEDBA?>=<;:98bV1 ?R20S/ 032 b0 B12 00@s 0 R,0 Q ,0 0,0 R @YfV ?R0@SQ  b9@S B88 C c3<21FV ,00 S Q 5075,50,0 5SQ= 305 7,5  0,Sf @ 2$01$0@@@0TS`VI2=0F?ofR20S00:FoFRQP Q P=V, Q05`7,505,Q,0 P,00,0Q  1@ Rf 0Sc @[ @ 0PW  @ ?RM0@SJ b9 B88R00F @00R%#jo%#jx%ju-M{0{0 Ѝp@-P`M0@ 0 4/ЍpG-PRM[  `TpPC/a@DP @1000< pp. Ѝ80S&  1 000< ppR0S0000< @ ppR0Sx R0S X 0 < @R00R00 Ә X \ x h @-$$@M ЍȅO-EM M`X@P+p `Eo? V0P@'T 0 V0P@T| 0 30EAP ? ?UEލ ЍWR00RR00 qd @-@` pMPMP& /:V 0RP$  rR$   P @0C rR  Ph 0 @Ѝ0 Ѝ@}0rS R 0 T LA-`@ p 0P/S /UP @0 Sp 0 S  9 Pp@-IMM@`PP p 0: S X0 0up IލЍpQO00@IލЍpQ00 }lp@-IMM@`PP p 0: S X0 0Jp IލЍpQO00@IލЍpQ00 T-{M 0 { 3=PЍ 80Q 0 080/p@-@PP`  5PP u DP  p@*PPp--00 M (0  ЍЍ/@$--M  Ѝ Ѝ/ -- MN<P 00  0 ЍЍ/$0-@- M@NP  Ѝ@Ѝ/O-,M `PRpp00:Q!0P00`Ppp0 0CS# PY P@ 0 @YP CNd",Ѝ0p@-(M `@P& (Ѝp0 00 $p@-`@PNpp p@p@-(M @P,0, 0 `& (Ѝp$p@-@@ @  `  @PMpp p@m8$p@-(M@PMp `]&8 \(Ѝp@-@PT T  ,M` @Mp pB& A,Ѝ$C-,M pP`PEUP0R@@t0 0:2 0U @P0 @T M!,Ѝ0p@-(M `@P% (Ѝp0 00 $p@-`@PhMpp p@p@-(M @P,0, 0 `% (Ѝp$p@-@@ @  `  @P?Mpp p@{h$p@-(M@P1Mp `%8 j(Ѝp@-@PT T  ,M` @Mp p% O,Ѝ$ Q 80 @-880@M08 Ѝ880/DD0000 0<PQ 80880Ѝ`l/0@-@0@0 M0S 0000 X0 x0PP X d00`B/P00 Ѝ0@HP,  $ v4 v$O-d3M0@ 0P Q\0 `0Dp@[ P P00U tpp0 0Cs Y 2ATT00  RH LD@D T^:[ 2 0000`K _L0 V0 W9 @2ATT 0`Fs 0RC FL 0 h 0 Bb0SH 2L@00Ѝ V0& 0 K L 0 A0pHXG0S? 04 Lu 0 B* 0 B#@ 0 B  BK`FtZ  0 B   BK 0 u 0 l K 0 | 00 D$p@-@PKppp@ 0RS00 /p@-@<0<00P  @Kppp@ $808 00 Q0R00 /t$p@-@`PvKpT T   p@pp@-@P\ \  ` @YKpTT  p@p$O-1!000, S1H0? MPD`d 000PV1!p !q1 W0C@(t  ,0@@KDA Œ Č Ȍ A`| Ap4  W R ? \ QQ Wt ,0 000IC1100Q00, Ũ Ѝ0\0 00{h$@-000 000 @@P80@080D@-@@P80@0800-M  nЍ0-M  ЍO-ϟiM QP@̑Ёqa ~P? `K͌U mPH? K͌T \P? F͌(1S IP> F͌(Y 7Pp> C͌ X %P(> JB͌8W P= ̌V P.= ^B͌`h=@ 0S078L H0P$ `P P  P P Px PX P4 PP( QP PP (P PD PxP'( tQ780H0x100C40S000C,0h0LP 0P( \(0Q0Pd  , P `P X hU1q @a0T0 @+T, 0X  p @dQYh`@0`@ 㾾P`'  V U `0P1A1S  ,000@!1S 0D 0| 0?piߍ00P,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P`V ,PY 000 `,0匰 0[p$0p1`㐀0@@p`5Pp  W 0@0@S  P8<`@P(04 0R(0LPP1@0w0S@@X!(@L n0S00!$0P f[T`0S0 0 X, 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  PU,0V00@ Pܰ封[ P@0㫽PP  U `X0pP @Y 0@X RY0,0P0  0, H V 少[0D|Aj>`Fp1P^ @ 0PU 0`0 0 0[0:ꈰ  0PU;P  0@TP=Q @ 0PU? @ 0YAJ @ 0XC @ 0pWE,  `4,  B 08P< T$,  p , 0 H T0封1D|a=p@&8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  P;U,0 V00@ P封Y P@0`PP  U `X0p8@ 0<X\P@U.[P,0 CT', 40p! |0,0 H0T 0q1D|a=p@P 00 0R1 (0SE ,00p W 0g1(0pS3 1@ a! @0T0P0 @@T,00 ` @!(0R1@pPBӻ0P@< T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @T,000 @,0,0Q@@ఱ>P`p{ PP U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @堽T,0 0P @Ta$0V1@V T  0 /0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a PWU,000 P,0|!0RP 0P1` @0P`P T  0 @  h50 0R80000S 6O-pYM|Cq0cS@` Q 00L3?K͌ 0 0v0S?H`3K͌ 0H0w0S?pp2F͌( 0p0u0S|?Pl2F͌( 00x0Sp? 2C͌  00z0Sd萍 1?B͌8 00{0SX 1?̌ 011s0SLN 1?41@BM@0810 PYߍ 00v0Sk H`w0Sv ppu0S Px0S z0S 萍 {0S  1s0S N 00@-P@L0MH( 00 ,0 40Ѝ0H$0@-P@L0MH( 00 ,0 40Ѝ0$T0T 0  D@Q 0Q(00?H/Ƅ$x$ D0D @ 0 R ,  R$ 00?H/ x$A- 0D  0 R  R' P?UH@0aaS,p10 0D C  (  \@T@T 00Ũx$0 00ĸ$\ \0 0H0S?30 -88  G\$00G/Ĕx$O-0HS 4M4ЍphPH D0 0 0L|!09|@UP` `0D0ZP`@0PZ0 T۸P V@``@|:L ?3Q 4Q<  H0 00DpL |"(099`P0S R@,PR @0P 9 R0`S4ЍT `@004  0〸`Ps @|`x$0 00^$p@-T0T 00P0S @ƻPKpp$0S p@-P@᰻P5pp/-H 0? 00S pp0 0 S0| DR0  0R0 Sx$0 00$$ 00 /VO-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n Z1Q0'0 0 0 0 tЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000 hT$C-餂pP@M gPP @@{ d"j =@-ÆBBB {`@C{@@@@"PV CF pQ /pL 0p R] @B0 @@@(P: 0 @@@y(P/ p+ #p' p0 @@pe(P  &h,$000S :3S PЍP ZB2T @T PЍh0S,A=pP_ 4St GA-Z`pPp ZB2S @TMV޸ܸ000 R AԸ A ϸH@-lQ+ P@E0`XM_  S- <1^p0!!!!v : !' !_ !| !o !* <#>4{!*prQ>{ R 81 R 0SЍQ L0 0 0Dl0T0Ѝ!fPTPOl@0l 0̃ S/NO-C@p`ᜣM[ +(p($W 㛹0CS0SL3㝹8ࢹP $3$0/# {% 08:x{rH̲ pŸ夒堂8ırxrhÃqpr(rhrq`r`PrXr弁qPrxrHrÃq@rr8rq0rr,rqps rqrqrqrqrq rrrqrsrq}@s: R 0S 18p10S pWЍQ 1 0 0Ch' Jl`p  \p  00(@T(0Ѝ `aP 0 DP!M+!,!-%!.%0%#fq&i%"`j#%ok{% |l%m%<ns%t%$u%4v%,w%x~#p#r"dy"ezM@KhK>Ʒpp<^㾷v㻷8#㸷:㵷0'㲷#㯷z #㫷H#㨷p-㥷-㢷`_㟷|㜷o㙷p㖷r㓷y㐷z㍷{㊷@|ㇷh}ㄷ6A-``'^` p @ 0^ 0(`V(PJO-`ܶ6 6M000ƟJҭp6 0000SVF % p 9p PP[ J p?P4S S S|V0S#pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;0Ŷ $Q B q 0 ;0 嶶pP.4 S S040S$ 004 0r0  cR$`S 404 ` pse0  ;0 凶p PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0SgpP 0@  ^ $@ `00 4S  20 zS 202 `. pX p 0$ $P0 s 00bR40 ; 0"p@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100#?c p p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100#?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 01P^P^,^(\QZPY`AX  8 0(  0 + 0040 0/W0S0:3S `00X00! 0*`00<00X A0 00$$p@-@P;ppp@p@-@80800P  @;ppp@$@- MP70cpP 0@T $T` @@TP  Ѝ<V>0/P0@P@P@X@-@69P @09P 0P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" 2, 2O-08vSp@`M$f`ZP T0 ʍr `r 0I"R 3S(0$00 0U7PK TK7P  0XSd%$ X% 0"L5`0T <504S0300SL p0SI 4SC 4S 0t24W】匡Tp2 >PN 4p2[  LAT `P P  @ὲoX4Ztx2 PX 04x204Y|2 Pl 4|2hЍH5S4S~ 4S0?o20 D p$l h $ <%$(lY $8P Z 8P [ 8Pp2?;~0p220P_0 rr 0H"R8YD  7P[2[x2Y  7Px2?;~0x2W  7Px278x2Z  7PL2|2[  7P|2?;~0|2W  7P|278|2w1S06 4S2{L%R/q[W]  7PXx2!78x2|"[Z[(`1M80<4 |2O[W,  7P'x278x21|29p2[p  B/oq`R"n000#?c Ѝ 0X0X0 0+8  @8@0@,?Q>= H=G-0S03P`@PZ 80$ RG V ʌ3S23pSmW " Rp .8 _,Ѝ0 0-M 0 Ѝ-@0@ 00M  ,0P 0 Ѝ$@-Ph0h00 @M P4p p`, p @0  Ѝ$@-M@Pn4p p`, p @0  vЍ@-0M@ ,  00 dЍ000 00:3S …/lO-0 J3\p4Pp M2,haP` 0pp,PC6od3τ  "   dm l  pb,F?⸲_ 0ͭ2Yn?~ 0`~ 2bP` Ѝ0 0 0 ЍTp@-D@D0@Ppp (0l0m 00 ptTp@-@0@P:#Rt t# R- # 0pp@P`p{:php@-@0@P :Qld^p- pp#P`pO :dhp@-@0@P:#Rt Ó \ "R-- , pp#P`p%:pp@-0@DPSP @p (0008 <@%8 pp $@-H0H 0@0:#R#R"#0:@-`0` 0@ :Q Q-  :X@-0 0@ :QQ σ #ppwP :@-0 0@ :QQ σ #ppOP :Dp@-0 0P@ :QQ tà Ãpp#!Pp\ :hp@-0 0@ :QQ σ #ppP`4 :Qp@-@0@P:#R  #Rp @8 “%\8 --  pp#P`p:pp8 :H$@-<@<0@00:3S 00 ~` @-8@80@00:3S00~  @-0 0@ :Q&Q)   ,0,0͂ $  $ "p"p#[P` :Q}p@-@0@P0ʃ#R(#R+ P-, 0,, -00$0 0$0X0 R0pp#P`pY0ʃ#Rp|hp@-@0@P :QQp!""p!"l#!l#, p p@#, :{hp@-@0@P :QQp!""p!"l#!l#, p p@# :{4hp@-@0@`P :PQ! “Uƒl\ l pp#P`p :Qpzh@-@ MZ&qQp* c0 0 `00004 0000408003 Ѝ 0< 403 ЍL L0 0`0` Vj#c7P`y@ 0 000:P/x@-0 000AxTT0T 00:3S 0@-pp  )P`/x(X0X 00 :3S 0-pp@- P`/w$0$ 000:#Rs/w\$0$ 000:#Ru/w(000 000:#R s30/v(0( 000:#Ru30/v0 000:/vxp@-P0P`M0@0 0ss̻p 0S|000 SC q R 0:#Ѝp R 40,00 3/ЍpvH@th# A-RBP0@SMw RP 0S `a 1 P00pppO 10Q41 1`p0V0S  z|100V0S  n034pp=( 03, pp%.W%ЍP  QÁP 0: 0 `x   0000 010 0@X100"tu\"X@th$D@-,@@0S?100 (@-$@@0S0100@-X@M@ 0S Ѝ< 0000 0l10 0Ѝ$@-h@M@ 0SЍ Y1 0R  (00 Ѝ K1 D@-@B@2@P$MQ :cVT0r3ppp'0Saqp 0SO1p0S@ k0  B0)1`00|PM 1@ 300 R 8 C 30 0X20$0 H :3,pp4 'P`$Ѝ0`00|P @ 0 0R` 00 `s000T @8 200 0qhlpC- M0 P `  }U L@s㑸<0@00:3S U c Ѝp n 0 000:3S/BnT0T 00:3S 03@-pp&P`/nl@-<0< 00 03, ppP`n@-808 00034pp&P`m0@-P0P0@Q0 M0 |P 00 02t000*# Ѝ0xP <00 0 2,000*C# Ѝ0mdl0@-00 P *C MT  |P 0 010* Ѝ0@#xP @ 0 010*C Ѝ0@r# Ѝ0ll0@- 0 @P0:R M P% P P Ѝ0P 000 10G# Ѝ0PtP 4000 Pkl0 000:j0S,01/Q&p@-`Q00?`FV`V` ,P1AQ (@0 ^0C0 S0Vpp/Q&p@-`Q00?`FV`V` ,P1AQ (@0 ^0C0 S0Vpp/\ 0,  B0/\//0@-PU,NQ (@0 \0C 0S0U000@-PU,NQ (@0 \0C 0S0U00Q=@-@TӢϜ4@DT@T,p@*P U``U`( P ^``^T!S(`P``` VPE P UPT/0 p@-`V,@@Da QP(0 ^0C0 S0Vp(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@s!800@-^0\#, 0 B\ 0 PU0,NQ (@0 \0C 0S0U0^0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0,qPp4S-`@PP3@ 0 00p) ,U4, [ 0   0   lЍB0  b9lЍOn/O-:$M$pdZ0  r$ @T] P 0p p  VH&:0PSE  0 s@Pp$Ѝ @ P0S S6 SpUV&0004S$ЍODp @0S F0V  B2Rp  `Fp ,U `F L,Vp  p+@p FPPQO-PM 4 3`S,[*Y= @00! 0@ @00@ TP/ { @p ` բPPE @0S  0 `PЍ` D  P 4A " 2:Ѝ @0 a| ;P0  0 /404 000S :P /_|<0<0 0 0S :P /_8404 000S :P /^<0<0 0 0S :P /^404 000S :P /^\-DD 0\ ʌP 0 z^@-|0| 00@T 0J#4R B0pQ 7@.P @b]808 000S :P W/]0D0D 000SP:P4@//\000 000S :P /\L0L 000S :P @-p @/\TA-0 00pW* Z3$SP! #R`@4Sp`3@Tv AB0tQ k7Ax-[-0    p[ 000 000S :P s/ZO-00 0 MX% p `P 0 ᫡p @ᘞP  0 P埡p@ 0 5@ ݠ Ѝ@ZP  P \/p@-JP }3S P`4`羠30PV帠  0s3 S 0tP 2 $R 0X0S 0D3 20X #$04p03ppp@-jP 93S @P4Pz30@Sp@sA-`PY JSU#X p@ @R 3S$ S(XڒL0AQ0, X0p ,01B0010χL10|10\ b0 0XP 3PSSpP4Spp3PUpp@-@P PX0:"C0T0XppG- ؀\/P@p  ` P LTL VW PT WV  P000S<080 0 0 VpxO-($Z Ap`PᰠP@8P ( (T2崠P* T 媠P 0 ( @00 (0WXT P  RX8 @(  !)@0U|x @-?S Pp0   0P @T1`a p@^`  0000T<0A- Q@PP% +pW# 0 0S07,5000 R   R   R  P r 4`T `TX *P Q Sp  QW02Sp@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S OP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0pCpP<H0H 000S P@ ?# Q@ 080//N$(0( 00Q0/Nt$(0( 00Q0t/N<$p@-P0P0 0@R`  0<000DH00 RI $@5<000h0S80@0805 H0$00 S8$>( P0@$0, 0!0 s0PT) H00#8 @ t@T,0Q0@t@T40$00S-H00S` $  R$ ,0  HDS400,01  00Q 0 0P$0qQ0,S$00,0,1 0000 S 40p08L|@0H00D00Yp 0SL01H@400 0,00005,00 0Y0Y= 00S 08` S0F 0R4000,00 1 1 01IY0Cڸ/o<"L\ R Y@L0l00PP 0 0 SP P+0 0S0R0S 00PQ ɟ`V0 0CS;  S<[p 0 AS 0 V P0P ` P R  0R^  `t9(00S)< Q0C0!  0Y00S3 80 u8( 0`V 00P0 0CS 80 @U@ NN Œ Č Ȍ N LL\80ɟ`V8 L0T T<00D R 0 R PP(! [R  [ $R  0E0 p0  0E  <000$R ( h7  <0@00!R ttX 4000Vn0 0C B!,0$ 0S$000,0 0S(00 R, 000:3s D  RD  M46( 00S70X *1h"0R( 060 0 @ `40 , 0U Pp$t000 @0p 1`11qW 00S<00 00S 0X *1h"040V @ 50S 4( 0pQ0A%0 0C03ꈄ 1D0L 0 S P 1 11RY@Z,P RRQ 0    #( R R% !#`FPA p0p`P@ !?3 pGWaFP `/0 < p  L  P 0P0P00 PP0ʙP0D0TS H00S $080  400  H(<20 Up`\Ѝ $0 0zH000S1( 0<000h0S$09 H00 R d1Sq\Ѝ4080 @0 80%P00C\!H00^ʢ00@ 0C9 08 0$ x0S7 p0( 0, QA@` `4! ,\)@XP pxL(ld vD$ vLelpX@P  P0@, QJ   4p@,@ APWp@PT ```TPp P @0`, AV4TDP q@DH P! X @   \`Q  ABQ`P P4 BQO p @ p  ,@0 8 R pP p , [!, !`k @@[`c zP p0 WPb   Q   P p,@08 P LPA\H0$00@d0`, Iy8 @A[0,  \ `$@00400  `40[0 pWP p p P  , BQ 0` W G 4 DP @P | 40@ PL0Y0I D|  p0UpP:W W@ P \@DT GpGGlE@N0 0: 40Rpp0,@0C 0B0W,0P 0pp000E,0 PU U R0a R  W R RR.0 S0@Z 0 RAA 8 LD@ ,　H@X LD 0B0 B 8 B!!n 00C0U40P0P,0a0 0R0d400,@\@ `*`vQI RF dPC  %@P d1S ( 7 ) 0E0p0 0E  <000P |8(  <0@ 8(0 0,0 0000S 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  {9( @` 0 `R( <`@0 0PL5S 0 0RU d>( <@0 0Lu0 00 <0005( >@ _0 `C0`  <000tW  I0 U<`? 0 0L9P6Pj <00 p*U `ʕiH5Sp@TL 0 `P@@U= 8P8P ` =`(O-x:xz0t*Mp$P( ,pP @*00\` S@@s  aRXAkHQ00) 4 @Y @B@0@T ROoB@TP `NNQS0)\ 0  |  bR\ L)` R&<) R! CP'I@, 4R S[80S 0P0$  B$ X@0C, 4R CPf S ^\ \( 00Q <80, 004(0RJ0H 0@0( k $P)0S700S00l0S# 0 S , 40R#0l P, 0S zP$0CP$D70 RЍ (70( M$(00 SBFf@`" & (00 S4$&P0C (00xP0S  ?P$00C$0@d& X&0 ,@(@ R 50 60, 40Rp F f@` 0 0, $P, 40BR0S(0g 0KQcڤ%%  p p d% 0(@`V#q@nR @D%@ T ,00P0S 0P0$  B$ X``Q 0[^[ $ | 0|$0C ,00(@0 K[V p<$ , 4,! ! x D @  ^$ $@$#0 P(0i0 Rv ,,Xqa00P* x# 0 l# (0$0@ ?3S0V{( , 3\0$7 (000P )(0$0S p 70P0  G@$(0lP " 20,  , n40 S ^ ) D20$ ,B@0S 0P0$  B$ $ 00P0 ! 00(@T7ڬa` ! (@00T0!0@Dx P(@0S  0P0$  B$ 0, )a`0S 0P0$  B$ 0, <ThPTl\80\<(PD(L $40\@,O-hsh3pdC@00 S M ᮳400040(c`(,P Zm34@ 3`0T&"0C S402PK䢟  50@DS(00S00lP 0S 20 0 204@,P0T0hP XRP0 @P 0( 0CS P 20 0 P1040 ,( Ѝ00S00h0S00~0T100  @P,P  -<1(`0 R*T$!P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( l0  04@SSCPE@D4@P,L 00SL004P͸l0hll<t|h@- ,(4 00@-  ,(4 00O-p1p!0 h *⨒YP!P H!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU,@0@DaQaS@00 0 Q  ST 0Uɔ0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/lO- MtuPp) h5` 80s,  S̠DD Pr 0R!1S5@50  50 `\Pᴖ 40 0s0P 40 0h40 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q WS~VZ]9 Q oSf2 Q 4SSVi^* Q j^S! Q WSVk^ Q S Q[-S 0Y[=20  0S0*Spt !-=000 0R$"R 2U8Ÿ= @0A004 1aA`PU+ 0S 100S H0 0YH0,N  Z000 0 0 00RYPU Ѝ0  00!R 0ʀl2 00 !R 0ʀl2 %R t5S 0ʀl2Sw Su Ss Sq So Sm S\j0~l{f{\d1P0TX POP# @ QH\F( 00ʃlœ\ 1:t“ @-'@T! tƒ'> 'tƒ /A\  B\  ^tƒ    /t1P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/@-@P@M&\\ Y #3t P P 00 8000 0bЍl`P -P\P Y͌# /@-00  |00S d d0 8=0!D00 R 0`uHu$@-4!41 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ !A\  `0`ttT0 000:h/xp@-@0@`P0M*l"R R`   P H00 040@ 0 @ &ЍpLlL02C-00$bS`@ M "2p @  "0S 1QX0&R  l"R. R !p@ '( V@ Ѝ1=00QM0SJ\1p20P10 0=0剑Q:20t1=00Q!0S0p20l00 00剑Q:20h00 0 0`0pY0!Q 00pM0!Q rl0 000/Lp@-x0x 000@00CS0 S p0 S P00mpZPp0$0p@-0CS@0 S p0 S P00Op<Pp0p@-,0, 000Px@;p(p@-Px@1p@-|0| 00@0J0Q P R, !Q0000$0JP\@-\,AP /0S/ p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0P`Q@ xpP 0 0C S p00$ЍJʯ,0  1@Q!R 1Q0 CP(^01A@D D Pv U 0 0 0I U0@D0?Y 0q@0@P` tPPr  U  P W(0p SCJPC0 0(0C\00C;T0 S}80 > *w1 0@0 @D BT `p`$Ѝ_ TP P  D0|0up H0@D002 T `V `vV `:`  P] 0 00P$p@-@Pppp@p@-@80800P  @ppp@$O-46dM0$00Q 0| @pw`PyU P#t0P0O W 040P0[000P0@SWL9.SR`0XP0P00PEPUO000 00PS0408 00 0`P0p @R@+40T R80 ) 4 2w$ 400Pp  pG`0000C?00wP`FwPH` 0p`0 PP Y 00 00 E 0 4,QpQpP Qձ,pp( X4 R!p! Bp G" RU     HU pG4 S0 0 P` 4,8p 04,0@,@ 0<8PU 0 4Q00C 00 Sb 0( 0C0, Q0 00SPl 0002000C?00|vP pGR0H`Fe pv$ 10 P 00  0E 0 K00000p0KWvP 0I pA! Ww 0H 00 0ᰡpG W!D0|0p'udЍ004 p` 040T pR0`40 00 0P} 0GP u9dЍ`-t0 00 d\$p@-`@Ppp p@V T00 L$p@-@Pppp@ ?p@-@@ @  `  @Ppp p@)$p@-@<0<00P  @ppp@ <$p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``|O-葟MS D@HP 0X 0p`@ 0 0[  E4/ 0 R < $R0<SP10000#10#.Q00S0> sP 0 0@0 0x00 P00 Hr R0S0 0?P4/[WЍZ00 Hr R0S@0刀0pP4/pW|hQ" @-@ RM !R "R pPĜ\  00@]Ѝ/0Q " @-  MS S PpP$R (@4Ѝ/H-4M0 Ѝ\@-@000M, @ Ѝ\@4p@- 0B\\@S ^\1  @ % e ,\'\ { d"LA!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\  "0  {  \ @ o% d  + {o\\:\ { c|QO-M  CpPP 0  %  0  S  h `\ @u,S 0   @0S *  QS%S +0B GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 Sr 00PЍ%0iR@ 0 `fv`  00#1.R0*R0 S l@0 S[0@@00dR% d 00 @0@00 S0[  00 @@"0 C0 0 S[ 00000 K0`"@ @ 0 @00 S020 0r 0  0@ 00 Ssؑ00s00 00 00 000@ 0TX 0@d0 0 r 00 C C00 0 <0  0 @D@0 @0T0 S\R Z I00 S0   kt  000S0\S 0 S0 00 |%p%c%+%c}}x}$</>p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0RR|RH`R A-@0MS0D0@!0@p0S? `: 01!1P!1"b2cP@AL0L  00210B=P0 pW$P@WP 0fS*PЍЍP 0ЍNz gȧA-@0MS0D0@!0@p0S> ` 01 ‚P P@0!0A1 0120BP0 pW$P@TP 0nSPЍЍP"0Ѝ0Lkx>C-@0MS00! 0p0S2 P} 0Z`1H $@0 x 0X1@ $A0!b4!b @1c1c0A 0 00ࣀȈ(!h!bC P㈁ 0tS0cS0S㤠 0 @0Pb 00< ?X 00u >nuhy, Ngȧw@Lkr$>qL?-S* T-0p0  Tg@W -@@@C?T@^ >Tp A0Ds =R=S2t 0BXaevV.`^`0^@ C @00! Dr 2\* R:0Z'TOP ͍R'R ͍T0   R'R'Rp@@pI@[bjP 00040YjP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 34 00`Q,\*P 0 |p 40P040`OU; 01 1`0@1O1S  0C-11@ST #Q,%*P  4 @@9AT @D=AA0@a DrQA DR3@D1@ؕ& R ?R ;RL  pR 0%R 0@a0Ds RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP OU5 =1 =10@1@10Ds R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@ps!R =1X@ BT! 4 Q`!`10` Q,0*S 0 ip 40040@M, 40,qߍ! 1J00@QU PE=1@Q@1OU =0@01P@ Q$-1 1OSh00PiP 400P,V 2iP 4 `V ᧠``&``VP``P``Ì`@oobP``V p`{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2i0PQ 4 0,0S@p00@ 0 n00 @00\| '8V A`000&@DQ0VT&$#"y p ]K5#t0@0C!@DmOo0B00f0@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/ A-pQ@PM 0S! XB `hP V`V! 6 0v0* V Uz ``ЍpP0U0b ``U ५ 0 0 R Ut U\P0S U(  +}p 0S R s0r (0 000SU00gP d0 p0(0[P c0 p00TIU@C4? D L @th \ h 0R @-MI0@S G ЍA-pPP U) U@`TV 0PS |@P0DBV  aP YoA-pR `Q 700@ PP{ % P P H$0 GS  gP  0 /0r 0 /r 0R0 /r R0 /r R  Ͽ|Q  Aq0 pQ?Us0p pWP·Q| 0?s0S # pP  o   1@pP V0?s0 q%fP v0?s0S  pP  q0Q ?sp!Upps0q@pP 0?spWC 0岀ḏxS$pCPC "/ X9 $ 0?"s0Ž nP6 sPD fP*0pS  U R00000qQ 0:!fP fP" $ pP g$pg nfP$0V0 p03?/U  R000000 /r R0U0p0p?s0(C-Pa@|!`pM0 ǀ P 000S= PЍ`P  P 0 Ap R 0S 0PP  VPP004PЍ 01 P @``+ P *`P,t ++,O-M M:S&0:SSP 0`S:Spp@F T R!*  @ 0  tDlP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`tP) 0/SI P5=P 0 ۍЍC0P p! P20 ۍЍCl0P 0S/S dpP fX #0fX P 0 ۍЍC0 PۍЍ p 0YfYW L0L 0 $ۍЍ404 0 $) L 8   ' x' LG-p`@P  X0@)fT  NP @\PPP P @T  @0GUTPT -@-@ M00 Ѝ@ Ѝ/B Ѝ@ Ѝ/@-@eee@ee e0e@ep@-@0 0s0?0 0?0P Y000p 0p@-PS@:pS dP!pYc@- ^ @fR^ qSnR sRq^! 0  Q A- 0X p`fR0X P@Ot P0  nR sR0?s00X0 0 R  0PA-P# P 00`pp0,SS00 0\,\@CbP   p`p@ FG-pl@`PP#;pWU*nUL sUC fUH0D Y%R> @$dPH H0D@ / H0@0 H0H0nUp@0 H P4 sUD fU< L00L0@P @QP00W ,00 ,00 mb 0S0000  0@SH  $03?0H00H0H0@ HH @,0s0?0H0@0, H0('H0, 0H000$P0s0?0H00H0 P O-@ M PZ p pY ` `(080H0bPS 0  uZw /   v Y/   00 R0 , 0R0 < 0R0 0L0S00@ Ѝ>, R 8< R 02L0S @,@-0 000 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\f|A-p ``V@PR bP A0u0W00 x /    0 0 0P?a 8  O-`0@ $M 0/P pcPpUP5  P b0P  0dc pP|@P P@@ubPOc $Ѝ DcBc0,P U 0(0$0,0 @ p @2/Rq 0S00eP^ PU X @/r c0LP@UH0@0D0L0; pfS0  0p 0 @P PU  @Ot@0nS sSqpX @p4Op b $Ѝ@pOt@ \\@o  A-` ppW@P R# aP 0uϿ   v0?000 0*  0 P4`0A-` pW@PR aP 0u 00` 00 0P `0O-LM<  <0+, 4 0OpP |@P0|0`PF 00ZPT PE:PP`PP  PI V 0FT 0:,P `a 0 `10#0 $00 0p0s(0p s (00UPi ,PC 0S@ $ .S  ROSQ = BpP# =@Pe pp`v , R 0?s0V 0S00 Rb00 D\D0 0SP PO 0 K 0S% v0 L 000  00 n0P aPLЍ0TS 0  0 00 800 S,0&Y0 ,`0 [  @0@SQ p@t`00 0 0f0 EPdX ,`@V 0 V P ph (\VQZX %P^VPj `@V 0P & 0GSI( r (0tP ,)0 FrQE F/RVTSRQPONMLKJIHGFEDCBA@?>=<;:t76km3210/[-Y+*)glh `V@ V%40`  @ `00@ @%40    `p` `p,m^0 :08 ` Q 0?s0T R:0 0P  `p       08 x ?V  #v 0 S00Pd0`@P00 T0@\8 40 08 HX00S0`@ PV```pI 0 00 s0 P ,'@ p@tj p@tG , R 0?s0T 0S00 R00 0S00 @PW{QPOT` sP0 I 0  ,ᷕP5 P p`v0[ 0@s 0 P0P 0  `_LЍ 0   pd0 l < (p( PH_| l  p tP/$P00//k4@-M@0  0!1l!1"b2cNL 0@@0#@B!A@C0PЍNjgȧ P0`0K?//jL@-M@0  0 LlB N0"0L 2<@0#AB@C1dKPЍLki>$0P00?//i`@-M@r0 O 0L@N $@L0B!b!bN?AA4 1c1cL0P0@$C!d!b8A@C1jPЍL?-S*hp@-0P0M`2{@P 0ЍpX, 0 0S Q20Ѝp~hG-1!0  aP P@4 04 S0p0p2,0PP0  |Qp`  WPeȄpEQ  W| 0 ȇ0H00 P` @-@P O^M^K^ I^$G^,E^C^,00!R  ! 001/ p001P// X *@--@ X@X0@0@0s H PJI HH @NDA--(M g7`0@[TpSo[jW4C@-whO<(q*]{b~ y\[9&Eo8k  )SRQPO_LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " k{WF{{!00 (ЍP P 30 00WB0h {kWkc!00 P ~P \# 0W 00 "P  0cP0L30{kWk 0 rP  0cP0I20[DW{ 06{kF{{\Pm  0cP0x20W 0y0 "JP;  0cP0y40 W"  8P:  0cP0}10n[DW!{ 0a2!"SJ P,  n0cP0%ʘ0 W"  R `0cP0$d10W 02P!"P  N0cP0$10W 02!"P  <0cP0@00W 012 "P<  *0cP0@ʜ00W 00 "P  G??ND  ܘ h | 4 G ڌ D ٨ | D0cP000[D{k{F{W{ 0! P  0cP0tT30{kWk 0 P`  0cP030{kWk 01 sP  0cP0m20W 0^2""aPD  0cP0Kʌ20W 0<2""OPL  0cP0H20W 02(""=P  0cP0D20W 052""+P2  y0cP010e{W{ 0 P  h0cP0ʀ10T{W{ 0  PA  W0cP0@10W 02!"P  E0cP000wWB 0 P9  40cP0jʼ00W 0[2 "P\  "0cP0%x00W 02< "P   ؄ ׼ d  ֐ ( P  ` G Լ l 0cP0000W 02@ "P  0cP0(t00W 02 "P  0cP0ʴ00 00W", sP  0cP000 00W" aP  0cP0<10{kTF{W{ 0 MPm  0cP0d30W 0r2#";Pc  0cP0 30W 02<#")P  w0cP020W 02""P  e0cP0Xʘ20W 0I2""P/  S0cP0IX20 00W" P  A0cP020 00W" P  /0cP010gk[D{W{ 0x P~  0cP0ʈ10W 02`!"PL  0cP 0<10@W 0% Pa  0cP0Z00W 0K2 "P  0cP0ʸ0 W" 4 P  0cP0qt00 00W" sP  Ҽ l G ќ   t l  D  @0cP0_(00W 0P2< "KP  0cP0h00 00W" 9P  3P  00{kF{W{"00 r3030vx300#W""00 _H30@300#W""00 O300X#W""00 B20{kWk!00 520200"W">"00 %x200p20c0"W"!00 @20|0p"W""00 20200H"W"!00 1010$0"W"o!00 10a10100!W"Hu!00 `10:X10l0d!W"e!00 (1000!W"X"00 00000!W"AH!00 00300f0 W"8"00 00  ,  <  ̈́ | Ͱ ,   ͸ ͠ ̄ X L |  ˔ ̬ l D D @  @  ɼ 00 W"T!00 `P00FX00`00-htp00N0| W"!00 G00{kWk!00 7300#W""00 *30{kWk!00 P30uH0L#"ZH _H 0#"W"00 20{kWk!00 20{kWk!00 20S"00 }"00 d" \20A {{ PH  T@ i"00 d"00 _!00 Z!00 kkS!00 N"00 I"00 D!00 ?"00 :"00 5"00 0!00 kk)!00 $"00 0Sh !00 |0S1 !00 t0S !00 l0S !00 dP  ^0S !00 V0S !00 N@ !TD- ɸ Ʉ \ P Ȩ \ t Ȁ0S "00 70S !00 /0SO "00 '0S/ !00 0S "00 0S !00 0S !00 0S !00 0S !00 0S !00 0S) !00 0S  !00 0S w!00 0S o!00 0S g!00 0S _!00 0S W!00 0S~ O"00 0S G"00 0S ?!00 0S 7!00 0S /!00 0S '"00 0S !00 0#[D"zP !H H 0#"0SK!00 e0S !00 ]x30cp# v"00 R"00 M"00 H"00 C"00 >"00 9"00 4"00 /"00 *"00 %"00 H mH 2x""2l0 02L0 0 2,0 0@2 0 0\20 0820 0~20 0u10 0l1l0 0c"1L0 0ZL1,0 0QQ!00 P10 0DT,10 0;j10 02:0 @@0 %L0l0 0? ” p @ 0 D P 0 T x , 0 P ( h x X H 0P0 040p0 02X00 0|00 0`0 @@l0 s0 @@_0 100 0u,1P0 0,P1 @@@0 o!00 10 0!10 010 0xG2 @@(0 k82 @@X0 ^l2t0 0U20 0L+;R\0@-L @AQ MO!Q0P PP 0 0 QȠ\ 0;B{ 7G 0 Ѝ0;B Ѝ03Q Q 0A@@1 0^46 0b0X #6 !k(7(@{6F{7{   ;B Ѝ0VtU/ /P 0S $0S 0S P? @4@P//A-P08pP`& , R0( 4", 0R40G@BT@! V @D 8,0400G0, #@( (8/P840,0S00 40Q 0 @-P0 R 0 I H SpTPo @$ @ < ?40P R $ R  R S /0?0Op\>0U) 0PEt@T7p0pp@$>00Sv ~=0000CS 0S =007s@ Q=0 C0 0,0`S P?N?P?5 ?M h?Q?H?A?L ?J P ?C p ElB ?9?:?;?<?8?R?D?7 P?K ?B< ; ?O ?E?I?6?F ?? ?GX ʈP ;UT 0PEt@00SQ! Q6;7sD@D  0;=0(000q^ ^  T:PEt@ T*U#   0s 0 @p 13$0 [U ($ ,U 0PEt03>0@\,( @Dʈ+7~M<2q@D0 D0B$0Sp0  0p2@0V'8<#0#w[ 202HL0  200@S2D0x pn 0S 3q0P0;T02@D0 C@3q@D07s0D@C s P7l0{1r0ರ^l[PEt@[UwR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0tP `40s (CP @n 40d@ 0p040H 700p_40R4l 0X[qPEt@[kU 0C00Sq 0 000(1 T*U $((U_ PEt1岐@^ Ԃ 7sQ0D7{D @C7s0D@CqCD6L0$ R'400  0r@6p0> 0sp0@+JP7s@DZ 0ಷ@D'q@p6l0 00` 0 0P00p0P0 Xtp0(0$P$(00 70( 'r0R0S(07@D0SR: @3 0@|0-8@0F(80v 0s \ p T d \ h tP 80C pC90S800p@-@VPP80S ($03/$0(3/00pPA-@`>PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  'P00S  E B0S  00?>?RP 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0NP0,40p0 x0 0 0 30 Ѝ0l0S  pl0@@@  @?S??P 0S $0S 0S P?,A4 BR/ Q /@o/?AA-PXPx@ 0!(`3/PPu 8pWG  ( 0(3/pP00@c  Q 0  \!P S>0R:oRS B P T  B T p W0Bp3  (08#8pPp  BS>00p000@ Q 0  \ tP S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-PM@ @㬰(0U 0C0 0$SQ $Cp0`0 sRpW($0p  p0 Ѝ0` R`V40sDJB 0|=J^S30 b6 0s0^0U 0 CP0S 0SCUP!( P 0, ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 280%R00S02000@04000408@0D?o2<0,000 0 0 0C$0 0R0pP0 R`0ࠃ40Nࠑ@00t000(@<90C1@ R@P00F3 0S $Q Br R$AVJ  ` V$  \ F C 0 Y( V F(*Q BR  BRW < Q  R^8 %Q  RX,  BB!   S @1P ,01( 0 (08 $ 0 00 40V@30O-pX04M3 00C PU?PU@PUAP0UAPR@oPP 0C R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 00 0  0#400 0 `0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000. R0f9S H0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH 0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 D R}0ES IS= [S8 gS8 40S0CkWi D8 RC0SS@ S   00#  #800#"0   n ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0u0S 000#400q00]0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S/t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&s0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0<00S=p#  #800#"0 00]`B 070c*W6F &R< \ R80l0 C;0,0|T 0 00 0000 B 0L0DC0C t0S*l0\06\0l S 8 B0 l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC 060@! Rppp@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ 2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&`Ī-M 0 BЍA-P?PUPr0 `0@ 0S  00 0t!(3/@PU \!@ 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 x, @@ sL DD n&!i0 0C006& 0&;> 0$0;/ $O-Q$M R0   0S "r ! "0o P@pLß 0@$0*  ")z0 (ay0qx0t0@Ar0 ! P1:SuPQ`&9SuPQp'8SuPQP+P5S>3s0uP1@$ " "@QP0@R P \!R!!P! \  ++ +P ! @$ @$ $PD!" ,!$Q"0S 4X @RPR@$t@a@R &P%uPQL T%$pAR%D$ pQR$T% pAR%D$ paR$d& pQ@R&T%@$t@\%  C R  00#s01^ #$ЍT 0o""1CBQ) @pm  P C-PRp ` P  0!\0 0#@B .P@18R0  C @$' C-PRp ` P  0!\0 0#@B .P@18R0  C @$' @-@Plp`hPp@` 0!ȑQ0 0#B   H @-@Plp`hPp@` 0!ȑQ0 0#B   p@-P04`^00# @L P%!p G-pR'wph Q RO SRCW-o`VA0A0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcV V-2Q0 pGN0 Q"R 0pP1W1|G.7&c2pG0N 1pW|GpG1^NNQV=F10C>@AP  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0A0C 00 pP80'7b"c2pGNq%R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/ HlU/0S0`0//\ P466@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-DM PX%@QX 0F  u pGjP0P4 \AB\S 1vσ p P Q-0[P4尐&G B&Sp  @  ipWPQ=00ද0 K`{P0: `;VT`+0I AX{T4T+ pQ}Qp0W20|q~6x `00[0` IT$P0>0 0@00 0p0 S[0 ⵟ0  !  W X SA ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00U0 0S@\ R @02^02N00 R0@\DЍW@  yP 01LX 1R 6 G2#6pP^p N j p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MVPPR@ʀk` W !.⾐ἠ i5Rs0( P000P#406IP0cZ3s0V⾐5s0iS0P⸠P0%TPVIPeQq BYr 漖P9s0000P#406cR!0C 6Vj VPT@Q p` 0F?oR20S RV0XW R+}~ʲᰐpj5WPs0pPJs000p0#40vPpgYww0 UVA5Pps0k.00P0p#406VPcQ 0C6PT@ Ѝ Br 9 kV0& PPQ^`徠἖0`j9Ys0`J 0 00#4 0编0iQq0  R0἖`g)0 6b궐pi5Zs0P000P#406I0cW3s0 Y㼖P Ap9s0k.00P0p#406VPcQ 0C6PP) P V# Br 5 yO-ʀ6knS㼖0M #P  #  # #  #  ! A@b9 Ts0@p000@p#406 B0c^~00἖&R @ P$ pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಐApi>Xs0000#406I0cWsw0 0@弖^ `D Br @n9 Ts0=@p000@p#406N0cR#r0&0R἖f b9 ^s0 @Pk`0`00@#4PP0 B0`Qq0 k0&Ѝ0἖=0἖9 8 ,  00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I, ( &&\A-@ k΀`P s0! Qr p p "$  aS2s Ak> ,u 0  u0#Ġ  <##4U0 0 B000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ M, R 0p&]P+&(+#0N  q/ ! R7@P j   Q&Q3 "[q6k S ;p3 s0000 #406 cPp 0Ck N.V6 0G. 0R0 0xS0   0LSZ=00IX  &&0 Ѝ  \ R+R +R ,RE R  Q ,_ R3 "&][Pj 0w ЍO R \3 "[k. Z0q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦|qk>0#40缦0j\3s0 J Z㼦syzk>0#40缦0j\3s0 J Z㼦T@|qk>0#40缦0j\3s JpM⼦k> / ! Zq ! 缦jR!r JPἦ L I  Q3 "[F@q:sy:s0:s0 r :s0]q#r 0  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  p@-@P`h0P `0P 5@T @˫000@pVp%@ paraydict@-M @PoЍŹ@oЍ@-M @PЍ趹@崹@Ѝ@-M @PoЍ襹@oЍ@-M @PЍ薹@唹@Ѝ@-Mp@P `P `Ѝ Bp@ .Ѝt0@.T `0p@-S P@0 C`%0@BT @pT 0 p0A-S Pp@0PC`j%0@vBT @80050p@-S P@0 C`0@ZBT @p 0 p0A-S Pp@0PC`0@>BT @00@- MP NBp 0S @p0@C%`BV ` Ѝ0 0 Ѝٸ Ѝ@- MP )Bp 0S @p0@CQ`AV ` Ѝ軸0 0 Ѝ贸 ЍA-Mp@P `P Ap@  . 0S P0 C@ AT@ Ѝ艸`Ѝ脸0`0Ѝ}0@-T` Ѝp@-@lP;0PPpdictp@-@`P/$0P p00pboolp@-P``@P  0@$p@-@>@{@-@8@@-@2@@-@,@@-@&@@-@ @@-@@@-@@@-@@)@-@@?@-@@O@-@@\@-@@i@-@@t@-@@@-@@@-@@@-@@@-@@@-@@p@-P`T@P  0@pp@-P`B@P   0@pp@-P`0@P  0@vpp@-P`@P  0@dpp@-P0`P @P  0@Ppp@-P`@P  0@>pp@-P`@P  0@,pp@-P`@P  0@pp@-P`@P  0@pp@-P0`P@P  x0@ pp@-P`@P  f0@ pp@-P`@P  T0@ pp@-P`@P  B0@ pp@-P`~@P  00@ pp@-P0`Pj@P  0@ pp@-P`X@P   0@ pp@-P`F@P  0@t pp@-P`4@P  0@b pp@-P`"@P  0@P pp@-P0`P@P  0@< pp@-PV@%(0P p0P 0pstngp@-P`@P  0@ pp@-P`@P  0@ pp@-`P!@ <P pP U pdatap@-P`r@P  b0@ pp@-P`@P  P0@ pA-P@ X0P p(`P  P `B+stngp@-P@ (0P pv0P 0pstngp@-P` @P  0@ pp@-P`@P  0@z p@-@R 0@p p@-@ PY $0P p00pboolp@-P`@P   0@N pp@-Pz@P  0@? p@-@^ @@-@X @@-@R @@-@L @@-@F @@-@@ @@-@: @@-@4 @-@-@. @D@-@( @Z@-@" @j@-@ @w@-@ @@-@ @@-@ @@-@ @@-@@@-@@@-@@@-@@p@-P`o@P   0@ pp@-P_@P B 0@ pp@-P`N@P  0@ pp@-P>@P ! 0@ pp@-P`-@P  0@s pp@-P@P  0@d pp@-P` @P  0@R pp@-P @P 0@C pp@-P0`P @P  0@/ pp@-P0P @P 0@ pp@-P` @P  ]0@ pp@-P @P 0@ pp@-P` @P  <0@ pp@-P @P w0@ pp@-P` @P  0@ pp@-Ps @P V0@ pp@-P`b @P  0@ pp@-PR @P 50@ pp@-P0`P? @P  0@ pp@-P0P, @P 0@s pp@-P`3 @P  0@a pp@-P# @P 0@R pp@-P` @P  0@@ pp@-P @P 0@1 pp@-P` @P  q0@ pp@-P @P 0@ pp@-P` @P  P0@ pp@-P @P 0@ pp@-P0`P @P  -0@ pp@-P0P @P e0@ pp@-P` @P   0@ pp@-Py @P D0@ pp@-P`h @P  0@ pp@-PX @P #0@ pp@-P`G @P  0@u pp@-P7 @P 0@f pp@-P`& @P  0@T pp@-P @P 0@E pp@-P0`P @P  0@1 pp@-P0P @P 0@ pp@-P>@ (0P p0P 0pstngp@-P`~@P  N0@pp@-Pn@P 0@pp@-P`c@P  .0@pp@-PS@P i0@pp@-`P@ <P pP U pdatap@-P`7@P  0@pp@-P`F@P  0@pp@-P@P 0@pp@-P%@P  0@qpA-P@Z X0P .p$`P  EP `&stngp@-Pr@< (0P p0P 0pstngp@-P`@P  0@0pp@-P@P 0@!pp@-P`@P  b0@pp@-P@P 0@p@-@Q 0@@-@R ?0@p@-@0 P s&q&p@PP0S p&0-\@-$@@$-VLP 0R @-P Q o// K K 0S p@-P`@`PPpoP p@xP ᳫ0 o@-0 > 4 T@-P Q @螫@ @0@ a0 )( (0( b0  4  Ƞ 8  0  @-0<  d  mA-P`p s#@P `P `ppP`   % `%%,T*@- ?#@P $0 0 0 SHA-pP ,#@P" z0 0 0 P#`P  ` P0 000 ,0X ◭@R | < @-@P Ρ@ xi-A-M pW $P0 P>@P"`P  0P}> ZЍAЍ/ЍAЍ/ 0 0t U t H E@-@P @ 6'p@-@P x0 00R0 P"0P Q  p@JppQ Ep@-@P `0 00R P"0P Q  p@pP EXP/0 00R /PP/<0 00R0/P///O D0P @-od  QP  QQ y/O| DXP/ 0 00R/O@-@P \0 00R  "0P Q P00N CP/00 00RP///NT CdA-PPM /o000"P R Ѝ R0 p 0 p!`P 0 S  R H  u= pP` $  00N  Bt BhA-@PM 0 00R ЍQP 0 o 0p!`P 0S d P >= pP` #000( (0( $0 M  A <$|+ P -/o<0"00^ R  R/LP/D0 00R /@-P FoK @P/D0 00R /@-P /oKX @LP /ol000"\ R RP Q  Q  /J ? ?fP 40 00RP /Jl ?xfA-$0`SM"P@U Ѝ P0rP  pP 00  0dP S $# @P d0 0 0 @Ѝ4 PSP  0ItL0 //p@-PQ& @R 0Q: Pp " P  `0` `0 L0L L0 808 80 p p P 0p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ PpJp@-@<PEPp/>P Q 7P Q>/P p@ ) 0p@-SP` @ 0S P@p<P QQ P/P >P p@ p@-\@<@P(@Q Pp$pP p@  \$@-@P@@-t@P  pP 0,0 0!@!A-PQ`@  + 0 S S C\P 0 S S C^\<S>0S: !S#0-S50F?o2-P0S-0S'S% -S0 -S0>S  0/S^ p(p 0 S S0` ` S S /S >S S 0 S S0FU0 RrP0/SZ 0$00>S] S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p 0 0 2 S =S`B`0"S0S  0"R "R RW0$00>S` 0   0C  >Rr0 P\ @-Q R$P <PG &P@aT lT gT, qTuPoP tP;P"tP @mT pToPsP;P';P<tP;P>@pT@;TS0S/Q /@- qoO-\1MM0(@P00 p$0`, 0$ 0 0[ Q` $ 0`;/0 `NP Mߍ qP 03/P 00  $ 0:/P 000 &PMߍV|G-@,PPM DaDqD`p@0 S S   CQ R@<S7  wUP#   qUP   kUP)0 SS -S0  -S0>S  00 >SS @S @@P@A-`RMaPPp2 0S/ @0U  UT 0/P B 0CU/PU  U0 0 B/Q `!0C@T@!  ;@04D.< 0ٛ  R0* 0 0/yp@  1V ֩P13ЩPۍ˩?00ǩ00S01p &2`$2D1p 11pP@C-`MP@PO ,x1p`F 2pF 0pE eS>#0 `弇00p1p)  !0 0娇p# 000Ѝ0 `嘇00L1p  Ѝ@=1z2@-@ o2@@-eP 0 0 ͦ XdO-IMP p @Tl p ` Y 9/0 pPS @T[ 0 R 2/0beF P003/Y@ 9/T >eT T @T@A 0SM 03/P Y 9/%e0S, @0 R 2/0)e( P Y 9/Z3 0 03/Iߍ 0 0 S 0 0 J 0 0C/A 0 0C/8 0 |0C//l l0l B0C/& |E XX; 44   dp@-P@PP  P $0SP  R Pp`]oP P YPP ( P LP0/O-@MM(p yT 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 08P 0 $ \00 Mߍ R00 0 0K/h l 0/0/@-@@ P 00#  R0SSQ///@->@ ZTp@-!@(MP  Pl  C6```rP(ЍpP (Ѝp  +6 $@-@⋤@-$@@0p@-M`P>@0 @ 0Qs*0 00 Ѝp(0"Sp@-M@`P0 Ppq 0 00 Ѝp 0"SA-P``=@P (pP Q$@P EnW@(0( (0 h.P T0P S0 P \0/S 0 P */\03#//2P S0 P \0/S 0 P */\03#//0@- P@M @ cЍ00@- P@M @ WЍ00@- P@M  @ IЍ00@- P@M  @ ;Ѝ0@-@P ,0 00R+ /P/0 00R /2S!Q  P*0  S */@/0 SR* R0:/ /+P $0 00R //*P $0 00R //*P $0 00R //*XP $0 00R //* P/`0 00R /2 S0  P *s00/S :)P/`0 00R /2 S0 P *s00/ S :)tP/\0 00R /"0R 0S/ /R0:)P/\0 00R /"0R 0S/ /R0:(P/D0 00R /2 S0 /R( P/\0 00R /"0R 0S/ /R0:'P/`0 00R /2 S0  P *s00/S :'XP/`0 00R /2 S0 P *s00/ S :&P/\0 00R /"0R 0S/ /R0:&pP/D0 00R /2 S0 /R&P/80 00R /! S *s00/%P/80 00R /!S *s00/%\P/00 00R /!R0/%P/00 00R /!R0/$P/@0 00R /2 S0R /$P/00 00R /!R0/$4P/80 00R /! S *s00/#P/80 00R /!S *s00/#P/00 00R /!R0/#XP/@0 00R /2 S0R /# P -/o<0"00^ R  R'/"P/P\ /QQP/Z"dP/P\ /QQP/Z"P/P\ /PQRQ\/!P/P\ /PQRQ\/!8p@-M0 P000 00S Ѝp$0@S `0-S 0S0xS P T P OЍp)PPӌAo/A-PP uP`p @N@P@@F@P p4_0,p0P4080<0 @-@  4@-(@@ @  @-@<@9O-4@T `,@@D¤@`T PpQㅑ PZ PPZ P0 0 hш ќz @-R 0P< P 4Q ,  D D0D @0 A0 000 0 8 08c dp@-@M4 00R;SP,0 S R' 1`V8 P` 0 0P 40, 0C40P0 A`ЍpS 0 0D ЍpЍpR t t0t 0D \ \0\ X0D ۟H H0H a0D ҟ дa 4ϐ Рlq tАHA-@`,pPPP W 0 !,P0`z,P0`G-@P M`P c 00pЍ!0 P (0S0 젟0 P (0S$pW00  0uP 0S  pyP  sP X p0 P ( (0( $0\ Kͼ  XΈ,K 0  @-0 : p@-@P l0`0VPP H H0 0 F0@S0<  ppD|0 0  @-0  T͐$0p@-S `  Q P@0@p 0  0  ˠ{p@-0S h`@`P0PpP p@K 0  0 Þ 8̸ 4 @-R 0, B4 P @@ @0@ <0B/⩞, ,0, (0B/⠞ hʤ ʀp@-@PP70S ,  Q <0 0 p@(=O-`p@ 40SK P@ 4P /P 00S 0Q 匑 # 00R&P P [G P \P P 0  03/P PP 0 S O 00CS 0 0PS Ph@T T0T P0J/@ @0@ <0R/X @ < D@-@u0,S<SSPG-Z p`0VWV@P/ 404 S"S` R000,0 100,0$ 100, ,0P ?o! 0 2\0S! ` F DP : < :404 SS` 0 .4 40S0SP``D D0D }0.p, ,0, (0.g4  Ŝ tsG-PP' 0 0R" 4fpP 40S @,0aᄡ1 f d,0`儡40@T:8 408  p0P 4  Q@-P80080/$p@-@P 80080p@ p@-@P 80 0R@ pP 4@ pp@-@P \0 0R@ pP` 00S@#: p@Xp@-@P~ @y pA-PP 0 0R4 p`i 40S @40S ,0 P@X `R A-@P 0`0VpPC 0S P @T @ @0@ <0R/≜@+ @ P$A-PP /o0`0"Q@@T 00R p  @P @T  @ 0  0R/NT d(8O-@PM h3P 0R @Ѝ4 00R80`  pP @KPZ@ ЍВ  : ⳚpP0 3 2 004QY +4 R] ,剱1Q  e P 0YId  B B!h,0 p 04 P<0 04 <0  p,WC<WEW+DY& 堡 0 yp  _pP 0,S<SS5 yP@ ,0pP<04 0<0x ᑚYp ,< !,0p 0 0^/|gd d0d U0c/rL L0L H0^/i ɴ D   G-@S ` VP p P { y00s0 G 0 0i/+ ~0P -?o@2 ^0S 00 S/ @-PP M @1 0R Ѝ`@ 80  Ѝ@  `0P 4 Rp@ Q(*, S1 B!]400C40<00<0  h h0h d0s/˚T T0T P0s/š@ @0@ <0s/⹚ }X,H }4J }XI P/?o0 2 R0S/00 S/0P -?o82 ^0S 0 S"/P/0 000R/P/0 000R/T P -/o<0"000^ R  R/p@-PN@P #P 0 03/P 4P @PpJ@pA-`P @PEpP $0Sp0P  pAtRp@-P@P U 7PP p_0@Z@Pp@-@P 0@ \@-@0P P 0R R@-P0S /7co/808 80 ࿙$0$ $0 ෙ { zO- 0S7 @`P. X0tqPpeP 0 _P  YP X0UUUB!#1<00@.B,? GP@HPOX% XP0@#r 140S ,0AT 5p@p@ 0  0O/‒ ^4`RA-@P 0P 0R@ p`8040S !,0X <0, 0Q<0@@|@D D0D @0S/B0 000 0S/9 ]h ]|Dp@-@P H0 0R@ pP`N@pA-@P1 0RP`4P%80,0!qW&  P  1P ,0P < 0@ 40< AAD D0D @0W/ۑ0 000 ,0W/ґ` \4 \|0P -?o82 ^0S 0 SQ/p@-P@P P 0 03/P P @pb @pp@-`P pP@P $0S p@lp@-P@P  PP 6 pÓ0@/ 뾓@Pp@-@P I0@oH011/A-\@`pP \"1S 0 €  P 1P1 `p P 0808 8B0 !$0$ $A0  Z\$ Z<@-@^ P ^%QRS  T00NQRS"  TŒ 00 0 Z0 ِ Y@G-@R00QP(M P 0 ` p Pl `o0T?o20S00(Ѝp`0 80 2/ / /    Q /0 2/ / /    P /0     Q /0     P /p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0W P0V00(Ѝp@ R 0S V0080Q000 00/@-@^p00T000O@-@T @-@T000 000S/@-Hp000 000S/@-p000 000S/@-p000 000S/@-p000 000S/@-БHp000 000S/@-p000 000S/@-㰑p000 000S/@-㠑p000 000S/@-㐑Hp000 000S/@-】p @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#( 0 01/001/0 01/d0S@-@1/00/p@-P0P0 0@0PS` Pp5p Tp/@--@-000 000S/@-pAo//0@-p@P M 4 PZ Ѝ0 0 ;0 ΎtvH PL@-p@M L BP pЍ(0( (;0 ౎@tw Pd0@-pP@ M T T T ǐ 0 Ѝ04 @ Ѝ0 0 :0 t0 Op@-@ @ $ 0 80 r t^ OPp@-@PP (P$Pp0 70 ] O8 p@-@PP (Pp0 70 J Np@-@PP $Pp0 70 7` N@-@P  Y.<+ < 00 ;0  NT@-@P ( 0 70 ( Nl@-@P $ 0 70 $\ MLR/-ptx` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@g P//-ptx` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@P=80 0 @  0""048# /UUUU3333  ip@-PQ@y : S P Sd0 V Sb0?0 r-w - 0!= S [ 7SJ @Sx00 r-w-0  R< R7 Rx 0 r-w-@!@ T. T( T0 T x :0pRs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- H0H H09 : S}A0a0-0~ɼ H<O-8AP@:  pPA /PA  `pP% 00 ` 0@T' 9P0=S AP` AT BX !  D0D D>0 1 V00L FC-@``"`2`M 0P$DT@Pg p`XP `@\@h@d@l@Xpk p p` o{{o{$P  {p[ p0 0S08@R0<@@@@40040,4--0-늉L1L0 00D000Qᘉ,X  #0S p800 0M0Ѝ1܄.O-MD@؃ [0`P@HpD:VL U0DPW p T"S 000@0`Ѝ0000 0L0|@֋0S ы00̋000S$0S Q .:[ 0:0SV00Ѝ0 K0 V0 M0 zW00 Q0:[00:S0S @ "00@ "00~\ NQ0 0 ȼhlld,l8kkpk\lPjjTk$jLj8j (jk (Xjit@-@P @ 0 /0 j| 'j@-@P @(0( (/0 @jX '<jl@-@-\ \ \  0P01 0  0 0 R$s 1 0R L^0 s 1# 0^؅00҅T00$0$ $0 nj$ &ii0 %i4G-P @p0#03w0q0W`@DT@!  ଄ 0R ! 0 0P   GM0@ pQP@-pp M P@P `P# +{0 @p{0 PP  Ѝf00Pa0`PY`V0P`PP|t0 0 X)X-0   X&)$p@-@PP` /o"0p@ ^J0 40 f #Hf@-@P 0@ IJ 0  A0 ڂ "fhfpp@-@PP /o"p@; 0J0 60 ‚f "f0@-@PM 0 0ITPЍ0 00 ূe "De0 !p@-@PP U ڧz00QUPQzp z00QUPz00Q0 /0 xd !e`1R ! /A-pR P@a@T T 1 !03/pWG /p@-@PT 0p@/pA-`Qp@P RP 0开D00p 00$`,@(P0RV00A-P`pd@PB 0U0" V W- p`Pp`PP, 0 0 00㼀@$P,`(pD 0W pPpPV W lpl`p``PPX``P`PP`P 00v|dXp@-@PPM& U 0`1S ,0S $0S  FpЍp@0@ @<0 ࣁ(0( (;0 bX Db,ah  b@-@P 0S$ y0 P @0P 0 0001 1 00y404 4<0 iꑃ 0 ` datp@-@PP% U 0`1S ,0S z$0S s\Ipp@0@ @90 6(0( (80 -` `_ |`p@-@P 0y00CS00 P.ypG@P0 70 _ `0--M  =HЍ Ѝ/ -- M0 0G ЍЍ/0@-0P$M R P0@S&  S$t0  B!  0 $Ѝ00t L000 u0 PS@$  \h_T_ [P 4000S$/00//[^[t^C-SRPQ  PICP@80X D,0( p `h6P000pp P@P!  Pd 00S! 0=S0`S"`V`X`V `ሀ}gP~0#S ZPU (000C00p~@p P@5P~@( 6Pp P4ބP 4  $k $k 0S000C00  0PP400pd$h`0 Z yp  Fqp0X0H@45PP}~0H SPڶ5 ,0pC b0P[U 0Pq0S S PDp  P @d=] t@(=^- $MT00  4 (0 0 0 30$ЍZ$0-|| $MP00  >4 (0 0 0 30$Ѝ4$@O-p PP`~  Bw0@00 00Bq PaBQWBABQ7B R0 S< 0A0CSF 0 #S2--00 D0S0R0S? R0 *@D T T@0 T:0 0 }v0p D0 00 0 v@0TD0[0S [?0:d0d d`0 v0D0D D C0yv v> >8>h == |==` X=l G-t1@0P?  @RP>T !6*PP000 0F0 r  p0 0G- M砐 p@ e$UP'0G T09pPUo0 ;u0+ @P   U0 U t0PtTP t0@t@  nx p0 0 4 30܍ 0lPp x`|PxT0 - M Ѝ@-0 0dM@P0\00p` P .X P0 0 \0 30 dЍ0 000 0 Hro~~T H.4.LO-/? 0M@Q000 < 0SD T@@P 0\@ ?T P @`DPPX@*p@@$@``@n*g\ !4peq(p` eq'pd(PfQ }adP8`da!<`hda& g! `dl@( " .%pPm` ,* )g  g* gtp捈@$@x@f ,譊h%fQ(! PffQ%|` . Pj(]@$ a,(@jA!@jA$͌@e! j  "+&0p'`) "M)l. '/.e,$ e.d, e ! ]P P!*L  ( !$(*((**() ()H'p0p ))''p, pL `&" po&` o&p p`(da `+da&++`pn mg pdq0 *@* O*@,nA!@͌pnA$f!@ M$lnq fq,p?菠fq'f1/(`/"Ho"_! _%,p% (( P !d!,( 0P "! ;!`$dQ  P%P- n (]d,b!On"@!O O$$@ $@  ͌O(e"nA 韠@ )..))),le,O@( /aA,e!@$`_@a! P " _%_% ,_%,,0_%MPh _aQ)_%(!!-_%$dA_%%Ph$_P+❉bQ$齋i P%0韃h P菃b  )]O坉$(((O$O$O$@kA b@$ @/(/"(/" , eQ( (/k% (/k!Mi%_䍈 o%dA_%_%i!$ "_% $o&& o PhQ$iaP%Po&o&0*o&-*`&$ha 矃`&]bA `(m@$heQ b%O)@@,捈?b1/"''p . p/".p /"$M/"(  h / f%  &h1f1 ?0dQhQd10_fQ``1d1`QP0Hp?h1P0m?#,,p?# ]?#?#0,0n1`1nqp?d1Ϡp,(0@!?!$,,,0fnLf}`efe獈n@gegf(@!!!0@, ,!hghA@e@H`,P!,_,!!!`h`M PgnQ`Qn_͌hQ dQnQdq p_`QLp P++,P   $lQ dQl_nQ_._%_%P0P}.`.aQ.lQaa `_dQgAaA`gQPOmlA(P`AgA` OaAO!O$O$!]!!f`$f͌菂g''( (''eqfq(e `qlqeqlፈ,fqaalaaqpoea`0p_/l!%)_% ''(0_%_%|Ÿ)'0'韌 +4$0 + h1a10h 0m`0韌h! a " =f 韌h! -c1f#韌( 蟠 )((,돌)돌$))ppfqb1#o0#0&a''ppꯌo&bqb!! "= `!-!c1``#O @ b1# 韌0#abb!!(p뿌0 "= `!-!o&c1`q `#  b1# 0#abAb!!_0 "=P `!,p!-c1ό``# }Zyn롏bl 4 b1# 0#0 ao&bpb!! "0= `!-!oc1`a`# 8P͌ < @@nDPbb!# "`0 0m0 `0 0 30Ѝ1!0 m 0S(1(!(0 m @-@P 0LL LHH  004 404 0 mgE#ͫ2Tv |A-PPp`8 W, 100.!0% "0 ?0%0?S@@h nb0hV@Hp` X0V@@p`F AnH H0H 0 m, ,0, 0 zm d$p <Hp@-!1 0MPP0 00@A TJ R00 113R0 0~? S ``4` 0~? S |U PE0"0 1<3R0 |0 0 0 30Ѝpd d0d `0( mTH H0H D0( m8j li 0 ͘0@- 0 0M@P000P( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)PP000 0F0 lh (h\ ̔G- MM砐 p@(e,UP'0H T0:APUo0 ;u0+ @P   U0 U n0PnTP n0@n@  m x0 0 5 30܍Ѝ 0XfPzPp p`|Pygf0 - M Ѝ@-0 0lM@P0d00p` P" +X P0 0 d0 30 lЍ0 000 0 lAee |00 {,!0 { / gE#ͫ2TvO-tM, l 03?0\ 0 Pp (0 " 40*i (0 8` h;" 0#0<8i;b iˌ! @D`ah`#h,bhD͠lbˌ Pb+`c! . `P% PH`b,`+` ak,`&iKL` c c;lk"`&0P`;a;abk `&T`lhlˆ`k#`& X`ɠbˌb+ck! `& \`b)`+` ak,`&``c c;lk"`&0d`c=a;ah`e\bhl@` `@$e{@bk `&h`llˆL`Kbhl` `.i pp'`#. 0dkŒȌ̌iˌ pzhlpbb+j{c!, `/&hl̠L`ˌak. `ak&` p@c nk,`nk&c0c=da;lk `lk&aa4n`k#``k&nXlck!`ck&lT`bhl`kk`Hʠi`ˌeka. a)` 8p'⢘⋜搉e pxd[f{l c P(n[,Pn[%c 0\PRX\Pd[@踠jp '<SNzmv3he;#0T0 0g;)0隠l c{0P $h{cp0fa"a(f `hHekb.b(e P]@a[n&an( h4bf%bf! Lp `$ 8q8pPU` Q``$0` (`H`0PPP#P<`8``$0`(`/`0P PP 0d"``lЍlЍ'G(0( (H0 TcB@ P@- M`_]tqt1pP@P`@@T 0Q P Ѝ$ D]P @ Ѝ@ 8]P"0S- -S?@0 0000 P  U RP +R@@D!0DSX ]P0S +S!@?@!@pA/|GX ?P L0P00 1 R/@P/!R/@h(0 @>R0 00//?@-M Pp @d`P`W0D>S 0!3100 0dЍ>SD 0!3100d00d00?/-p@-MdP@U@0 ` ` bPx0x 08 R;0Ѝp@Ѝ/0 a0:( ( D>   A-@PP`pU =UB 8X ERR14/.-,+*)('&%$#" Vp&2!0` 0`00+XPp -X% =X00+0E0VpPpp-0V0\0+00+0`0p@00,0, ,]0 a00  p@-PP@`  0RuSpWSRX0CSG5 +p à 0R ^ PSPQP^  0    T0 0+S -Sp0$ $0$ b0 ma@I L$O-0xSpLM 08@ (`(0,00040F >0 0uc @ ] nc@T8 P0p000003  0a0GS] SJ$00+W@ 0-S[=W000 0` @X B R j b\S  "=W  R"   P:0$Pb @  b R$ "@P0 偡   n Y# @ T:$Pbp@  b0S$0 @"@DP@ @T X 00X  0  0pW ,Wsp`TS `! Z0$Pb ` $ b R$ `"`FP`0 `偡   ` =W +0G?oY20S# Z$Pb` $g xb0S$0 `""`FP` `傡V X 00 00X00` `Z$P\b` C Tb0St$0 `""`FP` `傡 0T0 00  HR;I?I00 HR 0P01 P1 00S.p P 081 00S:0 Ѝ_0 @00S_@ ЍWt t0t  0W]XIL L0L  0I]0;+pΘ H$` l(@-`APP@ MG P1p0S'@1@T0 `0`S$ @0SV+ 000S"P>_0S/  Bp  Ѝ0@T0S "_00h\0 0 L L0L H0 \y)p T ڈPG-`PPHM6 p 0 p@ qp@ HЍ P 0 p Zp@ <HЍ^0S @XH0H H>0 \*A0P R7@D LO-P4MP@\p{ W?X0S2 `00 S 5 000 0?!S5 0 0 0;!WgW0c Ya X00U|5Sx50 0 0 0 0@0` P(0`0t 5`0$0XDP 0S90`lW ,A0` XW00V0SP@ ,(05#K 0P` X $ 2@0 @$*&  # $#. B@T$0#"A $1?Ϡ "!,:#  0`V4Ѝ3 00 0;!k3 0 0?!dp30$0H\.d0La#0L0|2pST0,@` P !WQ 0`V ^ @P,x ^[h"$:600%$0L"%>!!!0C4"0T,P%"1 #1O"QX00 0" 0$0 0?S%D P P@M`1T10&1! T$?01>! R01"_0`A(0|10X00`d(0X!X1X 9@ 0,[0@t`dP(0 4O  R(0@$Q5 0A`X0 0A$0PE `0P 0  `(`( 0 8@ 0Zy` zGG Q\(\) h؅SQ x 4ӼO-PP@`MN TV VA 0 <<T:R P* Ÿ PL P R# 0Qy SQЍR P P PP[@Q @| P @0 @0 T1T!TT0 Z@1@!@0 xZT$1$!$$0 nZ^ # ^ p0^p 0^ @0T^Pp# W @ 0|T@^*?[ ьh hh h@!]-p@-@PP U p@ILX X0X 0 ZU8 808 40 Zp@1L  ϨEG-P@U T^ Pp ppq W00"5gP: Pc 0Sb 0 R 0C ` PP0 XA V  0s0S0 0 Q 0  ! 0pW3*_oRe`VGP( U  !Z 0 0 YTt t0t p0 Y\ \0\ G 0Y[00P  ͸ d͐A-TT1 0MM@P040`P! R<  0s0S0 0@ $03/ 0 0 4 30/ۍЍQp夀0p$p 04YU0 x0,Yp p0p G0 #YT T0T 40$ Y@( l̰C̀E H  <O-Ɵ MMMčƟP p`TD$01 W: 0SC UL X 㰰[U04U@@ R R00C?o2 00⃰0S U0 S0E0 0S0000ShX- 0+0G 0@ 03/0Sp 0@@5$ 0000,00F$0(@03/P   0S00 *  0.S @ T0S0V:0S 0S  ,P8 * R P $0DQ/ 310 D1 0 (0"P00 0S  0P(80: S$X 0S 0   00s0S0 P@T  0s0S0TZ04/P9 0608 # $2 MލЍLf00m0  0B y 0.Sv0Sa 0. Sp] Rv  @p 03/0  000.SI X P 0 DP8 @p  2/0!1 , 0W!1 , 0WW!1 0, W0S!1 , 0WUp!p1p l, 0WX PY0SP PP9,!,1, (4 0W:I 0@ 03/Y0SQ 0HQ<Y0/(0 0@  03/0qHH0l *( d yƌ yd ylƸ8 y<Ɣ yd xň/O-ß KMMPčP`pؔܤ9 UB WK YT \[ /\@ @ 0\/\0   V"2 0 4 30KލЍR_/\8T*P/00p/\Vd"d2d @ 0VUD"D2D @@ 0VW("(2( $@ 0VY " 2  @ 0V@Pp PJP 0   R  R 0T/S 0: S+ S 0 0 0 0 pX +0s0S0 0@ (03/0S0: SVl/80 R0P娰0P 0H eV0G  0_VX/8 0J vLÀ v dm uLn u”o tT,xSO-XşX5M$M 0PQ000` . @~\< 0  pH 0/SS;R/ 0B0 4ZS 0H*0; 6P4S 0 0CPR IR*0S0;R X @H p0\  0  *\2 |@\ ?\" [\!PI 0^N \@000XS 0H 0< S @ 0< 0@Ⲑ 0R  R QR Რ@  P+]@PU "2 0 0 30ۍ$Ѝ0@S D0\P ]\!PLm @Ÿ]P 0 p-P]^ ~0]P @ 0< 010t  0BW 0R S0BW 0R S@c 0Q 0{  00P1A0 %EY0 [0!P0@ E0 0 p3P0P0H*0 ;bP 0ꐀ@p@p0P xT0lX TS@S@Q ?** 4[-]( ! nhO-@PM`pM R T    D U^ @P}\ @\ [\ {\PU PE0\]\ \8(\PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S00 8(G 0}^S0CV  F B   xU  @ ]RR ]RR pPpp0PdP  \03TWjL0 D0+Tc8 808 $d 0!TU kd| k@X A-`QPM+ 0  0 S -0{S @ p0Q @{Q0 !P Ѝ0}S0S ЍA8 808 0p SV 0 j,HA-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ \R@ @R@ )\ L 0 RLލЍ$ $0$ | 0S@\ hp@-`P Pp@0T1@D 0CP@DP t000p 0  0 VS h00 S. *S8 ?0Cs\#S 0 P/0S /Q 0S 0 0/p@-@PPV 0S] "S "$ R6  CQ   0S- @ 00 CR S 00p\S 000#  00p0"S0@000 00 R\0ppH e p@-((1$a0QM`M0500 S ` 0 0 5 30/QލЍp, P00 @ 0 Y@p x PE_0 \\PD~04 P 0~hҼ e4hLѸ5C-0$eP`M 500S E@ p#S"]T0 FP$ 0S %P @ 0SBT0SЍt `p  0@S0 0 40  0Sx t刄刔p 0fS0fS 000#3R0 <$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 P 000#3R0 x# 000 P 000#3R0 (# 000 P( 000#3R05 " 000 0#S 20@ R@@aEP00Ѝ0 S Sd P 000#3R0 (" 0@00q P  {P4 000#3R0+ ! 0 00T 000#3R0 ! 000EtP ` 0@S0 @  ?P =QD 0P0 0 -P=Q 0 @00 D 0P0 0xT8|АX<@DhlDͬ8 _P| ^@p@-PP xMP c@PLPPP 00p( (0( I0 P4 ]<@-,@@Pr00ʌO-ȟ MȟP P`@ pUpVpWT 4 Hp00; [Z 9QU D(88 0 0 30Ѝ `s?0l0` Ⱘp 00X CD Ua 000 2c110 0 0p0S( A8  $0p Pp3R<000S[ )R000@"R@Z 0B R00p PZpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #Sy R BqQ #S I BqQ #S H BqQ #S G BqQ #S3 L BqQ #SN M BqQ #SD N BqQ #S: O BqQ #S3 D BqQ #S E BqQ #S F BqQ #S 0S:U 00S! R B  P `0000  00 F  SS0,Z *p0S jQ00 0aQW 0 e[ XQ000I@QQ@p, 0O @x  L# 00 0 #   2000s00"   2000s0000q2"_0 Nkp00,(@ ((@(@00,0cD  Pk0Sky[p+ON\P00X P_  Y P0`00y0`0 0SpCr X  pGmw0060 P0SpY003[ p0S0 P  Mp`00C0A  > p p pt[Q GkD8|X V`l@0<p0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF2pP QP ЍpA-P`? A@0S( A@Q0+pPpPP @,P  p0 @BAQA3M@ p0 p0 ,0, ,<0 MlLH RT p@-p`pP`P@T T0T0 R@@pcP00ሽ< A-P@P`@pz0S |@@A R"@`lN@7P00O0@YP@-  00 C-`4MP(I@P 0S|0V ! 1UpЍ ⭿0P;  =R6 0Q*G B&R&>$#"M = -  Rp㴀Y WꘀqvK　SБp0X{FHܠ  0Űdl$@p 0O-,,% BMM $ %u  %p 000 0000+ 0因P 40 40<P P@\ aP 0S l400#S \ RP 0S 444d0``\ CP 0S 4d0``\ 4P 0S 30   \ %0P 0S r30\ 0P 0S r`30X3PE0 +@;@3@0 0P`\ @P 0S /@PP[[ JIP200xS0xS0Se "P2 0 4 30BލЍlR@P\ Pq 0S @200#SF \ P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S }qH10\ v0P 0S pq10 ! 10P 0 $0000 0000HPhX NPx M(< L_ K4T Jot J$<op@-d@@0S P Hp@P@P 4OP ྼplp@-@P$ 0PP 4P PPLHP TPph`h`#PLp4 404 0 J,l GHDp@-@P$ 0PP 4P PPHP Pph`h`PLXp4 404 0 JD(k F`\0p@-\PP 4P sp<`<`P@*pd@Dj`@-@@Pp 00O-v,M@Pp0P 0SX 0SN p60` 0P U 0E   4600{0?SO Sm *S 00 *Q @S50*QMU 00  q*QA[SU \S0  0 @ TQ8 ,Ѝ?[ [2 *[ @[[3 \[0S @@0S /Sx .Sxv 0X q 0X/Sn.Z] Q  /Q =P } /P P,ЍQ /QT 400 000  ^[![00 $0 00 @   /S \S? S -RG S0 U@ ∀Ḱ0s0]S^$0 S w tm + 0Xm  0X/Sge @_U/200 0 /ZU0@  0s0U ∀Ḱ~^]^ \^  @S ^U@  ᲀ~^" @@  %0\ @! q  [Q @P1P!P0{ I0S010!0|0 I 0 @0`pC p 0U0   峠zZ  0 lP/ZY  /<Q /QT 000 0| @  ?x@0GP@-@ P J 0 Q 4Q?o2c8$p@-@lPEP XEP T00pT 00pJ 0 pO-0p M @Wp` P  10230Y ߍ襽PT 0 8pI  㙽P: [ ; 0` 0P P) @@ 0  "p@ 0 P0P S P RI ">0 "C 0 p@@J -R4֠O-0p M @p` P ᆿᄿ10230Y ߍ PT 0 pI  P: [ ; 0` 0P |P) @@ 0  p@ 0 P0P S P H ">0 "C 0 zp@I -RԌO-0p M @Gp` P 10230Y ߍ蛼PT 0 (pI  ㏼P: [ ; 0` 0P P) @@ 0  p@ 0 P0P S P HH ">0 "C 0 p@6I -R*xp@-T@0`P@ e0P0S SpP p 7xp@-T@0`P@ 0P0S SWP p 7p@-T@0`P@ =0P0S S>P p 60 00 Ϥ-H- M 0 S 0  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/p-H- M 0 S 0  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/]΄ -- M0 0+--M  --M  A-pPPp` Q @Q PD@L0 0000Ak$0$ $0 EP|xT 340P R   0//pO-X'X7 0LM@P0D00 8 P7f/0F0 0 A0S 0* R 0 :R|R PF@    x P P\BPuX00X0'4: wP & X00X0 $` `p<E$0 @(0Up$0 00Mp5$ 0,  Cp5$ 04 E @P)l 0 \5 0 L 'p$00% ,00  E @ 80p840$4 0< p40 p40 p40 ph40\ pD4$0P8 p 4$0T p3$0 3p0`0*S$ 0P3 3 3!t002p,t6p"t!,̠:p<#tp` t0448",#< Bp0@a@P8 <0@(p ' R E8 @0s@qTP?  A@=@9@5@1@qp (   hp$   ap $ R  , Vp ,$ApE JpE  P <E 0@1 00Q`BP#$#< \P00 1@'p0@$0t@5T0A1@00ͻt!0 0 D0 30LЍ p 41"0 $UAPX00X0!1 h0 D21dp([wxdTP|(THPl,@~~|<~`d~8~($~}}}8|, ȂVEWŬdz +tzp@-@P> 0S0 70@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT D08@@0/S(@@ @@LLLp=A-M@P7Pq0PpC D!0C `0 00   ! 0b0C S0;.-,+0)('0%,p`wE0 B0S@ 0S 0SdE0"S D8#Ѝ T1r0:TE00Ѝqv{p°| /@-@P1 0S* &7@T. 0T)  /Q0C T !@# *0P@/S x0 B@T@!h0 0D  T <@0@0@/SDII;T0{-DM  {000up 804S DЍp@-`P@*p' P@ >Op V U phUX p` }V@:vP?o?o 0C-@c^?c%^& ^ `pCc&Pc2681E270G2&0H 0./ "0;:(0C0 /0 @- /0, 0-;BP @@ 7[D0 0/E0E0C004 0-;BP{$@G{6[D0{7P/ E0E0C0!/0Q Poo G-@a^?a'^( ^ @pAa&`a43V4X4G0Y@000?!1?1>4!50;:(A100 /0 @- / k{0   ;B 0/AC0C0 [k{${@{7P/ AC0C0 JH@ @-Eq@ J=@ @-:q J@ @-q J@ @-qPP `@-C00?0/R//R/?0S/R/P/R/p@-PMP`V ÷@T 00BЍp{ : { !p@`($ & ( 00 R ˸d,@-C00 0S@*(0 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"QI$\)P A-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PBPX `4@ :PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍPP @@ @0(@$0||O-\ϟC 0C,0  !/"b!!A0,0 W0 0000 0YWP 0  R0( SP 0 00HWz 0AP(0PW%S(Pk6 ,0 6,0,0 v>C 0CWP0(Z 000"0W0QD6 0 0P( 0, ,04#/A!b!b0C P0( 4 0 Br0 S8P(P1W*p 50 ,P(W0 00W =0 P( WTWp ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0$0?2c1, 11,0 020 0000 0 ,, ,0 0CP0(J 00000 3 ,, p,0 0CWP0(000c c0 ,_P([(P000yW0T 00. 0 GP(1 u  RO 0s! `p0@@v0 @`   ` @aKal B  0 B0 V PKUS ZSP  @ 0,"P ( $0 0 R0Y R0P ,P\ !/#b!!0"A `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0,04 00N(0~0 S!0 @pAY_"pG@D  W@ 04 0N~ Q @(02P 0(P00D|\)P\( @  \Ql'I$d(ccnaMD  Q(PP @ ACLC|q \^JS S 00#3P0z z H/o"(PzXn|TQ(P7 pp@*CP(!B0pu10 B0,Pp> ( ' Pp#/"b!C;R, a2ba126MP P(P @ @0C2c2c2P$00( (0 00 @ 0 @Q ,0@0S} 00@y0S 0@r r,p0 0P P(00, 0C$0(^3000c^\0M0cP$`jP$`   0P  P(00 , 0Cq$00(06  p  0P( ,  #P ( (0 b$ 00 0M0ЍpA-!1 0xM@P0t00PT 0SA@0 S?xa`\`al!p0  ͸K/P3D! `p,`0 H 6/0 0UP@@ A<@ 0 0 t0 30#xЍ0圀 S``  %=T00!=0d0 00@ 1D x \Y  4YX PX}@-0M@ `0P s00Ѝ@-0M@o0P f00Ѝ-4Mc0P Y04Ѝxp@-PP1 00Mp0,00`@P4 U<    P00Q Q Q < 0 0 0 ,0 30#0Ѝp  x h`0` `:0 c:UD0D D;0 Y:,t,t,t? xVI PV|p@-@PP U 0DPp P @pD0D D70 3:U(0( (80 ):V VV UG-pP`' X/ Y +.V @P0PES  R  DV#0PEV R  SS0@0D@ D0D DH0 9X(0( (I0 9U8 U@UD UR@- 0BAs @Q 0CR :@O-阡PP p MU WC O6@PI u7PI  6p`M -4101S Yk7 Ѝ0p60P@W6P- 0 0P 260 0 :=00 :l0l lD0 n96;00808 8C0 ^9+7S SJ S8RQ@-M b@PЍTT m;@Ѝe; 00O--ഁ M Mpō@P`pH 1PS 5pK @\D LX0 ^00pt0 O000 T>79 q@0,  (@P . P 0 0 5 30ݍ Ѝh0h hD0 8:00@:00 9` dQD0   M Ѝx--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-鐒@P p`M X X00?0.00P @ P 00 P! !  81XP:  .VP W^ [[XPVppPp4W` D 0`f`0 `ᎭpPR P00D!D1 00U0 ЍЯ 1XP C0PP00 @0 Ѝ̰̀0 0 08W` 0 8`|0| |?0 8rDpP[ =pP `D\ NN; 0N(@-@ M/(0S2 ]-0 `0( `1/pwqP0)  0 0 PUR <0PU/ ЍPpTP 0S  0CP/900pP/@-P M/(0S: -0 "p0( p1/`vq@0/  0 0 @ToR <0@To/1`V ЍP`T@ 0S  0C@o9T00t/900m/p@-PPE 4A0S5 @Tp1 Rp00P0 ׮ P 0S P0ͮ 0c0(Ȯ 0P0 î0 S,P 4P 8P p@诮T0T T0M 70Sp000 0K0 7eEJ \JJ` ,Jhp@-@$PPxWp@5@r@- @@ڦuW@Ԧ5rxp@-,PPͦ X@Ʀp4rD@-a@P`M[ P10`00S p  0 XRp p 0@@SN @ W8 CR67,0L0 S0\^,*N^(^& N0 s0QW   "\ ^ #R.S @A a  00C ƒ@0@ЍD0D DF0 b6 "^ #R|H4 H84  R  *4 8/o 0X\S 040:8 R РS /hBx@-@`P,8LpL0ppD尀 $T   ⾊p>@-P`@080 WA-Dx`Pp@P1 T&  p0 SSS7 S300x S(u#g\*7'0 5p7p'p0 5X70000F00,00 00#R00 00;R c\&V Psd\ 1P01 0S1000S0d\ Q `60100 R =R% R 0 060000   70Bs0 00Bs0 20o00BQ00100C0e00BS0100C0U 0?X000 R00000L-X00B ^Xv00= 00 k 00Bs0$ 0W0Cs0 0 ' R R 00" 40000 Q O 00B70B s00 X00 K <$ 0W0Cs0;R 40000+ 00C 1 0HnS ponmlkjico[TQKwja[UNI%50#\X00S00o%0H?o2300k&0H?o24 00d=Hoᨂ% d 00[ S 101000 B 0M00J 0 0K 0 0F 0 0A\ 0 0< 0 0100. 0 0/ 0 0* 0 0% 0 0 0 0 0 0c\ad\z@0<00R00F `EE <E| $ HO-PR Mp@C W7 [`M 0`@0  0D\  S@C; 0  [* @0V0 00 0 !0/3500 Ѝ 0 /03 0 }/03 R R @T0F0500 R S@C0 0 3=` =`=  p=,<0  0{0y  ;BA-R@P0`Sp ""#b! DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@/"00@1003/P(!p0 $@ 0V0 p00 R (<P000P3/P" Up  R  SVp  0ST8P000U dd3>/d&`c&,%Ac %h%8=A-R@P 0`So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@!00@10 03/P(!p0 $@ g0V0 p00 R (㨧P00 0P3/P" Up   R  SVp 0S㤨P00 0U ba$a##?<`#"G-@P P;&`P (rp^u  0F0\c<!"#b!0CaqV; Y @/PpY` $00100S p !`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(P`0003/P 0 p 0000SXP00}00_3>/_!D^ ^p^X  l]=G-@P P%`P $rp ^t  0F0\c<!#b!b0CaqV; Y .PpY` $00100S p f `1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(bP`0003/P 0 p 000$0SiP0 $0~00]4\\,[[8[dSR: G-P0`00Sp 3/0Y @IOP q T 00 00 Y @IOP ^ T P00 D0D 0 p`P/0ZZpZ`Z$ZxSR; G-P0`00Sp 3/00 Y @IP ) T 00 00  Y @IP  T P00 D0D 0 p` P$/YYPY@YXXO-PPM M Q@ \ /\C VPy`$P8p/\ @ @. D\k `P /RR.\' B Rk/0  F0V1 P 0E PpE 0: S 9S0/\0Sw@/\` FQ .PQX 0t/S0W0MʨP !P uM $ \@  1+/\p@` @qލ Ѝ.<0X0/ލ Ѝ @1 X 0/ ?   P@Z100 @1>00 @1?00 @100 @100100p@-@P Q Pp`\P?0@P ᅺP`V 10"S p100p@p@-La P`M=  x#00QP0堤P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P 800  E1 0 @rT|SSp@-@P`P3 V( 0Pp:P @P0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 .(0( (0 .0 0#4 ۸000/p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 .U8 808 0 .p "D/ ڨ/O-ȟ M MDčpĝP 0f 0So 0SV t4!S S$XPP `P  㙣pP 00S `D R!' 70 00 ( Pg 0A0P0s` @ `PV 0 S( [T :SZ \S S S 0U:H̤PPE VpP+  P @0` S[1ZP#QQ ,P`600`SP0@VE0AX0 0p&6 0 D4 30bݍ Ѝ:SZ PPEV  00 0S mQ00@ pP: 2d5@00PS0 0085p0040$0(`,= Pv :SL 0@S t40@0 0$<PK0C 04 8 0S:S XE H R0 0  Q!000M P@04@@0') 0:S * 00UOPK0 E0 '10 S:S008$ 0S:S00< W3V`|\d pݐ0 00 S-H-M0 S0 00 0 0 0@  00^100M 0 @R0    R L00 報@ 00 0 0 30KH Ѝ/SSR4@-K0 @ @0$5O-`@$MP%l20pW^  0p0 u0?10KP Zp mP p J  0J0PH0 S#: K(% U10 r 1$4S1$ !t@00H H0S "<100S (!0 0 0 306 $Ѝ U r [pP Р {P 5SX0( ,VT00#    PH H0SR\|433TP; dˠ@-(@M@@0=PЍ1  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A@{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T >(P0 0# 00Ѝ 1(0Ѝ0-$M  00 0P$Ѝ0-$M  00 0P$Ѝ0 -M 00 0 Ѝ  0/C-LL sMPP`0 V8 @X0^00pAtA帕0O0PP P1{0p0>TA{ 0 $@9 0 0 1 30sߍd0d dG0 %VH0H HH0 % LDK   d 0   M ЍKO-ϟ MpPÍP0^ Yf 00!R !Z P   P0%%Z * 0S0 R 8/0? 0 3 30[ ߍP0  P 0C PS !000C 0 `0zS|NQ~|{pyxwvus1jhc_^\ `ZEU000 `0CP0 PE 0SF0 0C0000 000S0  IY r<P0  P 0P0CS0000 @ 0D SU*r? (0R0 (0 , 0C$00 40A@Qnt#zx 0 S0 00 1YK @@0 P 0C0@0@ @T  0SP 00 0@0 @0 0CP2 0S0 000$0 $0S0D =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SLP P000, 0@C0 H9T@!r?(0@0@ + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0r000@T@0TS XRm    0 (I 0     6 4   00 0@0( 0CP000&     ( S@ @& YʱY  P6P&P0 #Y464&40 "jPp _eP @0c\P P  0 S0 0C0 S P @00CS0K 0 S0  @$ 00S P40SZu 40AQ0Q 0Yk $ @00ESZ UP 0@0CS0W 0Y0 O @0ES$ PSZ R0 0@0CS0  0 S000S @+ D  @AQ X2 @ P 0@0CS0Z000 0XW $+D @@P 0 R0 @NTA 0Ti@@P[ 0 R0 $ @XQ[@@P  R @0 00Kř? 0r?(00Y D   00S0P0SY 00 00C@0@00<000WS0,` `01D00(0H@V< . P 0  B0=>J(  r"0  ߙp P p ݙp ؙ=>3PSx $0S0000PS`FP Z,`X@ $0S0 00 0000V0JJ p (  d x| T0 P 0 0C P0 SP 0^Z``,40+"Z`Iy @0&0,(0( =>0#C0,`-Ql ]QP @0c Q: ,`0;00<0000000900000 000:0090 00|0:0000s09000l 0  H  0 PB P>  +"7 $3P1000;000;0A00=jIT  , BR@ 0Z0 @$P 0 R0l @X<0#  R @#  R2XX  P BR@ $P$M 0 SJ 0iT nT  , BR@ 0Z0K @ R񏐷D" AR>  @ BR  0X0@ NR-  @ BR  0X0] $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0 S$@5*Y,Y0$ 0(0@T 0<050 (@* n00 500S @0SI 00 0!Z] <P 0@0CS0| 0 S0  @]0SHOP 0Z 0aFP 0Z 0 p00 00= 0#3P 0X 0@^@ =. #RRc @R  B   @ 00. @0=>03SS' 0@T0C0000@000 0SP @X A 00 000P@ 0 S= 0@@Q#P2 0 S/ 0@ PG 0 SD 0 0 ( T_0T0P0S 00CS@0 0 S000@00CS0400 0S0  @0 ሗ PW 0 40H0 B=>  @JB r0 6p= P p }P 0Y0C P 00S"0,p `0#  , BR@ t 0 R0l00 (@m00 CP Z 0@003,  ]R$ ZzPp80$0 0P80,  4`, rO<`T xP$0 0P(0080<$VPR 0 SO 0MP 0X 0$@3P= 0X: 0@PD 0 S@$P P; 9P 0 S1$1I/P 0Y 0$ @0P. 0S+ 0 @0$P P P 0Y 0@/X,` @ t,TP 0 ST @tZ( S C@ S  &oP 0 S 0 @0002bP $P @-  , BR@  0 R0"  ,$P&, W;P 0 S 0$@ /P 0 S |P 0S@!0@3ZS 0!P P 00 0Z  ` `d0$0H00 PK A=>0 $ C 0r⟕p5 P&ZP@DD 0S#T `Z 0 @+ @D00P0T0SJ0000rp0SP Y ` 0@00X_<0< <08 100CZP@D` A-@P`p-0 0@-@-@`P MDp@0p0 000@ Ѝ) A-,R@QP`Y v 200S5 0P1S010n L000Pv`! pW@0PJ ᆓPPZ 0 00  C `C0000  Q  Q*RQ0 <00@8 B`00 `0  P00P0s0 ÑP B/0 B0 `(8 \p@-@Pn {0@op@-0P$L`T M 0S pW  07/@P  Ѝ808 808 30pY@ Ѝ H0 00M 0Ѝ%A-0P$L`TpM 0S $X 0 8/@P Ѝ< <0< 0p 0$@ Ѝ `00 0M0Ѝ$A-0P$L`TpM 0S (X 0 8/@P Ѝ< <0< 0y, 0(@ Ѝ |00 0M0Ѝ#A-0P$L`TpM 0S 4X 0 8/@P Ѝ< <0< 0D 04@ Ѝ <00 0M0Ѝ"O-MD@`Zp@P] UK 0TS$Z0 0S- [* 0 ;/0S5 $\U 0S H[ 0 ;/@PЍ 0 0 -0H 0 0Jh !0G@Ѝ0$\d d0d 0[ 0D D0D }\ 0 0 `  PX@-$$@M vЍ @-0P$L`T M 0S 8pW  07/@P Ѝ< <0< 0 08p@ Ѝ $0 00M 0Ѝ03?0/@-@`pPtt0l尀 ᣬT  @0 ᣓ$ ␬ቩl!x0fO-ğM `@0  0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b ͑P  00Ds0S0S0 S  \00t0!#300@ 00@00 @0`PUb*Ѝ@\ M00 发P-  R^^? @ 0 `0  ጑P 0J ZS0 0 0J ZS,t1 0000 Ѝ0S0 01 0000s00\0`0\00 00 00Cs0S  ``a00\0`0b00\0`0t00\0`0n00\0`0v00\0`0f00\0`0}r00\0`0w0\  @`qq|A- Q@Pp`! 4P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0' P0 A DA-P@`ἐPp .T Tp!0D1(0D,TS0 pAl_T %(0$"0@ !1 6I O-ǟ WMT|ǟ@P ,pခ儡<  ?oY20S_Zg Yo y P0P 0 b`0P(0 [080{ 9@00 P0 $0{U6 `$p@00PU`" T U 1 #0ថ0P?0So PzP P6&0 >PU` 0倁`FFa VP1 P! Ls `⾎pP Р  400S  V L0 G0CPa  * T50 0  R  ' 050 0  R 00 00 00 "00@\0000 Ĕ U( `(PU$ 0p 9/P500᠏(垏 圏8嚏X$44 0 T1 30 Wߍ<0S@<@N(00(~ 0PS 0S0 $U `(0Dp0C 0P@ 0T 0- p004 L l6<p@_@@@P@T_@ @@ T*0P3<:@59p0 ? 0, 2P0 E0R$ "@὏[PpY`* @ 00S0Dp<00 SR00<0@( t ᛏPp]0 S2"0 54p@1!0 VZ1!0 LYPꨑ ) 0 L}p Ϗa 0S 0S& 'P DpU00㉍P+ 8{1!0 R~p200/ 0>0 0 - 000 z0 0p80D$d H dtPp $ ֨ րը ~հմ ~`ը ~p,@-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 ЍHp@-@QM`P0  0 `Ѝp0@-@RMP0 o 0( PvЍ0@-@M 0 00 eЍ-M $VЍ-M $(HЍ@-@ M00000h0 @ .D 80P @0 0 30 Ѝ! P @-@ M(0  0 0   @D <0P @0 0 30 ЍD  D0@-@QMP0  0 Ѝ0t0@-@RMP0  0$ PЍ00p@-@Q0P`0M  0  `Ѝp-M00  Ѝl-M( Ѝ8-M $$wЍ 0-$M  00R$Ѝ @0S@! 00(p 0S$ 0 0? $0S%*(p 0S @ @0@ <0 r $ u@hH t@-PP@`Mh Tq ,0PXPI00Pn0: S Sr  SЍP P :ꜟP d0p堟`PV\0 `\0`.S0@D`H08< 0L R:0L R68 <P\@ D^V0 0U :0Ѝ]0S \040.S 0 :0 Th h0h d0 Ѝp $p Ѝ rɼ r ɔA-pP`P% V. ,0 `@P0\X0.   0  0P$00R @P \0 00X0T T0T P0$ V8 808 40$ @ qhdh q<<@-`Q@M pp/  80<RP @0DRP 0P0V Ѝgpp ֞pP}0@ox@ЍdPPЍO-`P `$0P0P 000S@-@(v0(@vpA-`P@ p  䀟0 00S (vP   (v 0Sp qP   0S P(v0SPpМp0@-@PPM 0 P! P 0p@ @Ѝ00 SP0 <0 ~ >Xp@-T!T1 @0(MT0$00: 0PS` RT= 0ST@ 0 0 $0 303(Ѝp ;(0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@ETΈ = =dX0P @-DQ4*  .x0h0P@-X  S H@ @ 0( (@ `P8A-p`PpP@ U! T 0 F0PU 000\ LL0L L?0 U000 0@0 x< ;HD ; p@-@PP  p@$嬏 0 10 q :000S 0 00 9/`-  0  ^^$  00p$pANmppL A- p`W'0 FP@Ï@hC12c` P@ R0d0d 00 1HP@@T0`10 PoppN _nop@-HP@P u0S,000@ p@ unlnn `1&P #Qyt PFR'000  0 0!܀,UPP@P@ 06&```00A @Otl00A0A100H H0H 0 Dlklx 6Dkl@kTkk 5@-(@@ @&t0@!tjp@-@P PP P @p@p0 A0 t 4A-PPp` @P# P# tP  P@3*"00@004 404 V0 00@ 4sQ:// BQ://G-88!000s0S03 0p0Q= `AQ@PP 0 `Q ̀@P   0PR@ !{Tl@0@S {000  B BG!R`iddi(p@-@P P8PpU0 =Sp=SppLp@-@P PPP@Ppp@z 0 0 :g 1p@-Ptx@P 0 P0@pg\p@-@PP LPp P3#p$ $0$ 0 g, 0O-10  MZp @To p `P 'P0=S] @PT[^ A@ZP1Z04 S@@@S*Z3 nz 81 0   `߮0S:a  D!0 0 @ Ѝ0Z   RS@ `౮0S a1S  Ѝ PPPXp@- @t,PpP 000ppA-l`PP` p\@P 0=S SP(00@0H$,@-r@Pm0@c,@-r@P_0@c,@-r@PQ0@cH!00-!0!Q00 000000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1  p@ Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPO-P@U`pX 1S P@@E  7/P/@P@@ @@ģXC 1Q0000/ @0  0000Y @0S0@0 PT1S1 S Do  00000@ @@@@0@@ 00Q0 -"P 0 PC R00 SAP 0@/ p@-`P@T0h \ H RH  "   T0"g \ ` ``R```0000000000 0#0 0#0000``0000T ^pp@\R4 /o"!T0#00#00!01 000T p`^`  T 0V0pp@-Q  `T \ !O-p`=uP& 0Q@@PppW@Q0Jh `X  0PX@aao(Oo(0pG.wZ_TaB $000 D.@-W,@@0@P0S@_ M-`@P@_}P(p0@aa~o0Oo00ZO.TTaXPB(0( $0 0 8Lh0p@-05S PoP0SZ sX@ 0CR\op@T P UP@oX]XTX /p@-@P $PvP v$vP vp@v0 0 -y !yMp@-PP@ T $0p@! 0/L L0L 0 T, ,0, 0  !yXy` !hy`y4p@-@PM$ P$`0.IP  P pp(R00S 3/Ѝp003/( (0( Z0( x xHxTA-$P0@MSp p0(`0 0@0p$p^Pp0(0V,00S 3/@Ѝ 00,0(p03/?pP A-PP@M) T2 0S Ѝ $`0P v00 @ pP fЍ00pL L0L H0< QT0 000 ,0< F vXv` hvv4O-d`yM(p`t,PP } t@Po 2 n20 RF n0!$@ !  00T0 4L  00 0. $(p,`L PP 80 03/``LtP"   !0 0 1 302yߍ         PSoTuP PuNuP||PCoDu``P:oʪ08\ 8tt t4 tP00/Vt@- 0UM 0H`0L10;p! 0H1@ឈpP㞈0P`p  S 0$< ,0 0 L1 30Uߍ/Ulp@-`PP`@M& T. bbPЍp dfP aP  aP |0 0  PL0L LG0 T000 0H0  q q qO-@P(p,aP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV 8sP``bn@P V@0SZ V@St00 pG-`R p@P8/PP @VG-!1 0M@Q000`PQ UI U .00P!1 0 0 30ZЍ0) p00P 00 S00 0壇PP  0☇PP Ꮗ0PSUp!0T  ⌇Ptp0 pPp P{p 0 @P0 00aPPd/0 R  B   /0 R  B  /0 R  B   / B/0  Q B  /0 R % B   %3 %//Q0 /0 R  B   /0S :p@-@P0C0  00 0p/0p@-S@ :P0C0  00 0pp0 $000  / 00$0p@-PP@ T" cP 0S S pp@ caP p@aD0D D0 sT(0( (0 ik kk lk`p@-PP@ T bPp >p@ucH H0H X0 H, ,0, W0 > kj j@jp@-PP@' T Pp bP 0S S`P p@`p\ \0\ x0( @ @0@ w0( 0p@/  i iPip@-@PP U p@ bL L0L g0< U, ,0, h0< \hiD 0i\i0@-PP@ M T# ^`P Ѝ0FbP 0Sl00 ucP P0P 0L T0 000 0L  pghX Dhh,p@-PP@" T+ 0 0 0S p`P bP `P   `P p@`L L0L 0\ dT, ,0, 0\ Y dfgL 8gg G-PP@; TD  R R `V V  0L0 00 0 `V000 0`V 0| !0FS84/+' 0 0 0 I0l Tp堀 pl 0 R R 0h ` 00 00 0000 0L fTef< e% @-/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/p@-PQ@`0 V% T ^ 0S^  S 0RR00Ap@@Tpp@0@ @;0 p(0( (:0 gd0 dST cC- MpPÍ`@PO TW A< YPX [Y`T S0S h!`1 0 3 30Oߍ(#@@ R R  R P9 1 R    p0S 4% 0p 00 0 Tt0t tt0 P  ى 0 `c bh Pblbp (bDbxO-LLğIM,M IM$J͍$@@Pp P0`S S  #3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " " < J=00h#<0I8 0oJ=00|4 0 hP J- 0SJ=  0"I 0  \ {J- 0Sv r0S? S" UV J=00 O J=00bX> O<  XPf S0SQ L|0S 0S  0S0!S S0S UVJ= 0 0"R #< XS) S LJ͍0 F:01 00000G0 ,0vTP @}., 00SLP$ P P J=00X0  XPJ͍aP ( D`^ HO-\\ğ M@pQ4@0P0C`S,H6)('&%$#"! D QWX00 R04{ 0S SY^\#T3 0 0 30Ѝ4#(3 0 0 300 HD@pЍOQWX00RTVWX " 0 5 TX%: M 0 t" $pP5T30Sy0S D 0" PTVT00P00Sj!0 T@@O 00!0 piT 1i #Yyp`1``PP0 ppW 0@D    ɇT00? pYp} 0蠟谟 P0 pY 0@Dm    ᩇT00? D PTpyX  ģ[[|[LZZl,ZtulkYtYpY0G-` 0 FM# P@pp P PV  P V> t0@SW 0 0 1 300Fߍ0 0qp 00  0P Y0SX 0S fP 0 <WFDA-@P`p 0  0P Qp@-MP`P@@P@T 0S  R0S P4 @PЍpP,PЍpp@-@P pPpPp0 @0 1 U0. AASq0C .S .R Q P-S.S S /Q P_S /0@-S GRC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ R 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0S00@-d!$M 0 0 AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S R' 0S  0S0S0S/R /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PP0 PG@0S0S 0S  Ѝ0$0$ $n0 piX tP@-PP@p`M T Q Q Ѝ0SS ЍS 0  0DPPW0S S |  0p00S SH0 P 00 PLP$OL2p@-PP`@ V T! 0poPpx x0x t0 V\ \0\ X0 T@ @0@ <0 ON dNN 8)NO-Ÿ2MC `<0 0\P0  03/P 0`&<00&,SS00 80R0S~  RD(ՑU? [=:E$04,0@$0 C 0\@P0  03/P @?] 0P0:]`7]Vx80Sg UI &<00Sj&<00SD=!P` E/o0"SQ[Eo᪢R,0Si0DZ@0P@C<0D\; Z^7 @0C 00P3 0P00,00,0%SF @%4 0, 0 30ݍ4Ѝ\00&<00Sc &<00Se  E'UR!`y [I_4,PZ0@C [n H0@0P0 p 0 o@P30* 00S  Pj X0 SR eP 0 I@P 0 00S @P _@@ @P 꾙ihUh3O--ϟ MSp 0E 08 x@0嘀Y U Q0 0` W, 0S0S  ` 0 . "2 Cߍ0S0S;0S^>3> `.> |.01 `P 0 0Q P 0. ^ 0S 0A?oP2U0P00S0S  p [ Pm吝`n` `  0A a30<aP[ 0S  ?Q, 0( 0기$` #0 RS S0 00S`P  `<00@(0PP`$pY i792 I120Y0 0 S   S  R  R Q ^  ^ \/oQ" SQ RRV  0PsQp 4+0 0Si QRe 0S %70P,0 ᳘P , 0 B  ` 0P0Y ,00 X,8`+ RX R R ^ x0S  YYB@pTP0S| 0``,p@b S R  P  PU \8 @T( T d642 D52 0S0 S P  ^&S㜐Q^.\+@`T,p5 W 000`P 0 `pVPUH `0P$0B XP 0 ``P`TPPXP1$a0S) 0S a 0`@/oQ" SCR㜐  `uPQat 0PM RJ 00SC RQ? 00  P 0P1 R㜐  00SS㜐RpmRo \;R P @ 0XP 00[0 0[*|0e/0 h5h%0 @Y X%`0@S 56p$P(`X0000XP X@T0 4p0$P(`pP` 000 EPu@T 0S S00S0000 0  `lP `@! T* F'RSQ #3 {/0x\ 4@,8`} sP1x00x0 _8`PPP@ `0V 00`_T0`_O-PLM` Zi  @㰱q p  PP0 0 0PF ``0S S S T@rP `0S `(0 ( (`*P00 U `V Y 00  Y``VU$@LЍTT T0T P0/Z8 808 40/~ d ` 8 h ĸD iG-XM`@}P pP @D00  q0 }P 40S0- XЍ PP ^W 0 }P ^8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍjxǷV$ p|G*0FFi؋D\׾k"qyCI!%b@@&^ZQǪ/]DSء!7 EZgoٍ*L9Bqma"8 DKϩK`p(~'09ۙ|ĬVe)"DC*#9e[YÏ ̒}]o~O,CNS~:5*һӑ@-@P 0D DD@  00,0, ,0 ͫgE#2TvD  LA-PPp`6 W* 0!ᣁ000?0"@@h>V0: ?0hV@Hp` 50S@@:p`F AH H0H 0 b, ,0, 0 X  | @  p@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 T@ @0@ 0 />$ = l   @ G-@"@2 0M000(2("00P003  `p0\ @ 0 XS@@|Q0 C" T. .0N|Q0.\'^V*004!$1 0 0 30@ЍT  Aa r  B8 LR\ P 0FS0 S S XQP0@^*0^0 8< 4^*0 8<꒎<<|;- McP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp  (0!@$R0@0T$0B0S \@0S ( !0$ R0D0:L9  A- rM`PpP: UB @X0^00pAtAP0O Q01 000TAΌ LVP5  0 ;ypP& 0@WP 0 0 1 30 rߍ0 <0 Uh0h h=0 P X X X 0` `p  `   Q@` ``  \0\ \]0 `p`NT  T X@-@P @AT( (0( 0$ @5T /g'QO-b PťPY<Q(0p7W `$ :6o@2/0p $` V( ,2(-P W0#03V,0( 0!( -0P QKU00⛁!Q03SQ: PQ Z5VV030#1!_ 0 S@V000V; Sp3 p#P 71S41pG2s2pGs1pGSpG0f0pGwp4:0;p0Z Sp3 p#P 71S41pG2s2pGs1pGSpG 0j0pGwp0809ppp p@-`Mep& @Ygp) P0u0'{0 {@30@et h0 0)P Ѝpge00e / @-\(,\ \  Q:^: A Ͽ|q<Ͽ10000C-P$0@SMT 0( _4p :`I;$880IG81GpB70 B-0P % P 000<890L>1 0 00LЍ 0 /?Ͽr s0|13? <Ͽ2/0A 0 0@-S@ 3/@R@-p] Qdc @P 5_2/P ` 0@ PEPET% B B&"@@" PEPEX% B B""@@A PEPEe% B N B ^ w" ^ v N1 $1 0@`@DF$FA!B@  D B &"AA!@@  B B!"AA!@@ a Q@'P 5_2/P `<ϿL,PE PE T% B B&"LL",PE PE X% B B""LLA,PEPEe% B N B ^w" ^ ^ ^ , ($^$^2 ^. ^0 `1@^ ^ N1@N1 `1@}^{ ^ ^ ^ @r<`@^lhdLHD7y   @-@P @ L0 /0 ¨ (p@-1!00 P@0 00D@1011.T 0@\0 S@ P pp0  00C1000L  00t@| ; C-P Ml 뀐pM%ᙞlaapGQQNHH0  @ N 0! Ѝ Q$@-h4h$00 0`P@  @0C0APP@@ 0P@pP Pp P0pC0QPp@ 0@pwP  0pC0.S 000@000@ 0pp@E0C2S20/.-,+*)|'&%$n"! je \NJ2S2\0/.-,+*)Q'&%$L"! J< 1,*000 @ @  @0BdQReBn`@BdABdBnPh00p00 R 0pGqqp00 H 0pGqp0000pG00  9@|O-`!0@@R@@Ɵ GM MtčƟT ࠤH8(00t6M0P40 0 0T6(`0D0h0,0$&$6 0 < P< 0`P@00 (dP?o0 2R0S 80`1  @0`V 0` 0V X D$jX/`0S\ ,0Te?pH5`00` 0VH W,0?p 5 0= 0Y& W0 i@X,0? )R 04pdp`  ( ^P* 4  {,X4  p0 84< p04 p04  p0 `0SPU  0R40008 Zh`1S   ;`1S0 g0  0PJ0  0P7P  PP$0  0P0  0P0  0P0  0P0 0P`1SxYz < P0ppW  0R 0grpW 0pW  0Rx 0g_pWf 0pWa  0R0 ,0gLpWGpWD 0 PS00 g`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0F001p 0;001p 00001p 0%xt1p 0[P=NL *gtЍ tЍ 0 ;10 40 - 0 &0  00 x0  4H0  4ۨ\ Hؠ(`@ ؠ؀@-@`00AMM0 400p00 ?PP0S tD 80 0 4 30AލЍ./0,@-@ M pp P?`PP 0S <0000 Ѝ00S.S 0S ЍPp@-|0|AMPt 0 ` $ 0 @P "8 00 0 4 30Aލps@p@-P@Q`  @Q  cPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝ0p@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00ЍpӐ0@- MP0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0 ܬҰp@-Q`M x00<@IP 0PU  0VЍp_40P 0`xЍp @@  0@- MP&0@0@=@T  0U Ѝ0p0 0PSU:L@@ Ѝ0<00@00 0PB Ѝ0 \|фҨ0@0@-@ M T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP0ѤѨx$(d@\8`0@- MPE@O@ yP Ѝ0 0( 0Pw Ѝ00@- MP*h0h@0@B>@T  0U Ѝ0O,0@ 0PV Ѝ0 l|͌Mp@-@ML 0 Q0P0<00P@ ` 0. 07T @D KD000T H0 0 <0 30 @Ѝp@Ѝ/.0 Ty2P D( O-PM@PP / p|`x0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`z 0 T @ P  S#3@ P 0RQ  S # 3!# 0TM 0 T @  P  S#3@  P 0R \  S # 3 # 0T 0 0N 0L0 000J 00  0; |O-`Q0 dM R R{20\0QS0N0<0l2a!##\B2b1!AP2aL5BX2dD@AEW0E0@02h8's2Q>?2crlqqHL01NਂhL΅ReXT P0HP QN*~ &~ "~[P0 T XF Z H Y J (0L0$0\04 0@0,0H0 0<0p 0D P40C[ &HZ "HY HdЍ00N\0`R`(`m  0 0dЍXZ HY  8ԀgibMӈQȌ\H<@-@^P$ 0D .R\0@*S0T .S@@TH H0H D0( *QA.@S@@ j8L@-$MP`@P`\0pv> 00pp< pp_p  `Pc$ЍƸC-@P@ `p MPOP @U ^P@Wt Ѝ @Pt0 0000 0 P"@0S0Toᨂ# DT 0|C-@P@ `p MPx@P @U n^P@Wt Ѝ @Pt0 0000 0 P}"@0S0Toᨂ# 0 $|p@-@Pt00CS0 S u P `0 Pkpa`u0 0CS0pSr P 0 /a@-M@D0  00600 !R !z0@3Ѝ@-0 S 0@Q0 R  004S u0@l@Q0R Q    R Q  0Lp@-DPD0P`@0pp 00p@,X0$ <Lp@-@ @ `@0Ppp0p@, LA-DD p@0P`p0 A LC-P0 `0pMpp@ H 0D @ <8 Z@Ѝ.: 0LC-tPp0 `0p MFp@ ( 0  @ Ѝ : L0 00/ L0 00/ L 0 00M0Ѝ- LA-TT p@P`Mp 0 Ѝ L0 00M0Ѝ 0LC-tPp0 `0p Mp@ ( 0  @ Ѝ9 LC-|Px0 `0pMp@ 4 00  @Ѝ9 tL0@-P@000 00M 0 0ZЍ0 Lp@-D0D 0@0pP p@c[9p L((  M  0 Ѝ <L R) p@-P`@V >P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` u0T  0C0 ЍH0H0 p<0<07/0W 0 4ĨĜO-Mp`@PPMWC*00V>:Y ` <1 p0 p, `P 0 P-0 P 0%Z ` p0 P0V0`FV0S0 0 Ѝl0 oP 0`00000Ѝ`@  `\ ]d$O-M͍0(0=000=8p08<0͍00\@=<;:9876543210/.-,+*)('&%$#"! +Ps R 0S .S 0S 0S00S.S=<0@70-< R' 7d 0@ 0 PE0D0 SiL7L.4,00$,0PJ00 CY 0000!( !, p@B <[@$p@D0 PYʠ0 yP  0 0pPd600#$ #(#<0 0 C0( ,600.0 r  .00Q$0 AKP00Z0D:0<H+B 0?R0S %T5 0 0 30  ݍ ЍX5Y =<00S4=<0@050S=<0@50MH0⯽00@0 0 0 P@0 50P,0$ 840H0寽00 @0 0 0P{5P5@5 0PD;<4@@2 0 0 P_00 0 B0kPU0H< 0R0JZ0S~#3 0T t=<00Sz4@0D;p3d 0P 0 P(0 0 B6P H00P8p4`@C 0P%P 0 uP0  P0=<00S40p00Wd 00D{L20 0 OP=<00P@C 42 pPN W 쁟W# @P᣼ 0 1P0T0 0 E(P00d0W0@DWp 0 PP1d 0[ 0  PGP 0 5@P 0pD{ 0PYW.  0 P}&=<00@C00  hdx| $ c NH%8D H@t|*Xpph D֤ B B==== BH==xUUUV說 @Ҕ\`8 l`|@0@d 00 0 P0P0d 0D 0 qP30d  0 bPpXD{ @QP0d 00 0 LP0DK0S3Y  0 =PDPUD  rp0X1 0E@HS Y>g=<00S>3@;30 P@D[2d 0 @R 0 P P:3 @DK1Sd P08 0 Pz3@DK0d & 0 Ph20D;3d 0 0 PV0 0 BdPN0D P@C 4> Pp P(4($0 @0ZD;: T 0  P,0 @C40+Yi =<00SD0@d 00P 0 |P 0 d  0 nP0@T0DK*4UpPTDK 0d 00 0 QP=+L0X 10"3% 00;L0==0;L020 200;L000300;L0<=0;L0L10 0;L 0 P0D0 SQx@pT P0倠t @ Up  R @ Z$ u0d = 0 P@T+A0X 10"3@' 00;A0==0;A020 0;Ax7;+A0X'1 000';A>A C7;=+L0X 10"3' 00;L0==0;L020 200;L0L00 0<(;L>L Cw 0 0  B8P"0DK0SPገ\& p$P倠P 0 W  R @0 Z$ 0d  0 aP@T0-< L9!?C0 Sd  0 JPPd10@)DK1#0pW  0 1Pm=<00S =<0@90[ 0 0  BP0D{0PCUQPH@　 @UG1 X2  0d H 0 P=<00S =<0@:0"00P84p@C 0PPo  0 Pg 0  uP_X  0 PW0DK00CS @;00 0 BYPC  0 P;{DKp0PD[ 0d  0 P%0PD[ 0d  0 P0p 0P 0<@d p0DK P 0 gPH=@ <<0 Ǹ 0 UP=<00S  0d 0H=0 0 @PZ0pD{8  1R@P` @@@@0H;-P $0 0$ᆸYP *( >0@@$> (04/$0Z= 0I0pHD{> 0S @t 0 P0%$0d 0>02 0 Ps=<00S/@/?pD{ @@2 0  0 PU 0 @PMj p_ 0P @DK PA 0 P: @ 0 DK P0 0 0PP(' | 0D;  0P0 0 B+P/@/0P00( D[@=0@0 p 0 gP-< <@B!?C0 S 0 TP=<00Sd=<0@d<0~=<00S0SH:=<00S9 L0@d 00v P 0 %P00d 0Dd 0 P 0 d V 0 P0PD[S1iB! 0 )P0=<0@;0$=<00S/0pd D;:0& P 0 Pg0084`@C 0 pPZh 0 PR 0  `PJH=<00Sg= @ 00H[0 M#T *0(*  09 08/= 0 @D@0 PH[09d 0 0 P0ZD1*p@88 0 DPZ W 0  `P p 0d @ 0 RPpG@P 0 Z 0 @P|@0 0@ BP8 0 -PPDKH. 0@D.HA.  j5 ᆶ= 00@P ( 80P7 05/D@G=<00S=<0\'@X7 01=<00S .0D 7d 0+ 0 PMl 0 0  BxPb0D[0S&C1#00 Sڐ 0 PL= @ 00H[0 V"T *0(&( 06 08/0 P- @DH[P D[@= @ 00H[0 0"T *0(\& 05 D08/0 P- @DH[P D[@P 0 fP=<0@$50 $P0 PU0D[:=<0@40=<0@40=<0@40y=<0$@4 0x=<0@40k=<0@40e=<0@l40_d4d 0k 0 PU (P0d 00W 0 PUDK  0 P PDK 0 ~Pn 0 P~0 @tcDK00`PC@ Po 0@}Pg0DK0S 0  PYP LpPWW b`@P 0 P@0T0 0 EP700d0W0@DWP 0 P'P< @PTT qp`P 0 zP 0V0 0 EqP00f0T0`FTڈ 0 bPh!h1h d0T =<0@D10= P 00H0 ᰴU@9*( P10LP0 05/+lUUUVdD8ɔp`T|ت4 E\8hPx4d ,`EudLd$x,0 8 ~~hl}l}}lL}P0 }|,{{{th{{dD{DD +qpP 0 D P?H1d P0P 0 P0 0 P( 0 P +P 0 D P=H{ ` 0PP V *0(!( 082 09/=`F ``pH{ 00 P 0 QPp+P 0  D DP=H{ ` 0{PPV *0(" 0 3 09/=`F ``pH{ 00 PPp 0 P2+P 0 D P=H{ ` 0=PPV *0(# 04 09/p`F=P `H{ 0 0PoX 0 Pg*@ 0 DK @PY=Hk P 0@POU *0($ p04 07/=PE PPp 0 0`HkP00 P(` 0 P 0 P== P 00H0  U@l*( 50P5 05/^ 0 _P=<000&@C46 0=<0@L60=<00`&@Cd6 0p 0 >PP @pPWWl f`@Pᕲ 0 "P0T0 0 EP00d0W0@DWN4 0 PFT 0 Ppg`C @0@Y0D:07'0 ,0'@C7 0%0'@C7 0=<0@7070 0 Pb xpF=<0@ 80 ,h`@P+ 0 PJ0T0 0 EPA00d0W0@DWڠ 0 P1 0 P)h`=<00(@C8 0=<0)@ 9 00@C 90(  0 vPDi`DL9L)0 j0`)@Cd9 0=<0x)@|9 0+J0X X10"3) 00;J0X==0;J0XX20!200;J0XX00300;J0X<=0;J0XX10200;J0X0 0 ;J 0%PPUD @- R  MAL  ,@0@(@@; Ĝ0 Ѝ4MM$000 1 2Ѝ/UA-PS`+p@ @W0 V :00@PU M(PV(0P0TPD0?T0S,0, ,l0 PP4 HG-0pW:0P W : 0W : ` SS 0W*(00@0S X0T0 "$ P0@A-QMup$0PS@` 0! $, (0v(`Vd0S`(0S0! , $P, (0S+p100'PP, 0 Q,0K+,U,(0T0PT(0 S0P$00Q (0, Ѝ0F 7P%,  (`, \:,000\,:( ,00(0 SPU$P 0"ꂾ00}(00A-QMv`$0PS@p 0! $, (0w(pWe0Sa(0S0! , $P, (0S,<0000*PO,0 R,0JU,, (0 Q0QQ(0 S0P$00Q (0, Ѝ0G P%,  (p, \: ,010\, :!( ,00(0 SPU$P 0"00(00G-pP@P`x Um T}00#q,2 < V(Ì@D?O p2 00< V(Ì@D'q.2?;: p p 0 0̉Č 0T0T! T00p#2<0W0!T 0 000=   = R*0@R0@|0| |0 W`0` `0 MH0H H0 D} H p tt L\ (O-cP`PpM U Q@< 2䒟`2 0 002 @0 00 0 02 0ᨂ @=Q^ P_ Z 񏐓,4U WT0 @ QZG@Y4ЍU W= 0 @  Y 7:P0U W* @ U W0 @  Y 7:P8!818 40P ⬺Ѝ Z) @ZQ 0@ QU W R 0 P 0Y 0 P 0|MQQ 00@=Q |      P}|Z |T|0 X|P 00/JtlP 0/(/ ///{{{{@-`M@lTpP@TL0 @ P@&LC03 y8{lA-Q`PP@pS TH 00SA00XS= 0ST.C+SQ2.~``p 0000s0  0C ^7ࠃ0ࠓ`0CVs 00000  0C Q700C20L0L L?0 ൹404 4>0 ହ |y yA< ypA-Pp@KU`* T @ W0``W0*.pPE^p P0070 2000 S037#Q00 ^00, ,0, g 0f0x xxX/o////T@-` @0 0DM0<000p2 0*0 RP+ 0 0C 0< 00 0 <0 30DЍCf w O-H2HrP0੒ 0 M #r $rgqC2(0B刀B# C@$AQ i!dP`3 @@CB*TJXRW/Y  @0 SP7[0S  `  0T0000000S @B0?R0S2  Ѝ @0 MgP Y W 0 \P@D 0 RPX  @0 HFPWY @0@ @e0  Ѝ :$I% |u u(A-`pPᇬ0S-@ ▹T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@j( 0 p@-M P@ ȍP k`\ PFo4 (0 0 8 30ލp9e  T0-@- M0@R0  HPP * Ѝ@Ѝ/ * Ѝ@Ѝ/ ePRp@- `@BPPqP0 ?p@ C_00pPRp@- `@ PzPOP0 ?p@C=ܹ00pp@-@Q `PZP/P0 ?p@B꼹00pp@-P@BP p@ p@ p@-@P 0PS <0S P  00p萹00pQP@- 0R R  }00p@-PP Q@ @Q Q QT0 D32e00pP T0DS@pP p@-PP @P  T $0S@d<@MnP$Yp@P @oP0 @So0Z@ @pP@40S00""[$D @P   0 0 0 D0 30LЍy>Ptpp  @ T@ @0@ <0L $KU Ve74et V6 ̼6X5A-PP@M7 q`p@T) X pp00 0 V>P   0 Ѝpp E@T Ѝ>P @, ,0, (0\ ѧdH  p5 4 O-ʟ UMMLōj|ŝpP`xU刕 0 0S 0  R0 R R 0`*0P: 0 L5 30UލЍ0:0$0(0P00 0 ZS#``P 05 0 0@P0 $03/P Z: 0B?o2\0R0S80q xP0`PLP00 V T00 Z@05`F00 0@P0R?D H<0p4X`P0 C 0B`P!0 $03/P @ ` Ve00p0 S(,0WW ,@x TH:0040D000@Q 0 d0H 0R \ Q  RL pp TP@`BZO[P0 0 0S ! R soQ \ V\pp0XP 70$05W @0ST0 B@Gq 0P^!P" SPSP@Tp`0S 0 0`@D @PC0@P0CS`@:Dp` @忧+H0T C0 0CS`:屧080S0 S R:  C'SR^0@ 0P0%L PK RSdX5 0 <0e@PD0  ,0@S<aY 00`V5 <`V`` P(0 5P0( 0S 0S @0S0P>P( 0@T`*X0H0Q*pB@0`@0,@Hp@0 $ 4  0l  0SR#3 l 0H R| R [ 0L0?R0 0 @P0 > ,0@SP D001Q>*0PP P`P0` CR00SZD0004D04004<cPeLpə0`P@ CR00S#@༔P`@$03/P `00D(`C 0P0N0P~  0 D00000"뱧 0 0% xa  0 Nύ00>1@!R:S0{0pP`pK 04P 0 d@PC0 , ,0`S@0S00PD000X@T Hp@0,`$0%L x4$P D001Q *0D0P00`P00D(@C 0P00P  0 D0:RD0400 T S Sp 0 D-h -8  A-@PPMD 0 S`05 S Ѝ0p 0*PP> %P9 80 0PĴP  0 0PbU 00S S 0pP 8 808 40 ੤@ 0 (l'G-30BMPP040@ 0 00S0. S @ᬒA~ ` p0v #0Gm5P @T *X` \"ST2P 0 <"$2 0 4 30Bލ 0    ! B5@PS `PN 8 0 0@勲PK` 0 00 00000 0g0@TA 0 p pIP* G00S 0  0pW0   0 0\ 0 0 0 e 0 C 0 < 00S Sy w2Q GX'' F|' %%4G-M0`p@P0P0 V 0   0 pPЍ 0 PP 0   0 #A-M`pPҥ@P , 0 (   P0@֥Ѝ0, 0ЍA-@P M`P@pR UV'0S9 0S0S9 P`8818,!<P P0 0pP 00 ЍU U- j/ 0 0 Ѝ0S _ 0 00S000h S S 0SP` @< <0< 8 00 5d#D A |!O-DDğ DM<h@P 0 (90P P`sp0 `PP ᆒP ,0  0P0ß RR RR 0 Q Q 0 R R 8 $0`$0@P`  s p0S S S@ 1Y g*@G@P 000S 0 R0 ?@B 0I  R06@DQ1 宣  @D T!:  @Dp0 Sq CF P`0  ᐣ@D q [p>`oPT* P`z 0  0d!P1 0 <0 30HDЍ(PI `  6P@o P1 0 0 0x0 J P`00 0 0 000)00 ` O`P A| > p@-M`P@ ),0,0   0aЍpKK@-M@ $$ 9 ЍKDKT@-M`Pw @pP0P0 ɠ@0@ 0   @0PЍJJ0@-P MP@T 0t  P00 000J P 9 @ Ѝ0⽺@T8 00JJpJXC-a@P`PMD UL 1 0`    p 0\# 00 0 L RU0100 L.\3W 00 @Ѝ R0 XS 00 9\0 @ 0 m0 &U0 n0 \ @ pG W QU$ (,000 :|  |O-ß3 0,MPQ0$00@`# R P P3 /00L#D3 0 $0 30 ,Ѝ #3 0 $0 30,ЍON쒟r삟 p 0I4 ⾠Vp T T 0@ Ⳡ0@:T000 0? TA 0l"P P` `@0 ეP 0 Z+ @ `V pW` a @$pTᰐő0Sk T0D S0 s\b 0@:TP  pKP :V7Z& 0S 0$ SPq1pJ04 ATg TUU 0 0@ 2}0S 00@ &@$p@.T`@$pTPʮP* 0 S! P 00S S0S S4 S9 S? PP000S 0 0;T $Ѝ`dP`VP ATq ^" S 0 `W FW WS SSH0H Hh0 S }ʴ <pp@-@PP` U 00F Gp 00p0 60 ÛUd0d d70 ๛0 0@pڝ0TS֝00  x -M0 3/Ѝ/0@-@PP M U( 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0D0D D0 jU(0( (0 ` H 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 *U, ,0, 0  T (p@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0 , ,0, 0 t0 Lp@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0$ ໚, ,0, 0$ ౚ ` p 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H00 {U0 000 ,00 p 4 l@0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0@ 8U0 000 ,0@ - (% `D&0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0P U0 000 ,0P E TF0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L Y0\ ಙU, ,0, (0\ ৙ t H@e0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L a0l pU, ,0, (0l e l @D0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0| .U0 000 i0| # d 8L0@-PP@ M T 00vP00 Ѝ0L L0L H0 T0 000 q0 H Ҁ0@-PP@ M T 00P00 Ѝ0L L0L H0 ҘT0 000 ,0 ǘ \ 00@-@PP M$ U- 0S S S Ѝ0003/P 00S00 Ѝ00 0S0 02/ Ѝ0L L0L H0 U0 000 ,0 t@ 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 HU, ,0, (0 = h4 | A-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP P0P L0 8 808 #0 d, h* @@A-PPp@`M3 W< T% rP RP P P ЍPX Q00R X# ЍAt 0 & 0ࡗ 0  0W 0  0 P@ J0SP@@ 0` ۠p^ D_ lLp@-@PP U  ;p@|L L0L H0 OU0 000 ,0 D ڄP $A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0 0  0Xl l0l h 0WP P0P  0 ,, 4 p D0A-@PMP` 0$ U- 0pS SW ׊  dP R`V* V V ЍG00 0 /0 ࠖU 0 0 [0SP Ѝ W` K0SPV Pp 00 , (h H(p@-@PP U p@T }P P0P L0 KU4 404 0 @#( t@? 0@-@PP M. U7 0S S S Ѝ00 03/P 003/P  Ѝ000 3/P 003/ Ѝ0L L0L H0C/U0 000 0C/ 0W h0@-@PP M. U7 0S S S Ѝ00 03/P 003/P  Ѝ000 3/P 003/ Ѝ0L L0L H0G/કU0 000 0G/ T{ (p@-@PP U p@UX X0X 0K/U8 808 40K/yp@= X$ p@-@PP U p@|X X0X T0N/[U< <0< 80N/Pp@d Ҵ p\p@-@PP U p@X X0X 0R/1U8 808 40R/&p@ p  Dp@-@PP U p@)X X0X T0V/U< <0< 80V/p@ h4 $@-M@*P0.S00ЍM@-M@~p  B0?R0S Ѝ(0( (0 Ȕ0CЍd ,| R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 / L0 00/ ,// 40//O-P0 MS  ģē \o Q Xj@.   Rc @Rf  X^@\AS0SI <  cSB!  S   XJ`#SpP@@P   pGW`W0P@W `0FS@  0S0S R*00@BT00Q0S@"@2@ 0 ⴓ ЍT S ֕(00@AQ R!   X@\ P\! C]R% X!q#c!! Cr   "!!1Cs0#"1 0@0@s 0;S !S" Cr 9"X0@S \S X 0@@EQP S pg' 0`A0k pg'!"p0`40^d000X.0 0e Lp }hQO-Pğ@ $MQ `0Xt P`p)[V> P @Qa P @Q`P ܆P @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]᳆Pj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b"r R` V` v`A ` @R^ .R @㖔@  0D0C  X1(00$Ѝ胔00P  ` < V   \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00` \ {D| x40G-\AQ@M*p0S& RD @R`P001 0X; 0s00ࠟ   r \ 0 Sp00 @NT00Y0Sx x0x t0G/ⱑAS 0SPQP!00P0X̓(0@0 | u\tRO-P3P#RP3 M0U 0p`\ @W @RH R R4 (00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[Q[ 0 0K/D  Y*@T*0Pb 0A\ R!ɑ" 40S 04 0 t8- M| ЍO-S@4M p0S0h 0S 0S0^P @^Z \S 0( X S B `$ ,PU P0S @Sf   [@U `PU00 S 0W*0 B>^A ZP `00  K Z0T?\P0` RP SAS^01"0!0\VP`᳒(00X0S $0 Q*0F S(0S 0 `(  0AU0S"  !  [)@Z0 p w(  ABQ APAU QpF  p  r  0B>SE0A S0AP`0S 00`(00@4Ѝ R p0S   P\`B0[,? 0,$ @C /Q R!1 0R/p+00 0 0R5 P`00j,@J0? Q0S 0 |0R/ sX \Q\ @ @0@ <-0͏D o@(J nؔ4j n\$p@- M P0 `00p @ !{p < 40 0 1 30ލp@< |A-P 0 0M `0 10@0 (q]p 0 ph0 (0 0 1 30ލ< ( Q:/R/0S/S:00/@-\@3#* 0^ @R R R u(000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R?00C8(00/C/A-@P`TP% UVT  P @TP 0?Sp 00(00QSp@-`P@ ߈PP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1APÐ(00辐00꺐?00Q @-A?SSRB 0@S A蟐00蚐(00/-- M/ ЍЍ/@-M@ p TЍR/0S0 \ S 0S0000/O-P M@P 0DT"S ` ᾉP-Ya +Y Q0Yc T@ @Q ;pW`Ppg;pwW`P" [-SQ& K0Iq P0aIQW0IAIQ70IS| V[SQ;+ 0S \0J0 Ѝ`Q0YXP$ A@0L ^P @Ϗ0 0R0   ЍQz ,0, ,?0 ]T@@q4 f00 0M0ЍG DA-00 rMPPp`, V4 @X0^00pAtAH0O `p00TA΀`L PP%0 @t0 0 1 30rߍX0X XF0 7V<0< <G0 -T:  < e`p e80   M Ѝ ` -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/ O-@SM ] YXc 0pS000!R !01 ᶂPP E`#3`7P*Q30A 0#1#2#4#8 |P 9    U 0C  pSLP0 0@pQ 0S  ЍÎT 0 @00Ѝ808 8@0 걎 0 0$ blA-@`Ppㆄ0 z0@ㆄ$0$ 0 M Ѝ T5p@-0 000St@@@pdPddP @P@P 0000 0 Pp55` @p@-P@W p@A-@`P,ppp0php $T  2<0 6$  A p|@-@P0S 3/000S@> A-pP@`  F (u000@P p@-@PPpp@@-@!1BMM 0`PF040@@@ @@9xqPpU h10S \!p0@  P8A0@ P< 1 0{!0 0 4 300BލЍэP ύ@P  4/P Q Q 0 0[{p0 00P 0 0 宍 @Wx8 x2, P\ \O-qQpMP1 Ap@e $a` Q00]G1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W 0@@00>IQx00p@@IЍPЍ<0 0z | 1p00// 0@-@PP$M U" 0 P' 00 0 P $Ѝ0`0` ``0 UH0H HH0 . Z~ ZG-@PS  RL `10\0SA HaHHqP`p #)/0PS-00兑 000S 0 000 00 0 00 0 00 hz G4P00H H0H D0 t`ì´ XA-pP8 0S@P$0S!0`PP @0S PU @@P |0Uw00 &s\@ 0@ P 0 000 ,0 ,L+ WO-XğdMR  0 S X (4`000SYD@0S00  0#003 0  0 00P YP3s003@0p0VQ QN  QI AP0S_ 3/0 0PY@p@ SP00SJ" 00C0T@dЍBB,@@@720\ 0,0Ss  R20$   @$(00 L00LqP 0S 0 <00@00<00aP 0 S@$0S(  ( @0P1 1S@i!1 0&( 0S X @L!L1L H0( ׈X0!010 ,0( ̈P, 00C0@g00$   @$(0rP @$0S(  ( @0$  $(0 ۸p* P**@ ) )H) < TDL Ta Stb'H x L 0C-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0(T*0 V @0S00U0Pep 0PT*0@0S00 V@@W <0Pe 0P5 Q ,D\O-ϟ M|ϟp `0S㨐嬀  V 00 0S %SP 0zS񏐆~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[YWVTSRQPONMLKJIHGFE.@;:97(54*1G*)('% {`?$A4/X-L= 0 |0 30Ѝ bOd @04  $0(P,9,##,cR:,c2S<4-PP4- 0 0C#/@!b!b0C CBq\\<N./3b112N 04<  #cQ<5: cQ<0!<3b112N 0 [0 S 0! V*0`0S00 Y `|0 p` Q @+(0 dP0   V*0`0S00 S0S~ ! V*0`0S00 YUSP  0S0  P 0P  V * Y ` R  P0`p `0 S00C`  B29Q/0A!b0dP  K Vy*0`0S00r Su 0  B2P9Q/0A!b0dP  + VY*0`0S00R YU0  p(`CQ!/ b !Q  (0 dP0   V-*0`0S00& S) Q 8(0 dP0   V*0`0S00 YUPIUPE0 p``p0 L5`0 S 1h V*0`0S00 Y0Sz 1 V*0`0S00 S V*0& `0S00 S0 p` 0S 8 @ pq   pq 0AQ 0% S! -R S% 5Q\nuLu@u,u I$QH ; 8  0I0Q0l0 00dP  V*0`0S00 Y0dP00 0 V*0`0S00 Y0 <008@0 0D00dPH00L0080 0X0\! \ V*0 `0S00 Y0Q01 00dP W V*0`0S00~ S $" 0R) $0(P, VS\ gS" 0` p`Y" " n g" I"  L, /A!b$0(P "?dN2c1 1 @1N0#/"b!!Q1C  ã/ d0 S  á/d0CS0c0d3dP 0 V*0`0S00 S 3Q00dP   V*0`0S00 S ` `Lo 0PF 9,$a j/ dA-M`P@Ƅ0p40P0000 0Pp@P U p屄0DЍ諄"00Ѝ襄T00@-$$@M Ѝ C-pP`X@X@ M @0@0  0 @  Ѝ xt4C-P`p@XX M @0( 0  0p@  Ѝ t4@-0N~ \0N~@ T \@T00\700p@-0@-S`M `+SP0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-0@JS( MS 00C S! 0P 0/S 00 0  P 0.S  0{P 0.S  40n@0 dm A-0a((Ÿ,Nl^3f*Sj Sq @R 0ϠTlQ@Ҍ 1C0o 1fcf Qq P@\ q00C◃?G1c0 0@100CL``S0B0S0BPDKHQ``@P QS@ 0S l lTà%A@002c2cPÌS S L l là l^#3S l là;\L l là^ʌ͌\)P*QfffgI$ 6$ 5 0P /0S/ 0 S/0S/0S0@//O-@M00P S 0  $0P T 8P<D0@  U`4矵0知f౞Ơ`nnQE0P4jPVV^ౕŠPnn@4jQ౼.౐@nA8<jR|柵|查ၰ౞Πa0!B@ jT0jP 0Sj<R0v0f0V000 0SjQ!a^ 1:aX#3`\<ܵ P崕崅ue帥 R p `V1:`Z#3`0PAjQU `TUTu44<<P `[Ϡl #3 C` RAy^\PV@ $<0 c sD0 Xj0 ;Rf@aPp\  0P` 0$ VU< XWC W0 0P`$0Pp? 00?0S  S   $ 0 4/P$ 0RSRP` `$PvuׁT00ЍXW pW $p0 a spzESO; R j;0000 @S QE"Q!ASF R|0S 0S XJF|lp@@pFl  h` " RX X*00 0$ Q000S0  0F. "x@V,h @P^Q  -R 0hDl -R P0R 0R R0 _ PO-PPß M@P  0S0 0`῀ 0  0 S  孀 0 020230ߍ0 0  0 \ 0SV  R 0<0Pz ] pP"rNA U p"^QFVh-X0X0XQ RO Gp `VE 0FlQP  Fl R0 h oh0 B00000  0 -0S & 0 0w0 0 00S 0h ?oh2A 0 B U 0 VT00 V00* O-@SM@ 7 ˄ h R2>JbQ0RRP=[0”` T4\,O 0CXdPReReCHDSL0Q000 4yğpdg/N(b@ "b"b#G B+  ƒ#H#802c2c3B 0:> tyßSD >BW@122e3cPL@/ c0 Ey8#(: 600+$0+>! 0 #Â!!!0C0(AX Oÿ2+" ?00 #2>[?W'`F@PG`D2#2:#0H"H @r,W"!0 / 15: "  0"#2>"Q0 3 #101`0U15? B4sppp0/S[0 p c0 x(a!(: 6 o`00+$0+>! 0\!!!!0C0Xÿ81+" ?00 #2>`T[h@t c0 x $: 600*$0*.0$1110B@T0 I:#$B0Nm :.EQu_9k"mn %8cSI$ňQ\\(=p \ Q\(\) ,s c0 ix(a< (: 6 o`00+$0+.d01110BX|0;#(0``0 0 cQ @R0!T BqgqgYpC(1 ?  0c0-x0,!(: 600)$0!)>X! 0Â!!!0C0x!Xß)" ?00 #2>r/E B  P2?A1c1c0R0B 0$2!502c4"2c2A" "b1C S/  `008P2P":#"0 όB! TY: 0"#2>"Q0030#0000U  PE0 S0  P P$ 0Ѝ@t)1? 0 c0w0t#):60 0($0#(>!!!0C#0Y("0 #2>t<0P0@`! 02P"> 0R \   10! S kB}00Ѝ0PS, 0!Q0% V 0? VQv8Ÿ0 0#́P0PQ  V0" RUСbFlh 0P F^P2l VS0@0@0CSH_pP 0Z 0S0ƒ!100 hh " 0{xY WX10\1001Y# <Y=0 S0S >S@p;S*S0S -S0 C R00@00C)0H`hlp崐@VUB tQJ d1d!0 t0000`0V m``@ vP P =D0C0CS\@0d/@D  ?@D0P0T0S00#  1 PWPࣷBU|,d7P@L0L L0p0 000Քd  4Ԕ`T[ 3 @-\Ff0 Q0 nt0t t=0 n\0\ \0 n0 0Cf Ij` `LTD(TTT|--M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-aPP`@M%  Z,pP8 Tn@P5  0P- S& 0p@ 0$  0, 0 (0 0 Ѝ0 >0 m0 CgЍo0000@Ѝ lX(SHSP@-@P e0#3@e0 ;0 umRp@-P`@a R T0U:T0T:p@np@-@QPJ 00!R ! 00! 0S uP A0Q0R0S`' 0S 00C000P0S 0 U00SpcP#0bP `bP  \0\ \W 0m  A808 8<0 m*o 00QL8Q(PA- R`#P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ 110L00^ 0A pW \00W00S PA0 SP0Ã@80p@,1! L0  A 0AC-p@0T@1WP` M n n0S* D![m00@ Ѝ00n n0S 0   ~n0@yn@O-P4M@p `!m0  00ShSf  %R0 0BZSZXWUTSQPM'J?>=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK 0V & 0 aQ S  T 44ЍPP؀PP؀010 00C0B Q$ROLP00 x3 0S 0V`1!'  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S pD 0V`1!dx$ 0S 0V`1!W V  x 0S] 0V`1!F +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py xp qp jp& cp \p Up"s R 0Hp0y  V@ `1 | x 0S 0V`1! | xm 0S "pT  0V`1!t ; x 0S4 0V`1!e ; xX 0S p/ T- ** p# p$ p7 p#l x 0S 0V`1!'P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S bpx! 0S Vp@ x 0S Hpz  0V`1!  x  0S 3pe  0V`1! PZ XX PU SS PP NN pG PD BB P? == P: 88 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P  p  P  p pO p P  P  P  P  P  P  P  P  P  P 0s 0 S ~p  0V`1@! P $Ry@00 P  P  P  P  P  P ~~ P{ yy Pv tt Pq oo Pl jj Pg ee Pb `` P] [[x 0S pP  0V`1!p PE CC P@ >> P; 99 P6 44 P1 //O-@||ϟ oM M0Pƍ0PD L@ D0S 0P00!R !0w0/0 d 0S   R  D0 0 䠍H I/@(吠` 00040h0\0 0PU @%U PU`DV 0p J0`0S00`` pU 0v0%10P,$0 0EZS)'&$#" E=     o @=;wOrk"8P\P    R\00sX D0S Pb?`1RR`O`.>TQCgˠNP`G0L,D \DPt/0@8D@P @@\P@ @0@ 0@00r@00E`PA@00E S$U ,@DT\ V4 $;0p0  n S !10R q- 0v $ R $@TP@@~ 0R00S*@v b`?0pdP$@0X`T`<`8` V` Z0P00 (Z0P00 Q 40S 40儀0@0S 00 00XX t)l9 0 6 30  oލ ЍUc ` Q`b_@v X T < 8 %1,S000 0Q00S@00儰0AY}R   0 R v 0%!R ` 0 0 $!  0 R [ @DT L% 0 RP`0   , pBWS@0 00P(U0G0Sv Yr080$0S@@0S 0 1 00080S|00 x0 07 `R10P | 0R0 BR0SH = 40S 0P40 x0S-0v00s<0M P P⌰dP0 p 04 0@P0r00000  p : R 01 0000P@/ mdUL000 bL0 P0ap` ?0@000 SpL 0L x  %! * ʌ$ R v  p\  wS0 d Rg bRdP !". #2 e d`$@`F0pw 10  e00R00S 00@d`0E$@P`F0p^P P倰P P*U 00E S0$0 P! 00E S$ @@P@PZ0  p ) : R 0P1    R%Q, |<0Pw0\0`8 R R4 H< @KT@T ڔ 0 RP@0 <TIY\p< WP $   d 0Rb 0P$ K[[ ڔ 0 RP0 )$p[ pGWWڔU`P(P@FpGW    0RP0 S 0, B[b[N$p   pK[   0R0 S[K[0(& 0 \  01S00(+T嘰 pK@DT   0R0 S@DT0(l'0 P @ 0S0 V0P000(V0P00 U0P00 {$ R @bAd@@PAH00Q@P0 S U0P00R0( $HpLWhP0J0A Y+)p l@ @pPJZ0QP0SJZ0( P l@) 0 ^0 Hv JU0P00 S0 vU0P000(AS0 hU0P000(Dd0Uv  V0X0$@T0<080SV LUP@@0 (0;*0 Pp0 6S@0 05W,[`(P@FpGW   0RP0 S 0U0P00 \ U0P00H0( 0CP0 +0T0P00g o@P0P0S TP@@Z0h 0J? 00(   0 R ,0   $  d 0   0 R K@TK$ H $ 4 R00  L0L0$0 S 0 v00p0S R``@D$@@`-0  Pp0 qS wT0P00) V $.$>$ ( 0 `400NSr `Uv vX^P0$@0@0X@`0T@<@.>  0_j.>  0_]W^`P(P@FpGW 0\P0SpGW 0<0Pp0  G T0P00 0]0@0 W RL000  pL0pT070@0 1 RL000  pL0p@@  R 00P1s 0 P X@T RTo`Tw8`<XT[PT< @DpGK0Q 0O8 BXX ڔ0Q 0NX  ARRڐᘐ HX 0Q`0SHX0(  0 T ^0 ]S0P00 S0 QS0P000(S50(RS(v 0Yڰm@``pDIY|   0R`0 S0(S0P00 S0P(o(1<0 S+0S cB-0C R)1ھύ L1BcR0 0a0  AC LQr*J_`L0 _0S0( SL 0 01L S-0`v0͵$0S L000 L000000R 00P 0 RL000  L0+ 0 P  0S0 R0P000(0 0@X0T080?4P0+;  0 $^|00CH0S0_0(0w<00 00bd`\  0pP`F k  g S 0  Sn 0S0 L0! L0?  D R 0P:>S0}0(p Z0  RL000L0  ? @0  RL000L0  ? 8Y0@P\0SW <A0S0S S0<\TX`@?4P08@e`U>ʨXP v XPS0R0( 0S@L0@00 L000000 0p0 w S0 ,  E S b{o\<@G8p`"# . AR t '\ ,\0[PFF \ R000\00SR0 08p   0R`0 S 0H H0H 0P C[|00CH0FL0LSL00L0 000 H <@BOO 0P (/> P⌰B\P 0 mpP 0@00T!T1T XD 0Zl!l1l 8 0Z/h J? 00( RX 00P1<ARF 001 *R5 001 "PL0L#L0PpL0I_SU(@0g\ 0 0 0D 0_pQ\ 0 0 "2 0Z| @B0?V0H@U@b SL00L0 00 0.0D 02p 0ScL0 , L0`L0PpL0L@P ?L@N 0P <(@ 0S P0@$0X0T0 0@00*4<P00E SA@A@00A S$Q0S$ 1$0P[\ 0 0   SL00L0 00 0S0L01 $000$ L00D 0p_ 0SL0 $ L0 *@c@-@`P MDpR@0p0 00U0@Q Ѝ A-@P`pQ0 ?0@QO-[T/ M p0Piqa \ ЍO{[D{&{83`):Fk{J @ H 82k0 c01{{&""{ {0 k{{& {0 P{  { x C $00$0XCZJ40S[00SWpP( @PPU 00S0SA UPYH Y @P= (KP9W;  W9RpG  Pb8w@P&@P [0 (0P(0 ?@?@$@$$0SW F 000 0 `0408`(P pP0` PU8$$$0$XQP 40SYWQ+ 8` (Z 0SZ  pP` U 00 E0K[ (K0(0PP1 0`00 (0S0P(0 0 <0U  p(0 !W `S;%{K0F[kF{7@{*0 0r  k[3{Ck6{9J\0 0R?0S@ z0$000 P {'{0 {O{;0 Q {'kkKE{{*N{7N BB*N@{*0 r  P`w< `  s0R @0P0`kW~ 00 pS`C  @P 0Z 0P0 P p 0P00W0SpG P)pP   ! 7VPP 0CS{  s9R @ r `  0P0010b$04u(P]00C 0^@P 00SL0SR E0 LMWXt 000pPQQ@0S Y Ys U8`a@P (P9X\ 1 @$?@$@[ LP0: K[{[$kk0kP0C [@0" % %A|0P(00@   1 @Q Y! Y {7{E{ P@e P@ 6W?X 0009 QY8`d 9X a9 pP 0S0$&R !**R Wp@ P `QP `N(W0SEP`F 0SrPU1 000P ({0 {!` 0P0 L0S E0LL)P8`9X8` WE 0 L A-@P` VUT0p  R *P @UpR UT@p@`@UpU@P0D #460/\460//P@-@00 R@yP@Rp@-@`0P0RP*h0PpP R 0 R VpP 0@!O-0@ MSY@DPqapPV`q!%:0  &^ ^ W0 * 0S  BX:X@D*0S @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ-0UM 0,@P.0L10&T {{{ {d 0 B      TTm ~@@-(@-8@- RC/A 0\R#R! R/p@-`P@ TP P0F R @P  S00pT P,0, ,?0 R0P~pp@-@P F`PP  Sp0 :0 {RL~<-M Ѝp@-@ P` !LNO !@Ap- MM ЍP/D -0")2b3c1@2`M1 QЍCރ0@-@PPM {  0{ P@p`Ѝ0(0( (;0 R  | p@-0@Q r P p0 S P1 p PP   ! S @0O-`MpDu@0D0QP095X! @0S S[ @O 01 aPn P T@@<  0  "W @TQ @0T020$  0 W` ЍQf@0 R AX0P @0   0`00R.@0QLW 00000`VBQTQCp0 0"!` b  V0 ;T@P@00jS" 0 @000} @ 0Se0T0 2a PPl"! 0#000 \ @ 0 `@P 0Q/ R  B / 0Rp@-@P*`0B @!S@ *@B@DQ@@@ Q0  `f2& pS@ * A BP   Qpb  PPO- -pM@ 0kD 0(l x t0`-P-+*)('&%$ nu000P0 0 00@ S 0 040P@1T00PCT!Ђ0 @t@00@ S0\ @0, EQ!0 00 tp0t00+S -S0t000C ^(0Stt00S 1C\8Q 0l0 08 000AS,d S^ ?o2<0Zg{0T@S{pp S ڐ*5 g{0[1k{{05[S,0S ,0S, %0aS*pAp|0 @0p @pw Px |0p0 pLW|0[ |0p0|0  A R@ Q HpCW= Qx pqm0p00040 S|  @00S 0@000(0 00T ,00 8S B ۟˟p?H0 0( PT0P@h Pz  T ! Px0] @Po x   !PpP|`; PE ` R(0H0P  C0E(H PP0C PEP`PU00 S 0SPE`FK(0SEQ;q,0SV[  P2 A PP- 0S0S `  <0 pSp Pp W= 0Sp# V`@0 S0l0 x [0[` KQ 0Z00S800X00Mc000p 0#Z00S|0L0I hd `P dQy{00xS  ! x Px 0 S B\w@0 S+p 00 B0p  WL0p |000C?o82Q0S )K{8Ik{GZɋL0S    0SpЍ ?@<V? 0Nl?00XS `t`0P P0 0x Qt000Sl00l0R x lЍ , RiS IS NSt@qP 0 l0000t00(S 000nS 0x tpl0P]  ^P00CtT0v @00C Q,Qt$0t000pC,0pW|0@0*W.  @P htp8000t0PY `00W'"R20{|r@HТ*:?C0C0  Jk'AQZH@ rR,zGpGp04656 0 kF @30@{  0QF @0S t00S l 1CQXt`0C00000QP|0Ct00C YLt00N0C YL\>88Z8a8[x- Pxm p00p0xt@P* t00Ct0Pt0 0t0 00000x l0s|0pC,0p|0@0pg  4k01{{{pc W'"$450{LuXX@HТ*:?C0C0  Jk'AQZH@ uR,zGpGp04656 02 kF 50@{  0J<0 0l00 0 Pz|0@00pCW p6k01{{'{PvV  OV 0I8pX00p Px  B\0S> p 0 0R0p 0P 0P00 00@b _ Pf HP^xS Px @0| 0C B@0|  xY0p0{k V0 0ƋX00000H^8pUZk書<0jSI8t Sc Njfpqa `P_{ڃ{I{7{pl0X 0l00Sp0KS0 x PxB  |00C |0  0u sqPom |0 R# 00S S S\ x^0x00 l0000 "AQ!*L 000  0c2300x S 40S 0P 0l 3N"0x 0l0Q000l0{ @0l0"N"0x 0t `BxPx |0p0C|0 ??A?aNG_000 l0x0 M"00 0 0000P@m!0!l0 0I8X00{00<000c<0 100Y000 S00S0 00 0tx0$Pl0x S0tpp@00x@0 |  |  W p00[o K P]px @0p0C|0 kPxQ !\ \ \ \Qxʀ0,P^8|0"S|0|2, 01H0|0@0 0&| H0 `0"k <5S,0Á!{{'l 0 G  {2P p00S800:80X0相00cX000S 0x000 P00 @0CXPX!Ђ \@\00=0=0 480< k 0  B1{{l00{0 G P E BI  4k0<   b{,{' A1k{'l00{0 pE0S! 0|H05 `fS!00pl00Vpn 0S xp0 |Q0{ ! 0 00C lp |0Vpd!0Zl0 0@ R0PPO IP0l0|0  0Cxp|0XPx> A0P00l0 .0Sg  @ 0 00lx 0SW 0px 000 0|0P0l00Z!05 l000# [00Sx 0 VZ 0l00p 3S~ 0l00 Px  p`1`f`Pp00p0!0l0@0 xSl !0l00Sy0S40040s|0p 0C|0h@-}00[G-` 0Q`ppp@PP  PP`q0s z #8 *8"80 W# G B0W   3`Ea V F A0s#8)8RᶐL0L#Y 0U 0 Q 0SPP   ! J@P@O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WI:Q0 [ \ 5 0QR T0#03\0SuWa*0 GV*0F@S3 F\   I0WN 06S  ЍW*@DPD@ Q0: Q0Q l  l>P:00XS Q0p O)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0 |O-M<0 "XHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 00Vp@ !HT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0SPX 0Sa ;0 0UX 0p 0 Q U P  U UE^ PLU 0CC10BgP0DSy`0 S0 S C U 0S S S IP@"00ЍRq  BPP+\~ -\  L^ ?L NZ @\ #L@NT @Pl '@Ѝ \ 0P@0Q 0S00 LS S80S $000 0 b@0fI"00@C }`P `D21 2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf x0 S_ I@"00Ѝ@P0M@E PL `K"V`pKW  ` 21p 7 ` PEG@QP!80Sj80S 000i U U EP 80S800c8080S `}T0)  RP!@L#80ST80S P 0 0  B P\ \vj 0`e  BR "@` P3 `2 c 1P5 ֈ /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPU 0 BP @` pV  0 BPp0U`890@-M@Pe a  0 B0C2S  6c@ J@{k Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ F0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/l@A-^0000PbA1 !0T2, l!p(  T2,0N10C#10R! T TNNN1^0R @-P@M: Q @ 0 R Q ~@ЍA-$a$1`pP0MS3 U10AT !0S 000 F@T 0 0S00 0Ѝ@0!0D1S<000մS 000ʹ hp|< w0p@-@P0p R pPQ`00App@VD `᮴80 0QApp@袴 $p4<0  0#10/sP30s R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P;pP   ! E`~P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  D  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1⣳ zPP4 @p PU `@00SaPP# 000S 0y0tPU 0C  pPph0biV0S <0W ,0R0i 0Ppq<BpG-P0R@T`塢ڃ0TP$ Zp  !pD0   a!  \2)0L0C\0003R @@HpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @00S 3 #V0`F`F` 02NS @0@PpP 0!Q@3A! p@-@ AP`DD 0` P0R @ *\ l1 0DR%& 501 P%&0;Bp0R `5,#511,?C-` M[Tp>P Đ4$66U0P 0Y0 0 CII50c0 Ѝ 0P c2# R   Y C>C0C012`0S0/0 R /@-`ap`@PM= H1P4PP2 #pP,0S  Q5 }p 0: S.zBP 0uPP0@ 0$  0,  0( 0 0Ѝ D00Ѝd0d dE0 A\PC00CO00 `(]X<p@-@P 900CS00 P9pP0 =0 Aah<$@@-@P 00CS00 @ 0  I0 }A;`A-@PpS 0rSL wS aS_` C 0 \`0S! e C+Sr ^R)# `0S``0[S0\S0TS0USP`0 >0 Ad:8lp@-@P7 0S= 9 P00P! !& 0S 3/PP೼000P @ P 00 `凸00aa9d0`` 0py[6P404 480 @B 0P0^H9(p@-@P 00!R !.P 0C 0 ;0 @]8@-@P 0 0 S 404 40; @0 0 S@6]h8Tp@-Q@PPE 100S4 0 XV ?000SD 0#$0 3/0P:s007p00P @ P 00< R 800p@0PFỰ 0 J0 ;@5P00s06  0@000 pNB 0 @00 dt6[X-Ѝ/p@-@P@TS S S /B 0 pH0p@\,0p@a0p@f@600 0 00000/<P 0p/@-B/41Su C- Pq M  a 6/p0`@0A/`ዯpf APpMOĀmZ@Q 0p2hPU`Q 0p'hPJQ 0phP@ Q 0phP6Q 0p hP,Q 0pgP"Q 0pgP@Q 0pgP  T Ѝ/AO|A,aQ@-P @41S  P hP0^AA-4!@ pPP/1S 0L1巶 @P!尶BPPPUQPMoPP Qp ᖶW !Ap_oRApApp@-@P 0@}@A-@`=P] VapP0PQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V @0@B@@SSO-P M. St$ATp`$q(a qp A`TP XX`A( [ʋ Q `0(qS 0P@  Ѝ0Co$!?P (xp ₰\y Q @pT`x^y0TC G(V: ( $! AT$$( [ `( A^ \ :0  @P@, R$!I(1s V( T  0 = 0 =0 = (R 0Q0(0$ 1@($AP 0 mPh D0^0$^-Xl-4l-O-,M0 0 S ! rp2/0, (Q0 <Pu @`P@P\%$P 0  CZB 0@PUpWW 0 `PM 0@SP㲀1UJ[K ,Ѝ 0 WlPPu/  $`lPB 0 $ `P# 0@SP㲀@1  QP\ \4 \  ᰠZ"[ L`PP  ?dP 0 UgP@00,Ѝ$`p  0pilP   dP(q@GT 1S(Q0 @-@ ! \ @,> 0 ,1>0S@-@0@ >00,1R@-@1  @0> ,!>0 0G-ḕ0S MB Ppw`ڲ@P WQ   | >P 0 p P0, eş0  4` 8P  D*=@ &=PP X PP0U4PS 1P3\ X\\\@48 P3` ZŠ   0 `$ -ePf33  JF<, 0(r zPQPXIK KP  0p '0~ Xk PUh A/ Qp APW ` VS@ZO2  !2/@PG(P 2QPC aD0!B1\0 Q!NX QgW0 pp$4q$ذPx b"0bP  @0B 0!p PpލOp=p| P= 0 p=p=Qo=`V/ P<Ƞ*  008P4` aD<@ <b=PP R W=T=@pN=pK=p0|C=@>=@ XaxXO-(P`P10p5fS@(Pp5 RؑUP- (d ,0[ D D S 1"1 Oafꂡ P ر $ J; _ؑ@-@ 13/, (Q0@-@Q _.00 2< 0 O-鴆MS`p & 0Z0 P!U E Q[ [ R Y 88YYY  <00 Ѝ P 5%0 ؕ !@P 0 10$!12唯P- 0@S0 200t5V00h500`50 0X50 0P500H500@5000 S S S<00P p ?ᷱ 20 2 801p  *0aUP U\3UX# 2Z 00 20120QSE  000 1S 06 pE6`@V*v`V`3w`0 ,P0 "  ,P 1S0S1S z-0 29 20 29 20S 28 2DR3S # .  P~P s R < "4 <(P0"<S 04,8<004$`8, 48 |&4 <0&<$0%4<0 %< (0.4<0.<,0,44<0,< $(00*4 ,<0*< 40Z$0SW(PJZ㪠O*z0[* C00C 1! 0Cs0 1! 10 0 00(0 0S 1S RV  R[K  &q 2 Y 0 xpR & 0R1 S0"1!x1x!xb0 !3P9 & 0 CIY㩐2*yI Z0 0bP0{ ! {0!10CS` *v00C[010{/ⰰ1l0l lb0 2T0T Tb0 2400 \ llkkkhkxO-(0p RMC @a0kP`0P P FP1uP0y1JZap@0 R 0 1S@10CS㣰L* 0Ks0S0Cs00 VqS10C1(0 0S Ѝ@ Q! R0(0 2 0p. 0  GPR  0R1 S0C1ȁ sp P lp 02"b0 62T` Y 0I p1P QPEUP *0EY):YQNQPEUP:$2$"$b0 2u00CY Vp崑 (00(0I1!0b 1u00CY*0 p1MPH Y Q %PP @ PA9P8(00 (0%0!0!0 $PPm 1P0CS㣠)*0J 1P(00  h%`@00 0`p崑Pq J(00(0 Q%(00(0@0@ @b0 1h ihT|hdh,hfXfhp@-@PQQp $P 0 0"%Q $P 0 0%ppO-P,a V0Fh  1{$@P `Vp0ഀ0 0 kpo 10CS0*S0ST PP 1!b0 !1  H h1zp0FV㴠p1p 0 R 0 1Sp10CS㣰4*0Ks0S Cr   0Z0s00R10C1 $ R bP  0! 0 P$ $(0( (b0 0ddc(Pc8O-Pp@Q$M f$00 2T T 200@$Ѝ(  @i @$Ѝ007طا0 0 [`Pd  R bt@Y* P 0PA 2@D @T㴐: 0 bt@d0Y:1ᴐ0CS00 01*S0C0  @P 0p 0BRs00@010CS0*SP@0 Z#pP 10CS0a*Sg`0 @0# Pq  0S @ ĵ `R 0S 0 #q,Y@ t@@DV #qY 0G 1#P: A`W@DT@: b0/4$0b /0n {#4$b0 /1 1@0CS0*SPN _#T0*T6EP@ 20 2$Ѝ4$b0 /T @#3#b0 / 3#TE@ @DOoB33#b0 m/ # # "pPP @W1 @t@ @01` 1 0@1@`01" j"P@ Hx 0  " X"P 0 !@T| "T{ ~C100q `  " Pd 100,p Q^ [[ "QU`F "Q0WK `0E 1"P? UR  Br@!V@ `F!( 010Q00P 1@Dt@@v01 @1 0 t" !P`F 10CS@: b0.  ^"  !P P5bpbT|`<\`D_Pt_\_8_ ^`^p^$L^4]]\@[\@-@PM 0 0P Ѝ0 50 n.  Z`O-Ÿ JM M@Pč`pPg VW00?470S 0SNIPIT/ 1"P l000L"D2 0 4 30Jލ Ѝ > 0X0 0UXS 00; Iv0. T:+[) P0K/S  0h0P00: S *0000S0I S 0?00$1$!$?0 - QP PV# 4- p!00S X  \0 RK [ !P/00W !p x P /@om n m XxR Q0P:Q0Q:.@- @-@@ႝ $ @ p@-@!P#5*`P$ p@Ѹ0 0@-$M @@0S 0P000 00 0 <p 0S$Ѝ0$Ѝ00TP 0p 0S0     0XV$ 4 0O-TM Pp`0H0 @8  8$(4PD 0,0`< @@pLp PP 䢟䒟䂟`p  @$ "dXb`%0# `!,l(a `& `zcna'b(*abf ` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah `猈b,) &`dL(bdl+`|.`lXpp<%cjgpl&`` `ga*aldH(d` &b() `b`j+g .pl\c:%pWpl̠@|h>D>X@=?C-Mp`.@P%  )PP 0!0 000 0`r 0@@!! 0 040000 00i@PЍЍO-M@ p8PPc 01 0 0 0ءR 0ⲡ 0 1ᰠ0CS`8*v0Z? ء q`PG  00 00 00Q㲡!0 &P/ 0 0<0 00! p(|Vp@PЍl l0l b 0& 0p!0@P_p u҈;d;xO-dM`0匀pSFL0H @(804 00 qPUp X;*1$0Cs0 11 " r  00(0H0LPS  a,ZG 0)  ( ($  00 00F 1pP% `V 0`0v`0CdSU HLp   P  HdЍ0 0封10CS>*0S00000#R `V 0(p,0 000CS?1!00 0R0 0  00!0VS00 HX㨀*x戀10 0 \XP0TXP2/0  S  0 00 !0 00 0 궄HX 010<0qpGWp*< wpp0qሀpG0wp0qqᰁpHX㨀 *0x0,0LpS^ (0S  2 0 pPB  ; 7aZG P 궄HX 010<0qpGpWwp*W  0 0 sP:<1  刀0C s0 11qpGWp*wpW  0 0 sW0Lp0,0 S P   dЍ 0 S10C$s0 11  R00000 `0H0n 0 4P 0 0 0` 4@p00A H P 8aHX㨀&*x0V* C``F '0,01`01(p>a` 000000 2b 0$"2 b 0$qpGWp]*wpp10<0!1 b 0$+!1 b 0$qpGWp4*wpp10<0 X!X1X b 0x$wp* P 2 0(-p00S ( 0 q$ 0\$b0 $V$0!l 0 b 0I$ 0 b 0?$p00V9:2322ɜ2x2t2P2d 12Ȱ383 d1@1T<11,O-M  @pPPj 0SB 2 I0200$2 002 0 0)  봀X(0Q< S   `PR A`@DT@#*t@@D @8 P 0RX @0`10CS@(*t0V 0Ѝb0 #Q 0崀 @`TЍ  W0崀|0| |b0 # Q P 00 60<t04.tŸ.O-`pQ,M #00 YY 09J  (0IY 񏐕fb0ISw%00@,Ѝ(0YQ '帷帧,0 P1 pU 0pP1 0P1 pGp0 1 J@P QPEUP: 0 b # 0QPEUP:uP 0 Pb #1q0pGP 1W p: 0 b "1|||V,01 PR  101 01  @P ! BR : 0 b" @R @P V0 00QP(0r00@(0 = P 2@ ] 00,Ѝ0SN 0SK 0v@TF @R 0hp@7 0S "0!0 . @P& YJ YG Y(0%QUYq  Y#  @P 10CSP*PEuPY P @R  Q0(0 @R y@ P @ Rjp @PEuPR c(01Q0CPS㣠uP *z0UY> P U 7@PQ PEUp @P: 0 b! @2"b0 !R @, 1 P 0TS>A T0D@ (2(00 2R0 @ 0,y0UUQ U0E  1s @Pk 1PU0CPSuP棐: 0b !1!b0 !N0CsP 0@NTT  0PEuPD0!1  0 PC 18 @P0 10CSP: 0 bq!1PP!0 P 1 PP @@ @ R P,- ++'(''D'd&&&p%p@-@`PP Ҙ0 00(0`00Q(0pO-@`$M,  弱 LpPJ 1p0C0SsP1*U7 PrU @t@ @e 0Es0P P 0%0!01@0 @ 0[ @Kt@$ 0b t0@0p 0$Ѝ 2 @ TQk10CSP:l4l$lb0 u0TQ0 0@p P P ἑ0P0 N0㼡 [0 30 0300300 u00CY0 001뼡 [} 0J 1pP QᴐZPEUP:b 0 e " @QP@ PG 10CS@D*0D@ 1PP5 0㼑 [0 뼑0 [_ P0I 1VpPx @YT 1 @Dt@ @U0PE1H e \ @C1!b0   K0PppGw0 1 01P01  P0)0Z!0s00 !p̰̠ 1@Dt@@U0PE1 @10 n pP 10CS@:L 0 b$##P#"L"L $t 4D000/ @-@P L  0 0@ (] 0 "O-@P2M0\0(P 00$` p @ ` pP0%0g#" 0," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00Ѝ4HA-@PP $`?(p7 )0(0 0`0$0d0N0  Sh  08R(@R )@ b08 )8 b~$0A-1?`@Pp @f(X4 @$0刁0$0 0@pG0( 0p * ?W9@`G?`@`(`0@ @T 0"< T"?pW (q"0 "?W@`G?`@``"@@< T"`R @-/ Z@-@P P Ό 0 0@ (0 "8R @-{/ 5p@-@P X00m]\`  0 P0 $$pO- 6LM0^o~?,00p(@ @,@@0@ @4@ $@8@HP $D( @<@P04P@Pp `( ` `@(P@P$` .w0` y  ,`0 .) 'p',') "!p00 "`$   " p 0%/$! p   !p 0 ($~o%arp' +lc  !``&``&!p` 0,p `Y$`3,0~?000@4      ( 0! A"Ġ0̌? 0#P$Ġ_̌#,,0#, ' IG) "@P@P@!W!IYG`%KD "@@Q< ! @@8`a` A0iAqNf`&@4p0yAvN@$"#%C$-Q "P8`ˠČ ,0`P0@0#<`@0@`Q `.0@@4p0 P$ 0 /P)Π+! Œ,+N /)! B(p`@$,#,@$ &` .` ` " ` .0@,b0P PX $ X DP0 0 0 00 000 00000000000$00$0 0,0 0,0(040(084000 000 <0 0< 080LЍ4Dp@-@PP 0 pRPQp b;o Q70P0L0@H 0D0 0p@SR Q b"Ip D0A-1`@Pp fPX5 V$0 #$ L00L0H00H0pGPpP +WF`G```$;  S$P*$0 $UpW Pq $0 #$$0 $W`G``P` $;  S$P*$0 $U`R @-/p@-@PP M0 E8R pp@-@P X00k]\`  0 Pv0 $$pR @-P/p@-@PP 0 E(R Sp0Ġ@-@M0 . 00Ѝ00@-<PM0AP@;P񏐽ndn<840PLHD@<84}yuqmi}yuq<84KJzP;DPnE@5Py|{xsrqponmlkjih{xizQPedMl]\[ZYXWVUTSRQPONMLKJIHGFEl[x5P l5P 0P9@0ĠH 0P%0H p Hߍ0?CP 0P0 !@0 ߍ00= @2S, DP00  L ,0Ϡ{000H {Wp l0 P@000H AFp D0/:0 0 !@0H ,p HP ߍ00 d0 F0 y@0Ġ 0P@0ĠS@0Ġ0 d0 a0 ^0 [ 0 0 0 0 O 0 L0 I0 F0 CE0 D0 C0 HYPFL)HRP >0 *G0 @0Ġ0 0 x0 u0 r0 o0 l+0 i*0 f)0 c(0 `&0 %0 Z-{ {@ U 0 O0 @0Ġ@0Ġb@0Ġh@0ĠB0 - R  i    <xLxLxh\0 $0P P@0H A:`0pH0<0 ,0 @0Ġw@0Ġp{G-P Mp`  {{ UY B@0S a@P_ WP^ T 0S8 UP Vp5 (20 R I0PX U`d  R ! @ W@ ! V ! 00@؈  Ѝ VpU0W T1P0 W@V (! 0S1 0P` @V0  0S 0P`00TT >00XX 7W0`|  @Q @0` TT ! dwXw(v Ȩ Ȅ P uuupuT 4p@-g00@T 03/@T+PP |0@T 03/@T\KpH00@T 03/@T$*p ƌ Ɯ \  @-@M@P Ѝ{  0{ p P000 0A0 Ѝs$($O-p@R M ഁУP `A80 S! 0SJ: H 0 Z 0!80S7  0Q?0 3 0 0 Ѝ 2  Z  0  00 0 P 00  }P00 2  jP   cP  000@-0 P R@MPQ ! 0 013/Ѝ0s?0r? <P100@-@P0U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpG-`P @P0Sp:ؑI Y `1`! x  PU p K @PЍpP pPO-Mq0 P0 pG 0  PU @P U`1`!   5[ 0PU0  ЍЍ0A- P@ P 0 a`F P@D p|V: h P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-#81 ,Ġ̌%T\$DL0P  R*0@ :#Ġ01̌  R* R: B0@-#81 ,ȠȌ%XX$HH0P  R*0@ :#Ƞ01Ȍ  R* R: B0@-#81 ,̠Č%\T$LD0P  R*0@ :#̠01Č  R*0@/p@-@Pp00Sp 1` 71!004  4PU 0<  R<<T@P\`0(A@ ᒌ0 <01248 Q!:0 S p<0<P{ Pp01G0(0 F@p0S(00S0!@Q0: Z Y @c/\%c/! 0p 00S 0 Y@0 SR@T ;00 R 00I"00t'd7 0 2 30ߍ@2S@70< R,000 4`0`\ b,0(`4`,0(倀7P 0  p (pV:` 76(0_Wࠓࠃ604< X00So  0\ YppW` p``!XY0•2  \<Q(( Q )`p00S 0 SR@T 000S00t<@To 4Xu @ X`@n Z`D 0ST 0 QP X^Y@LZ 0S,c/Np* Y3 0 SRb@T o000S $0S  !z0 0S 0@T` % S P0 SRPU G000SV?00 XY@ @c/\ p <@T0 SR@T  000S/00c/\@@  X `2 `0 R$SY`bp]Y``2 0p P  T0  R\ 0(0QP0 P  PY   T`X/oT" R@pP T 04S`X# @@@4VD 0 W 1DU V W(: 0 0 0 30"Ѝ-@@@~`@ T X _Y` `@ T`I`~U t 00o @ X , p @- A0@ @ €1p@-P@Q T0P ! "0 2pp@.p@-@P` VP#p0-P@  P 0S RP0/P *0?c0 ?oPP0/0/R00 B-ptx` PP5y  R i  ` RPJPN P?e0 ?o60⃑ i`PI 0 08P?e0 ?oP 0C!P05H RJ@+ IP?e0 ?o5H0 SP RZ 0P@ 4 0S00Y+R03<PR#4@@PPrR PP @0!32P#4@@@ P5`P_eP _oA/@-4!41 0MQ020' 0S0. /!PR*/ "RR /@ 1@Dr0Q R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ 4 L x LQRO-`P$MQP U  "100000@b0pRppP0@࠰P㒛+ 0` (P   5/P   5/P 2W00Z & 0 0J AQQ0@A`HQ!Q0Su*R*0RI: Y 0 C0000  5/P G00`Z, 5/PW W 0 S  0 0S Z W  0`F W0 [W000000S00R*R:  :W0 SW 0\KWJ 0\0 0`HCAQ!QQ 0CP 5/P ) 5/P \!0  05/ P 删  5/P 0K  05/P    5/P ڈ0F  5/P m 5/P  5/P l 0WC>0[000S0W5/P `0`Zn$Ѝ >   0@w N !0Q0 0`HCAQ!Q 0C!0Q0 00S  0 I 5/P n 5/P f  5/P s 5/P Ek 5/P T  5/P .K0@哐*Z`c⃀Y*`  V@ `5/PzW W  0 T0  5/P  5/P % 0 R0@0@ @l0 (0( (k0 s<sR Q0P:Q0Q:@-C- 4PS@ M  $3/`t0   PQ` r}4P4S  $3/000 Ѝ00A- 4dpV:@T@T 0P0S  00 S  0ʃ@P0`0dp@ B ! A-`M pʘ@P0: St妃PP ˅P@ P 0  tdЍU00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0U? Xh 0SL@-  00AS 0nO-4MS{@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0    Ѝ P@ 4   0y PQ 01 W|$R P0)[ 00@000dS0  pq0Vp 0  $6/Ѝ 00z00vO000Q 0A00/0@-S@  R   0 ΃0SɃp@-@PT @T 0 `pp@T+P`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 !!!0 ?oP//  0S RP/0?c0 ?oP/@-P0Sp@M:Q !SV@Ѝ0A 0` P Fj@Ѝ T 0 @00O-PP X 0S & % 0S" p@p" a,0T T 1 ! 3/PS00CS@D0 T,0@pVP ?0T` BB \|  i V`!  0 0C00`@000CS0 0T` @pQQ  z D R ! ,03/`PIʼ0@00 "R( Y `1`! 00PVQgRJ ,03/`PY M 00CS@D0 T@0Tp   P @0S*V*  000P@DS*`A 0`V:⑁0P 00``F0 ``i  0Y0C00 00oP   00C000Z`  000YP sd0d dG0 XH0H HH0 00_ 00[df8<@fp@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 V0 N 8e@0p@-@P0 S0 PTpa 0P0, @z Pzp dR0 q R/ S/p@-Q@PP8 100S 0  R 0   p0 0c0'   0R0B 0 P @P ~0 0 $0s0 ,0, ,<0 p <Dc0p@-4aPP`p@M' W/ T7 p p5P0:*C/o" R/  S L 0( 0R Ѝ ; 0 Ѝ0 0 Wd0d d0 TH0H H0 | ;0 @b8АДbh|a@@-p#p3 lS0lM@PP0d00B 0 C 00  $#3 0 d0 30lЍ ~0p0S6 `~0P " V000`S0 rrhP0 L"L2L |0  0"020 0 0S"$`@ Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!`00 +{ {*{ 00{ 0SQ pl 0M `` ` 00 ``pP꼵  ڔ ڀ <`TPΠ`,lxΜ|p@-@0MPnx00TapyV( vy0T1S Ox0T1Shy0`[y 00UTX!\!R Ѝp@Ix\!Uy00Ѝp@@x00UX\! X\!0 000S/ pp@-0 00PUp@0x00TQ yU0` TQUP xpX1P0X1y0T0`X1 ոph0h 000S/@-@0w0X10CSX1 @wT1OKx0@w p0 000S/g Ԡp0 000S/p@-P@0wU0 \AQ\ X10CSX1 p@w`x0T1Ox0p@w xp-X X0 04M 0,008 00 0 ,0 304Ѝ˴ Ӥp@-@QP  p@$ 0 90 @,t~ZHO-MD@؃ [0`P@HpDVL U0DPW p T"S 000@0`Ѝ0 00 0 0L0P@ 0S } 00x 000S$0S Q .[ 00SV00Ѝ0 K0 0V0 M0 &W00 Q0[00S0S @ "00@ "00u XutXt-M{,0,0 0{ {000{0mЍ hp@-@PP`& 0S 0 B0 U  ppߐP%0/%p0:0pL0L LC0 404 4A0 ƔWlWHW$p@-@PP`M/ 0S !1 U0 U+ 0  0pp0 0pq 0 p:p0Ѝp@n0S0pq0P:s0:T0Ѝp, ,0, i 00Uh8TØä@-@P 0S X X0X |0 @pp5, ,0, {0 TtPTh ㈑O-PMp 0GW"S`@P-TP0| +T S 0T W p  Sv?00  0 0 P @p Q 6 P Q  S  R-  " Q 00Bs ^a0BSW0BA0BS(70BS%| YZ  P Q  S  R " "00"00 0S \0F0 ЍS@ `" ?00 Nj  000 R0  ЍS@`_ i0T0] XR" A B0A PR W p Pp pLP0P P?0 %'p @` <W6pp6lPd00 0M0Ѝ 40 0000/ |0<0/0 0000/ |0<0/0 0000 / Ȁ|0<0 /0 0000/ <|0<0/0 0000/ |0<0/0 0000/ Ǵ|0<0/0 0000/ p|0<0/0 0000 / ,|0<0 /0 0000 / |0<0 /0 0000@/ Ƥ|0<0@/0 0000/ `|0<0/0 0000 / |0<0 /0 0000/ 0<0/0 0000/ Ŝ0<0/ @/ /H-M2 0ЍH-M 0ЍA-`@PpA8#pW 0P@-M?#O0S!/"  QO$!Q ЍG-P@`P pR#W  ` SRR Qa 0Bi ?o/o0CS 10c4ÀWR' /o?o BR 0b14ÀO@ϠU0P0 T R∀ᣟW0 0C W0 0U0e0?oc104/o?o0Cs! R 0b01ÀW W00b0?o0c40@b1C<àQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /| 0@-@ P  000 q/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 0000@-Q @% ST 0 C0 P @D^TPPU0N QP Q  00S@R S Q0 S 00 /U/ S R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ ^S QNP  S^ PU@Q @0S Q RU // Q#/   //s R RS0  0/U/00 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@RP` R V  U  R 0 p0 0 F,RQp@-`P@ 0S0 0 0R0  0p 0   0FlR S 0Q00S0 0/0 0/0 // Q#/-Q S  BPQ P0C SP PU0-Q S Q P 0S 00P 0@-M | @*00΋΋00ȋ ʋ4 ,0 0 0 30ЍZ < - BMMRč `` T @P 3 Pv2   lL`0@- @-ßs M Mp$ȍP|`@M TF "  r" @$@`p 0 "l2 0 $8 30ލ ЍB^T"P0 @p 㟉0 B^P.!0 x100A@  0 r P0 \ AL+\ -L+*)B'&%$#"   \P  i\\\\\a1 ft ft 4`BpD0 e  d|0 %0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A0@-0M000 000@>S@P  !0#00  :P0ЍM00 0 @-0M000 00@>S@ "0!,03,0  P0Ѝ)00@-@኉@芉0 00/ -$0$0 0M 0Ѝ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ 8p@-@p@-0@ ,p%pPhi0Pp  ////// ]//1O-0pPW`,M 0200000"00 ( 05/,Ѝ^@PK 0S PPP S0S3*0! 00S S( #S1 0 0S  0S S * Rp C 0QW001 00 S0000t0t t0 *0X0X X0 @ 8    p @ (  <9 9X///O-QP44͟ MQ0Z Y7 < 0 0 0< 00$0 0%SS  IS| 0p  0GZSZXWUTSRQPMJ7~}|?>=<;:987643210/.-,+K)('&%(#" ZU  {JrW  0`@ 0,p`,0\  P [: Q Q0 [4R BV Y ӄ ˄@T*a 0 PCUPE[ 0 [04PU*U 00Gp! 00G S[   + 0 00S- r0 /0 R0 bp< p*WN 00G S4p00G S-p)p&@ 0S Pu   0 P 0  BU@a `@Atp xp0 $   00sb 0SP00Z`@0`0 ` R R  BL \   [P*  QNAQAH0 [4Q*BI  0 0 000plWp p0` 0@ `,0, p倀p@ 0 00 0p 0SP00`0@0` <  000s  0SR00w P0!. 0 c0QP `EVS @F B cV 5 00X  000 0+0p 02p/ 0pS 0 0)P5 00< 0 0 0 0 pS P0" !c h< 0 p0 j R0P0#%:@```)a@ R`D<!i. dT0 ` c/*0  C0Cv P 0000N0C0B e [  04 AQA Y˄Q* Q Y# Y  0Yp˅0 0 M  000 0j0 [0K0"2 0 0 30Ѝ0 0 / ,  0 (   @ 0K` ` 0@@2 000* X0 @r    q 0 @| p l@j 0 0 i 0 02@0 r 0 10!1  0Z 0  0@0 @r 0 00 0]00p0T0 0 V 88h<0 T-,<T,`^L(A-@P@ `t0pP@PU J0PES 8/`uX@pW$0$ $:0 | \t + 0SS S 0R / 0R0@o/ @-oO-((@ CM Mp4čP`q0@ j 0 @0 44 30+Cލ Ѝ 0p `0prP =rt 0h p$L+  k  0k/2 4 M G-0pS+ S'QU$ X!`@0`S  0P 0#4@0S 0S0S0S%  P V Q@0 R!R  "$0 R R \O-` BMMVčH1 0!Ȁ Pp `V' 0  cP@P USdPd0 ZPD@PH <0 0 4 30BލЍꖥ  O-<< AM @ MTč1 0Y,:0`x0(SPp2 0S"W0 0@T dd0  P pW p   0:cPL @0 0 4 30Aލ Ѝ0x0(S@  O-M Mϟt p / 0 s @T 1S 6 S `1  0 ?l@X@0 0 p tC! @0H0 ^0S3 S90PpP@u` R PP' p 0 ] 0dP R!R㇓ :P PpU`@P0ST `u岀0S`V@ 9 S 0S< d - L - @ T p P  Tc0 <0040v?D0\@4 0` S1S < 300S S00X01< 021帑Y[0H0tSp080400SAT <0CP D0PpPPw 0;O8@  ΤP V@T0P OP  4 <0 @4 D 0 T<0D \@0S  H0SQ /<002p0^ S00H00SS *pt`P|@600P @9/P"8`0 @ЀPF 0  P{ |*: 0 6 30bݍ ЍpW 4@P{D0Ppw} !D0Pp0 e  0 : X0L D0pd4000S70X08<0PS\0S  P@xU00 `F P/$P0,0 蘰 P(00E0, XP [0.(  QO `1  0 P90 X0L@0j Y  @00@0'$0 0 0 SO@0b0!0Tp?A9c!"P @0S <@:0P #o0P(0@'    ,@0P@01 Q!  (8 0 P0`1  0 70TX0 @00 00r  1 01 0@0`1  0 $70X0 @0r0 M 00 X6PW0&0< h X⩇LP 00 @q @1W㲐@D0 `TPv? 0WP G  0‹2 0U 000W    ‹0v@1粐0 0 l5H@X0 p0@0! ^P0D pb@`0P In0$0@$ 1  (0d00@03n0$0@D$D 0 AQR `1S9 0   0@ H0@@`Tiʋ |@ A`!!! Q=   30 @| X0Q 60H RC A aV *Pv|@0p t@p6/P񏐠0+S .0CS@0PPPU a0 2|@X0 0`!02 @@Xi S0\01S< 3`0`00S S8P16 d`0 P00 `|~P101@PDy"`hP p ` &~0PW`0P 0D TP Br R D0DI 3~PU0d0RPP0@K@ d06SH[F    Cރ(@x`H, @H(08 0_6pSX06H`s DP TP Br R D0D }P0d0@0P l0 0@! ࿅VW0 0R 0`1 g 0 @1l0XP0 &0R  Ul0!0@!  0 P 0 1 X@0&0 R  h cH0S[=00b}l0H"0l"l e6   & Gr R P T Br R D  R,#H}Pʎi 0 c0@ 0~P`P 1011S1I00 0 x30 X080<0d05d000 3@X@0" (&0 R  Y*0 3 X000m0d0 @ 0P k0l$0@t$t ܄0d0  `0 l0+S .0CSB@0P k0$0@ %  ೄW 0|p0 (0d0wP0 @ @r0|5 @Xk0%0% ℄P0 @ k0&0& nꊟ/0-P@@0/M- 0  0 R1#0e(6,  Ѝ/;M-  0S R B 0S N   Ѝ/;M  0S 0 0 0CSЍ/RЍ/0@-$MP@C}P$Ѝ0 K}P͡0ıġ0"c110$Ѝ00@-$MP@#}P$Ѝ0 +}P͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/bMO-@ŸBM M 1Pd$č$p000 S00- 0p t P@QP0L T0l PN0 0A !< S 0 ༂T40 ; P0 0000 ; PPF P0. ] H010$430CBލ ЍS  \ 0S0Q( Q" Q \      l0 Z\\\ {@$@ E~ y}}}C-LLP AMM č@`p04" R3 ) 0@` ࿁ P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R` @@H D D Y\꿝 x} +| wB|t|HO-嬡 AMM  čR{pPLpNPG `PPB t @+0nDP7 0S4 `  0S+ 00@ p8P00@S 0S0S 00@ @K @ @b @ D ,0 0 4 30AލЍF w v{-| uO-ß CMM`,č@pPX\.@[0S  .S@0SV :T d1#T#*0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $y[000$0D DR @@ 0S+ .S& 0P0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@1( P/d!"" 0Sx0h 0@$0000]0@P@Tk0!0$  00$0s}0S 0S ZV0 tO0  ZG u8 tDO-p0Ÿ\M P@`#T V 0   #8 0ŌpU@ V 0 p\Ѝ020g  0 0VX0 0 0 FYP0swpZZ0SUPPV   B RX00 0 BYP vZsZtZmZ pAWTѺ%0 `F 0S0 s [ZwXZ YZ0sQZ0SpP 0  PpAWTQW L0L L0 f\ЍpHWT q<HuxssG-@0`P p)@D T@8)Z0Wp Z뵐0` ! Z  @Y0U0@DT0 S  P D D0D @0 ( @rrrrG-@P` p嶒Ẃ6 F0S@`?0WV!; Y@Y` ,@F0W0T0S?T0 *GtY0U0`FV0S d d0d ` 0L] @ @0@ <0 `Pqql=qq q8AO-0P䡐 M0S5 @@d@t@`p S S0  ƚP&  P0 ẚPI  ೚P00^  0  SR 0  SRS ЍCPd1 02d1 H~3P0 ~  {P  tP060 P0 ~ \P  UP090\ k~000<d~i0:0  9P  2P090090| #P010r  P020h  0P0Z^ d@L ?R? # ^ 0 2M$ 0P0ZC @1 ?R? # ^ 0 (32 ٙP+ @ љP010  ǙP010qhq|q<qLplpTp:o:`poooo99lo nnXnDn$@-@HMxxw% |Ô0{ D   0  x{ 0xxHЍ @-AMT  w0000 00wЍ@@0@- 0 A0tMT0l00  yw 0P0#0h    @ 80 0 l0 30tЍ0@@6 e eX0A-@P#v 1!01n0SPpuOPp vp0Sp@-Q@U x3s|p yc01P sc01000pucWwVxuP //DP //jG-P`@>V%0VQ\@ 0\!R p Âp p "p O-PH+H; 0MM050,;@005W0YT 0 0`01'0`,4< 05@ d!A  d!. 0`11110aP  LJ0@ʏP 1#S;S 0 S# 0(Sz 0(S> 0(S 0(S 8 R 00sS2 S S 0T( @8 R2 S S0S 00 S S SS@@ P `0\_A7P@ 0Q.0A#A'S? 7R2 S S00$R00S 0@0 S S00 @PP0S S 50P PPPPP00H00@06w_ 0D2 0IPe  PH1H0?:Q@ Q$10 p?  960@`@0O- >lt֜քxh< l8\|PB AT0dP ̼d =@=<=(@-@P00Q  P    $00<0 0@ ($ Tp@-l@@`VpPPp"0U1pPE1PSp ( 0$ 0pQA-pA@PT`QV0HT@P 0 P"P`p p``@:A-p`@*TPP T  000P   li::@-@@0/ L00(/X000/D004/000/00/ 00(/000/008/008/A-``PU 0AP ppT0APV404 0 ,(0@ S'UV/-< <0  M00( $ W Ѝ 8@-@P [0`00@^0 50 <ʼ8@-@Q 00 2 R 0 G-xsPp@M 06pE T 0S0{00 0  0 0$ -0{aPP 0` 2* "Z &= " 2> 0  0 pq~ X X 000@ g@PЍ <R 2"00@ΦW 2: 2 (7iP)0Z 2< 210 010010 010 0100100x100P 0 R00   0AT 0 2 13/pTd0-00բPP 0`2 2u00@Z@0S|X~ 2: 2p 3Pw 2 @0 2D001800 -l8<,XC-@`pQP M 000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH xP (0$( p 2P ;00 ЍP Ѝ 00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p c ЍR @-@`pQP M P00U,0`V( 2S * 2 P13/PPF `P 0 p 2P 00 Ѝ " Ѝ00PO-1PSM0:00 X1*q`I`[ 叚p@ p W "0 I P tZ 2< 2ЍЍRP O-MXr=*`00A̱PVpP W [K DR@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍTRP"! ЍG-pZ RbM'*Q* U@0U @ RD0 | P X U 2< 2Ѝ@EЍЍG-P഑p 0@F `` I`!v` 0 !`!0 0CS @QàHz0S0Cs 0 R 0 1P@10CS㣐**y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2.pl0l l0 T T0T b 0808 80 ++ ++pp+p@- @RP ` xPP  pPp@-P`@Q r00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M 700 Vu 2+ RI 13/p) 0 e! 2$  00 3 p`0 9/P 0 9/P  1d0P 4Ѝp$ 0 5 rq0 wP 2: 24Ѝ?p`(0 0,9/P 0  0[a`FV`&*0v`  RP !q0S!Y ! Y Y0!00C0 b0 8 0!00VY`R`Ѝ0E 1KP 0UY0 0 0C0 0Q[@@pGpЍ%G-p`0@ PR@Dt@Bp wppT@$:@Dt@6v0p@00T`:P0D0@l0l l l0 P0P Pz0 808 8 r0 #L###t#|#PG-P@@ `RNZp; 0ഐS0FI S0y 0 B 0V F B 0 0 \ q|CC0R000 00@ @@T*80`F0C@J`80000 Y4y, ,0,  0]G|"!G-M( y\Xp`PJ \;S<03%R @@{ZZ0 L l3< Gp P3,0SI 2 R , F $( 4,<0 < Q0 U@P00X06x0Hs00ᴀЍ\006`S <0 PK,0S0S $!Q  #00 00R#40A 0S- Ss0 Cr 0 0 0 X0倀=@0@~7@0@d d0d 0\ 0S0 0O00h#d51Sp@-@M PLaP8 \,0(P8ЍpO/G-4Ÿ`0 MqMŸY w @P^ 1 R2X< *5S0@ZZZ0/ L,. l3.<  0GpE YO\!L1 0  0 30H؍ЍU80`J8 {8000S   48"Ġ< "̌Q0 Z  Q"$ Ct0pps@0m@0O00  O- P `L@P H1嫲p0q1  J08 10000N`ⴜAO-40@S`p M0S0040000 PD 0$B1;0C10 X0 M ^ X @[ 0 PW!B! 0SQ|   R 0S  "  0!2#$ S C$ U @ U` SRZS5sPoUj 0 Pb 000@@℠0ᄐ000ಀX20HPIᲀ0@ ЍX D $ U D R RP1 PD D00CD0 0 10CRL Š B QP"y0 0sP!1 | 0P!@ 0C 0$ 10C0S  0"^MPO Ѝ1 _00 _@0B YPUڰ1 0S 0PŠ!D PDp0PU PHDŠAD41 (1 D<hXO-@PU`p 0M1^000Xg*0QE P @PU \000U00SP ^) PЍ`0SP0@ 00S"@P 0S00 000S` 0 P00080080ЍO% "0008(8⒞40PЍ0@0 00^00` 0300Cs000N 0S;:00Cs000B0 0PP 0 X0:0 H0ಀ0 0 ` `x x0x 0 70 X X0X 0 0< <0< 0 0 4P8TX, 0A-s %!@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!A菟pP 0  < 0x,4V0O- `ştMV@ `P10P(0i 0 ) P0 a (v`0 000 00p0SRH@0 P@ P 0 $괐X ` x F  00H00ᲀ`P  R@ڴ R  F@D ^0IPx  A LH $  {`(0 0@PA~ Q` 0,0040X0$0<800CS0s00 R*< A Ar 08岐S0Q რ:8 @ಠ0 0, 0ឝ0P,0 \f 40|Sf 48,0400<0 \|QdP00Q0 00 R@P ` 000z QD0s00 ᳐Y;00S pB C TpP\Xǘ0S$0Q0 00 R 0P 0Z 0 $0g 00040嬑S,08400<0 PT Q^40S 470,0`00 0 0 0P(d0S 0$ `@0T$0 h0`S,0 40l 0Bs0 Y0@:0 I 0( pഐ0000 000tЍ( 0d d0d L \0 &H H0H 0X 0,  xS l L O-X\p0`S0P @L$P uJ v&O-@$M`jET Hpܴ4$$0Rab (  WpVΆBP b0@SFSC,<L\l 4J?3 3$$ 3$ $ 3  3$$ 3$ 3($ 3$,$I `3$d `^$Ѝ $  ( ,  C # PU! Pp "P^@P> ` RZPxB `  p  BR 唋pPG Q]($R0 U tWS UX,$R$ ^`p4 I`p0 W$RD $pR $R !;^&@ $R $`p P$R& U Q R  T$^&@ @ $=  ` &@ T `   p Up$R UM`p -`p P  ^w`p U?@ Pz_^4"w&& $~-)&w&&h>O& *wwO-@`MpP3iD뤳3#@ @Cp#x3B RP!GP P( J`f@(hPF  H@ P0t`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X @&` `Z`r`T iPP   ᰹`Pd 0)ȱ0V!Xq``pVpP @ % B R,,,,,, 0S U X  i0S X  R 7/ P  R <$ C  $ C  uP0S P㨄X Y4"%kLxb-)& $xs xx݈x*xO-PyM`1hC0pI00 00 Ep8 PEU( 0R` S 0 0 bvPePRP&GPaf0@S$$,$$<$$$D$L$$$TH0@ S$$$$$$aP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0Sp 0pSppT0T PE4T& 4 P Q.6P/[  00010ScU0Sppp C C0S S/R 8ZUp0SCUa(0S0S 0 0 9Up !尃 0: S UH/[0%㜃 /U0: S0( 0 000JPU   )0P0 0P 0)ṽ0P @/P050CS",t tt tt $ `B   `00PP0S TM0Sq 00   B R,\ L` V `,Q$ /0 ~!P@`0 !P` J/R  S/R/   C  R: |L ` : 3 0S S/R% 0 SR' T0sX0 0H!LR\0X!\R\ X00: S h C C `XT0: S P1: S ,T : S!  Sn  Sf E^ S_ S L0S !_PM,0SL ZG0(尥 0Z Z80 S80p1p!pp}Q  TP!P1: S 00Z0S 80 0CS!800 ]PR X0|R 0S !_0S !_巷qW4"&x& $xy'%klyk%kt *y}yxyyyzzM& zm Q6zz Q?zO-@Pe8/A$&GCp6f@ Fn`P50`U)a0S0  `)RP 9Za4P0805H`40 aP0|%.,0@3aP7؁P0< 858%H`QP8P H0 0%43/00P08004 幁a` 1V0!aP ,`P 0000/0 b$0 .cP0; S D0( @, "1H `86/dP0`R\Y2`` `0 Xs0 CS /1#Sm`P0 0, (S* B^"!!0 `8PH0U 03/p0S4iH0803/paP`Ȃ0 &lh 0 S * X  *0 $03/0 0 -Q0  T 48a0  0 -1/ 8P0 0 0 ,&0 &P0$ ,!`0 ,ؠܐPZY0   0 0&0 &  000 Ra0 0013/v S_ SA_X`\P0Q , "PU`!0X`\PB ?U4"~& $ R'0 >O%ox'0~~'00*'1 ~'0  '10 ~lO-M Mpdy?H Ap 0 Q 0  s0(0G@-P񟗙dp(<HTx0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S PU RnR oR0P<0,߹`P  Q<P8`P,˹PPPPP LWTR8S;05PwPa4 1S}H @0R. PV`@0S0H0S 0  cP P 4R㓥' FM P3mY`, 0X ,0SH 8 RS P0SP~wP4PD0S #[p=X2Q=0 q E - Pf Ri Rk R3 0!BSQg SNPb0: S^ 00 |!=p10 ER!MpS|wPePLP PPp FP Szf@PHHHHHHHHHHHp000p0 0p0p0pp pQ |*zQ  M@P0: SpGP z@b*'7X& $*4" 0a~O-M`_|J;LlrPp@` [=pH20!1S U``$ MPj3 `[A PmP pPP "A`P |G`@ 9` pxᒻd000 00S lMP".0 0^MP& 00 3[` TMP/  Q  T: QLp [P0S T* `[`;LpY3 `4"& $*-)x +VO-JM MP0_:@rb <p1 PEUV0 AS U  PiP fP hP vP00@0@ 0E LpP0: S(! ‰ P` !9{0P 0Y/S / J>00$C`İPE@Dd0p/SP/lPT0 S: Lp  ဪ♃PPU4"'8& $8A-`P@M^ D 4 0; LP  K |LP  K rLP  K hLP  KPlüh3P0`3P P$PD3( 0P+( P3( P7( P;( P?P ( PP( P PP8$@Ѝ(P (PT"f(0S (P(0S (P(0S (P(0S (Pq0S yJP!0S0S Xp X6`PPa D1R`iPU 0E /R 5P(嶵PU  h00,0/00100CSP0$0u00S py`0s00a' &P'4V%s 0]'8՜'8PA-@Pz]8`p :p 00S VSPyLP PP ޵``P o$刵 0@N4"& $&&h~O-`pGMP<]8` `  :p 6Y.0S ЍfP WP! PP p `RP dP ܵvP iP0p0 `rPxPpp0p0 p$pq6 0S!R  ᴷVGe̅PU JP$0  S0S0 0j0@0S* /R! /0o0P0 .R R .R0S[  H 00 0Q@  0P0SP$0`S0S@ ㋭pP PX᪮PP10S 84x50C SU(xl0$S P P8 00$ @7 0x0S $ ?RR00R0SV2 $ 7  <0SX  P ᷯ0 !!0C0 iIP 0S' <00S 5S 0S 0SIP 0 0 #{X ӴPuH0Sn5P i0S 0Sb 0?S^ 0SᯭiM0S 0?S 0SS k7 db000: S0S<U0S 0: SiHP1 0S!  S/o" R  rP SH 0SsIϴP 90S 50?S 10S 0S '4"& $4*xA-P@k[6p` 8p 0 R1 P0C@PLpPp HP`/PW` /P 0S 0S0PoHPE/04"S& $*p@-PM^ 7 $ 0G HP H@IUHTD GP00!Ci6TP3 dXP 30S S! S  3H \3! d3 00L30S  R ,#6 R #!SR3 3 2 20S ( 2 20S 0S'002@T$P0"L@LxB00CS00  0 < 0S60016 R0S 10S<7t0PR<f0 01 10SO 10SK(2p1\1PML10S H10S d1 X1 0S 160S 0 _ @1 EH01(~0S0F0S 00s0SN0S 00R@`|P@Toz'4" %t''T''h' 'Jp U8=%u%vG' %t'0 TG-@MP YW52br@@0 S  pX "]7pC 0 L1 0嬴P|7x GPd-`x GPL-H8 GP4-T; 0DS 00S8 @0xL0QD0@0 0Q)@0SZ L ePUua0@S񟗷(d0\@| FP \u@@L bP KP P 0@0 00 @Ly-L-0@0 00 0 hPL|!D0S hx 7GPTH-J4"& (& $]ci@ tBs@th~@t։&֚-)*֔tg֤@-YwEJO-M pYtx4딽@0o0C?o`DT20<$<4@@@ 3p$4 4 00S ST [@ Y`> Z``: 2uRPGPP! Q!H@ PxDŽp`hP dP fPvP$@``j1 00T 00; R4 : P @E!A0S #S!!d2 00 0 {`PXL 0pL#>.  P (Ĉp 弈p ! >Fp t0S<0 0@0050C SR8PP|PPPPP@P[ ẫX@P߼0S? 0t$ p3 p0 R qX  Pp P    3/P00 S ,$ p3 tpZh000S vI4"'J%v0& $S-)7x'xx*|O-M MPdJq^nd5005d5 035 d<:p0 00P ! pP pVnP Q sA@6P񟗹̨P̸,Π8ΠΠDΠΠͬ͜8ΠΠΠΠΠ̔ΠΠΠΠΠΠΠΠΠΠΠΠΠ΄ΌΠΠΤΠΠάθΠΠΠΠΠ0WS }055050p 4pP P 0Xtȟ S  SSy `s050505484 P PW 7q ط  pĻ0"S osꐷ  p 갻0"S hL } p0"S P 06ysppTH 0@SxGpG-_xX8 㭼G P P% oPP%-`V08c8 pᓼ0PZS  0 , R# -H 0`||Q-)& $D~ȀDՀD{(D| *6D}GUbu* +V&araydict0O-O-222 22223220PaM⤟0 00/0ph?pPPE oPh< "2RHo "0#0"0"0U1dR0 U% PPL0⛣p L*pP  PPL0⎣ppd2SP@PX0: S0d2232d2oPPS0~0 (>ePp0SH d3PE/PF1@PCߠߨ߰9P<Lߐߐߐ߸ߐߐ@ߐߐߐߐߐߐߐߐߐߐߐߐߐߐߐߐߐߐߐߐߐߐߐ(4ߐ<ߐߐLߐߐߐߐߐHdTߐߐA@9P2000A000`| ,bh<,000S0?, hn0d2%0 2"02020202@\l @IFTaߍ0220202;/`˨pP 0S /p< 00  R /p. 00/ ᮨ`P   R /p 0 0/ ᜨP000S /p 00 R /p0 0jn0*2lj000 0Bp B{P 000S H3 S;3Ŗ0*00j 0  {P 000SX"\2RRX2}i/pIP P?PX0 : SL9 j `P +/3P )0 XX PDna>>`P %?p \q:wX105  Wظ* >W %0>C!14(Spp >r037  8037np 4V70377 P 0 S 0"R S2S S 2S 2S 0s =pp P0 mPT5 f/LٴH7T0L7P'\,w?S "2"2 -PN0 0P UY(P`T `md2S+ >p%=00c\1X! P}X1\!0\-2T72P7p$%>pU%I=pP @$U=P"$.P 0lU 9 Qh 9Y 3232 32\T\2S&"2QX"\2 1!8(!%w 4 `Q 01 SR !R QRQQS 18<45-0  *-0\H2R0H2 1!8d CR``````8`` ```\`h000   t 0 )     r Rn : ᡣPi  [ 7\ P7S0S R) QnQoQ0 )p"pBp$0P@1  600,"($2$"9ލ Ѝ ៬P' 嚬P" 啬P  'iT.@; ^p@. A!:PZ9pAt800 6X`V  :p. ?91>04P)`CQښ. .a0C 2 0h(H-)& $Ade * r&(H(H<a%w4"(HtдE(H@dz(I`*HnO-`@ṕ̑Q )p%W㬑 0S 0S p10`VA rP `m0S Hg@`V-Z ЍyPmPPP fP q:n0@ S 8L  0 0000000000pGW 0IP  :P:P 8X-)(N8& $TO-4$M` 9P! 8P$80pD刔刴00PPPl$>)p3W00S 0S 0S 4;Pp(4 a X' 0S00կP Я0S ʯǯPY30S ЍzPOPBP4 FPo ^P@*PXXXXXXXXXXXXXX`X$XXXXXX0pXXXXXXX00 P2 P20{00b 0 ~^p?o0` 0P00e @ڪP00^ 0 c c^PV Q000M00J00G0 mL^1 P :Jg000001000-00*000&000"p 00000000P0S5tZPtW00S 0ՈP$`I%t^Z G7^Z(`\(XX-)([44+& $4\ (``4{ 33333eu%x0334JO-@MP8@{J\(5PUPE10ųʃvPlP,HP8 TP3@ ` A8p@-  P@tq!0 S < <0@Zx fm@ Ptttt0` 4"'p(2 R Q!  R 1,0Q ϩP,00S  0( @ P@J00-SE 80@0$0 ę@P?Ѝ$0px1 4?$040P ?000R0Sp d```8`pX0Sp0S ~ 00 0@@`p @$@ @P Xn 03/p T\ l-)bb& $ |b) T>h(ilO-p0`M(006外Fp0  #p6V K pV0S`v```@@0V|P 0SЍuPfPFP RPg g@P@`0P0 _b0#S >P00 $$00S 4 $$00S FpP R~p> 0 p@7p>?a0S@>D$RL$r R  $t ~Ⱕl00<4A @0<4x00<$ 0/p M <4 D!@ 63`PEB@D4T񟗷"h(h(h(h(l"(h(x(h(h(h(h""(h(h(h#@#(h#(h(h(h"\(h(h(h(h(h(h#$(h$L$$$%%(h(h(h%&,&d'P&(h'|(h'(00<@ᬡP} 姡Ps T< $t|| , 8< m (<$$r $e4LD፡P ;$0 00  0 <N0 08 K<  ;0A> ]; X;$50 00 `0 t ;'0 01 (0 @ : 0 08 :  :$ 0 01 0  x:(0 01 0  @:,0 08 H0 p z:0$:@90S P4: 000   01 0 V:0 01 0  Ht:0 01 H0  :940 0c0 0 P ,: 0 01 0  888刈@0S C.0 LP@] Lr圠P0@4k 啠P@e 8(%] 8@쇟ᇠPD40 l倠PD40D4M L G 0P 0B $000!0 0!7C1d7@gP00)7 000  7F:PP/P h\0SX 0T470000PEU UZ Rã ⿣0PQ 4S<4Z H$L40 R,.p=l?H4LP4SL$H4R0d `&,pP LB R..p 8< 4S@00TS 4E~G/ጞGLtHW00 4/p4WHLt +KpP +>Y\ kRPP;`%QPPP%PH\R-p P1: S$%(5 $Rg,@P$,PTP$  OܔP0IXZs4S04>0$80jp!t$ ,p = h$0cOP$0 r0 4cP ^P $(03}p,p40S0X44S@0S4 p2S "20# );Pr 0T40S 0P 3P#0S 8?T4SXP L3 2"pGp2ŸS L4H$Q*[pp0 H$L4#"1 _pD2 C  [0, {p㼮p;  >0P 0P, zH$Lt?'"y4 S 02?0W0 p04$$ST RQ 0 W0  T+p pWR00R104Qf ;R040 Q$ Qq*4em(k[Z*& $ -)4&_΄zQ6 0&v%  ]>NzP;X. R04ʃ1$4Q :$4(+T4S%M +d0("lf1+***LX+\4$@1L4`D1x0<$0@ 0+pl␝P>0Z MP>0⁝P  4⿅p  T4 | J(0. 8-O-0pIMM∹i4,  pP_`9`4pGs04WZ `  Ya' 4S<44S$$ 4R0()p  `g+p  4 SP,0S x 4ś$ tZ0 0o 4幛 Q $<1Sf $4 $Q_*`YZUCUDPEU6X5t85t5t85t5t5t5t665t5t5t75t5t7H5t5t5t5vbPEUU7|5t5t5t75t5t75t5t5t8 8@5t5t5t5t8p5t5t86 (&p00( R0C0s0SJ p 8Y044s04?0 00 d0 p610 08 ,V< L0A" 40 00 0  0 0: ;  0 0: ; 0 01 0 0 0c0 h0 050 01 80 ,00!0 0!40(40SX00; T$XN0P0<$X`H*p 4S (PP#\$P`P#D  8(@KP,4(0(00`V Z 00p"#8$p = 0KP0 r0 4˛P ƛP#0WX3}p$p4S80S4\ 1S !10"< 0S,j⤛P 3"b~11  $4 1 "\pT2   "X% rPxpԑ P le $$t 4r(4S 0<{/?0W0  $tR $4%S 4$ʚY0; 4 440 W0  'pWpW㯚Y0:S $R4 ĔS  ҙ '0S Z ',  0ἙᄚY0⫱}Y+(p0-)& $1(tP %pzQ6G~(p5  Oj~G-GMM@ph m p40@D@DTQ@@5P?,>@?P?`>@>@?x>@>@?>@>@?>@?D?>@>@>@?A>@>@>@>@>@>@>@>@>@>@>@>@?@@8>@@X@x>@@@>@@>@@AA0>@>@AXAx>@Bl30403003{3 (t|3 p0,@0p0H300083080(030# 3@| 2Dt 2Hl2"d20L0`x2"XX|2`"P8`2@"HH2 p0V 0 2zW62 rp0X01!h$ 1``p0x0p0X1 'p`P%Ş  k@`vqP0 S  0`YP  RV0S0Sh`lP0 #A/SP"0 0 @xP-xI@P1V GލЍ L& $-)` Z b,1O-` -PMp L`KP}'tDPhU r'PQ&p4 &&p$ `9P $pP$ 0{@{05S = 3# |&P, C@4P`IEJ J J J HJ J GtJ J J FFGhJ GJ J J J J J J J J J J J E\J ElEJ EHEEJ J FTJ FFFFGGGJ G\H 09 0 P(P P  Q R vU 0;8;08; 00H2HpPat" P R  s{ r;RNU P P R / < _ 0< 0: 0 3U@0 010@;M 0@0 00 008;0T P P P R / 0P. 00~ 00{ 09x䰟 P+P ` PR |ꬰ P P R @R dmK ?A@bMR`)zG{?z& $<Zv))}-))F) 0$; 000H L 0P 0 000l ptP  P R  $S0{{ZF%PZ<;S?%PS0gPX$ <X@G8 ({*<0(+R[X= P10H2pGS1<+0X2 10S 8Xp<0H1 ,8d;2S 0: 0 >00!u 028PZP ̌p ZPUpȌ 刀ppPt , <+TUp Aeb& $4")})}&)4z@_))(l))|%%)|)} 0@ @ |0 0PUfPh 0C Se0400000,00(00$00 0000000000 0000000 0Fa0p 4RC PPH@+@PWC *n8;p 00 HL0 %pj 8; 00 L0$p\ 8; 00 L0$p N 8; 00 L0$p@@ 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;P+2(bⱚP L0$PW;"0#10@00 0`K`QH `    ` 0$Pt3K0S PP K0$P& 0  00 3w$Pd %0 *Ss``0 c$P`4$[$ޚ!2P(104d 0`[[[[,Q0Q4QPPPPŚd<;SʔT<$>@ /Wz{@ k::˟S)$@ 3WVz{@ k9I:`"2RgdD' R{ @`30S 0 ' B@MHIN2 X0弅"pU00 c@+@0W0 00D)PT2 -ppW O P $2#PG`AQKY#Ppjc1{{7 (H{CAZAG@8HIN=T{({*Xa"@-T7 }0S3 [<'0xpT0T00p0p+t@"P h0S F m#t;<000[ Y0 0 /|$  r)d2"SS% 0 " @$?6C-A~8@@)z)|)T6&)))QV&_)}H%< `I1 @S! 2R`2p0Cs0WPP0dR?L!L0 0 d20   O  `0/0h0lp0hA{{7{{{3{{ {  M@ X9: #Rpp: h2Y0@ph2pdb |W$<0 00H 022 0BSA (SI; C 0;(W@pCp 0h 0S hSY #,2嶐! 0I0Css0S 0I s0r ( 0 1帑;    0; ( 0@0 0! W |#<00 H 0@0p0V 0 0D0$1 J 0 Z`P<0[NW D0 00R ZW |#<00 H 0@0  0 I0D tI(ppl0Zp>(D0 :()}H%)z)&)4+=j0CSYPZlZ\\[ [<[d[[[\\@\d\\0 P Q9YYYYYZ ZZZ$Z,Z4Z<ZDZLZTZ\'' 0ߋp@0ntplhd`\XTPLH0 PO (0 PF QZZZZ'S'0 P' '0 P| '0 |PX 0 sP Q Q }{0 aP {0 WP 0 NP 0 EP 0 <Px 0 3PX 0 *P 40 !P &' 0< 80Sg AS S W |r"<00 H 0@0Mp'H 2Ke{+<Jo= Y}‡—«½)l)z SIZ0KWI7P&DDD0J0ZD0  I)0K9+ 0KF U QJY0KWD03 +Y ^P WD0 &D0J C 4 ḛ aW>\&pDDKD0I0YD0 0J#1 K#+ q& Wi&O-M`P@0L-S@@P. @,4 t p+40SP a`F0pP[P' PijQNpGKd PN   N P@ \3pC d0@SaaaaaaaaaaaaaaaaaaaaaaaL@20SvK@HGG 0姈 0p` ]Y \]NZ'F`PP`0b 2 R    0 S    U+ 0  ! 0!00 X) Ep4 ,;pQ0S~X~` )p?0SR5P0pp@@  0M Vp ~`P*x& $  *oCÁÎà4"ó$X O-PAM Mʽ@`᪏|P p夏Ph70dW00-S% @ P ЇPM@ p0K0\Z ? `F0S0`@DDA@Dv p .6p0StbLpPx63 Q \ 吇P -00 `@Z-00  D0B5S񟗊gddddddddhhdddhPdddddddddddddddggh$dh0dh@hPdddhpddddhPhhPhidhPi 00S LP}L0 0wꨄ4P L00i00fd400b d4 ^0S LL V 44 R00O %P H  V300S P60$010(0.0,0+t0C?o 2R0S0$0wPr`oPjDIw04#@DT 3a00@`FrS; RS iS/ !tS xS J뜒+0p 0A00@00S . 0@T'0S  < 80R0B(0/S ((0S 0 @Nx0S (0S p|1 0h0P.S 4LV(0S (0 @ =FYj{ <P+8 0 P}@TZ]*& $-)6*X%u ƞƬ80&_%9=T&+FX 0ǤKqLj9O-PLM)@pPph/ p\?C,#@DRQ0I 4@@0SRKvP cP SP- TP0(3 LP d0@Sn$mn0mmmmmmmnHmmnTmnlnxmn0D003030800H00 30$30,3tC4"%**˜* *¨*°*¸*ˆ }Zo $T*. @j*€*H#1?P]?G-`XMP5+?P yI p 90VJʜ tGDP% b0@SS~@}~P}~h}~|}}~}}~}~t}~}}}~}~}~\80 60$60(60,60064060860<60@60D60H6$&R 4&<  <&,&R 8&R _4&R <&R 0&x7RttQaQT7PA@7=CP $dPW0S  fP 0000)P&T60 PR`X?PzP061 (VUtph0+SpP*H6 000뿲<0 0/0P& !%T00 s000p :X݀P00G00XAKpʀ @P`< 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0pq4y 0Q0TPP)(FgJZp3V u`(os`F ]P% 0SU030#:U 5%P`ƫ P P}2 8OT&P6K/r03TvPS0 0S.# G@vRPEX9 Pv"E0<6S"46S" 02Q" P2019vx僫6S h~cP0W0`W 0 ÇQ v 0K/r0S,6S m/PP PRavH<6S:46S: d1Q0@6D&Sx1 0 00Rh!  H&\RX! $&RL! 8&R@! 0&@R0! ,!Q   @ 륍 @럍@|0P{h*x& $U-)vC{S**ɔ*Ɉ&&h CoP#ImwJ >>_=A-Pp`IHM 4p10PEU* HP h0@ S S H4HHIIl1d1T1 P1 `q 4*8P p 1!qPP D L<$@@p3@(@ @i $PP NP0S CPxV GP XD0 0000 J& $-)% **֚ tyT tC]h0G-`HMp0(,S,C, p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 a0@S,<LtT 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTQPCV ДY 000 0HЍP PPp  C0S  *|0 `PHPV qh V `Fl*-)& $%&[z**C-Mp`‹PPF! VF pSPU 6 `V V 60S aP& tP8t6 R !l&   p@6U@0V`F V"@T 庆P  嵆PV"PV 0S A@D !P`Vf g ctP9@PA@3P񟗹(<Pdp|zP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 03嵮 $0S=<0S800S3@3TP0$0:(U 0S# 0S 0S`V Q CPF B0S 0S 0S`V UUpυP `ʅP \ŅPPEU4L U3 UUU  U4 @U U0`0 0 # UQa=PK0000 0 "P   !$0S "   ppqç*}a@yT ṧ 0 s#&  @ #4h$P @EP @P`T`*& $-)Pg&*Ha'G-@PMaqM p1 R1 p0CġP R ލЍRP fP74$0P` AXOJLWP1 JP/0: S2  S)J u$P0 JN@n` 04S00`_밉0S p J K$PJ D$@PJ0wp@Y*& $*v\C-PGMM 90M$= <8=8X@8DXPp=0D80l8"=`{C0D `XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxx8PP   (vP:?( 0@cL  ނP< <؂@P |P @0P XP0Pl Sh0 lxP4:T{ |qP :h(s\hP 9T(X(i8 pe,啃P 9h(g40GDS4 ,(@l\@P|`P\ Hh 8(VS h8X(T(N T8,J8 o8P 00S= 8 ?8, ,, ,0 7,, 7H((wb$8pb7, | 7L( |7P(w+t P :?@ 074wobpP78 7T( X(`7 6<(L7 6P 00S 70 7 6P 00S 6  T6t(6@ 86,p t68p'bp0┖80 P 0S<6dl pW 8f1pR'0 0l5L(5a` L5`(d( 85u^$5P հ@ y5?Q4RGލЍx5| p,Ǘ0D\<<0P 0S a V7Pyy@PxdD8SQa@4 aP t sÀt RἀCt Rᴀt }Rᭀ|t vRᦀ pR\堀X$TjRP嚀L$HdRD唀 8^R4厀 (XR$DH]UDUUUU 0S0SA  B@288S2@P R<S P 0S :a 7aH2 uN @+s P: B?\ |081<Skf+Cs P*UX0:X~PP304[sDxp4S 4SoP   11/΅01<2F01$1n   (z#2R @jp`d Pa Q1s0S [m5e`qЁБnp00o V B/o" R opP  \o=`S 0 0000 lo1s0S*v`#RS S=?o20 S S lo1s0S 0 S ` S S SDndypx+wR;;\;;p& $&;+; c99&;%%;;+ +8 <;O;C*&4"G2R@-@`2PcP 1 q $pt10SAPX1PH "wD1C@GP 0BP 1 nPbP9P0P 00@0c0@ S VP    h0  X0  H0 T TT uw0Sw[+¬Ba& $wVwU% e&B-A-`p pp2 0 QQ ]P#PPExeyuP`P GP( IP) EP 0 a0@S0X\d0000p40G 00 GRd18d1|h偢0( G1!1pQlqK0( ز@Px`1k 0> G0R  >+00.( d18d1=0ZSVPMP 6PR ?PI 4P㸝N@P񟗬˔,DP\fP j@PP񟗛ˈH $=0X1h ='hf`}蜟z`1f3`1kt0000n0`1i\ ʙ@cㄜ`|]0 P(⒱P `1~P 屙0$P]( 媙0 GR(⾱0 (:@P 0 P(m돹 吙8l&h(00d1(⚒p g(⊢1S(ᑱP 8 pn(j(ɡ(⅓:0P ``1@ @ Tp  p 7( ` d10 QP819: `!d1 @id1h* ` p@P P*$8 %d11`V mPPZ: )Z90)0 0+)(e `1 (yP{P L {(0 09u℞p@p  X (0S` D 娠UPQ k{0S (d!`10`1808"/0  d!2sH8"/0 2d!s"/ p= d1Xk (P%<Md!`1 0`1(00 8夝p 138J(Plw`t(00 7Dpz0S xLd1aHXz0SLJz0S z0 S d1`!8 0`!'zpz0S &t"pz0S &@(P q(  pm|d1 I S 0գpL9 _p5 P 4`1$A>`1 0T1(00 6Tћpwdޟs$0 T1w(00 5Tp ͟p  _p P `10`1Kt彟"O\`1(@0`1.`P  4Pd1 P40 (➐pX d!`1$ $$ 43(Lp (Sⱼp|(00 4cp8p!Rd14d11(P+h(v!dP0!  R!Z00!R00SR`1͞(d1 0㄃儓 Q01X: (O(Gd1 (ޓ1PU3d1`!( ; V A? =咞(Ó(01R@T 0S 0 @@ 0S  g 0S ᪟P`P P ( RV  R   (0010 S   0 PUQL|勞`1@0@eh`1  ' ' &O! * * *% & &!$& $4" +1 $x-) $^ $p $ + + !) - "F@ +V +K +XFF' 0B!0/ +g +} + + + + - +0 , , ,+ ,: ,H ,X ,m , , ,1 "P , , , - & & & - -&7 -2 - - -Z -B --|& .  Q/0p@-x@0Ppp@ P T0q5p@] 0 0$010WHh V/p@-hPMP@T Ѝp@ `0 @ i 0 @ipFF0ƒ S"*0@- R P@ 0\ R^D00"@ 400 0^ 00"@0/ppo@-M @`M)Ѝh  0S/ -PM00 0 p 0 S 0 0 Ѝ  /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ -*/*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*/*/6*/*///*//7 */>*/ 4T*/@-@v@*/*/*/*/ps_strings missing %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)ctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230516NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:inN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.12xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hfeb/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.0.8--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.0.8 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.8 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLchangingaddingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenIPv6-Only Preferred received (%u seconds)reject invalid addressnot ACK or OFFERdeclined duplicate addressofferedignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d wWv<XȬ j <`vhvvXvM8vtvvcdvvXʸv vP v  l(v$ vOvv4 Twtw|vww(w.3=C`C_P_w9dw8dm}HwA\wJ@5^wR !]wUw[a-lwbl~wgwl ws ,3v>pushdnepopdne}X}||,@@},l(}p@@}}\} G8 }H}@@ws@@}unblock and -DNO_CONV?hܼܘD8܌H$P100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLinki u   EZ#8Rh#r r_^F<>?PATH=  Atfm!d(!s#c5!m.!l<Cr  +pKnS!v ['b    EOF reading here (<<) document@l9HLPUZ^bfkpǢ tyɀɇɎɓɛɣɩɮɵɹɽl-27<B`n?}-+?=/@@|sC4vy|abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.''t00'18'1>'$8H'`0V'L0΅'80Ό'0Γ0'0Μ>|B ]- ;&w2BC{  kS  N qU4 !ӶmC4[|                  5 0@& +oxX'XlbN+ X1ڄPt tЁ6J49Ћ?CHIۘ _T_|Q 3Y4@\4PK`Vd,8Muk 0P } <+Pr}yzl@VWЇ3ҥҭ nҳҷnuҼl    ; Ү %՝ҟ: ;Ӕ<ӛ;HW9;HӠ: :Xӧ;DO;Ӳ;OEI;9lOCUSBZ;EOX_nu{x;l  $8.7>GPYbmvx %+17>EI;9lOCUSBZ;EOX_nu{x;l x %+17>EI;9lOCUSBZ;EOX_nu{x;l Vv    0 Q d    +  V  r     Q    < a u     !n#n$&n1n23n4n5$6n8/959<:U;o<=@ABC0DWEmFGHJLMNOPQRS.T7U?VWWq\{acdefg$h$i$p+qnsntnuAvnwGx[w5Uq(?[s5=.Jmnnnn$1C]m.Kc&A\nn e #n6fn/[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] v  Z;EOX_nu{x;l returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock u u u t        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-T\\]]] ]N]W]] 1]Zaaaa/aDaVajax%x@%y%x\%xt%x%x%x%x%x%y%y$%y<%z%yT%yt%y%y%y |Z;EOX_nu{x;l v    0 Q d    +  V  r     Q    < a u     !n#n$&n1n23n4n5$6n8/959<:U;o<=@ABC0DWEmFGHJLMNOPQRS.T7U?VWWq\{acdefg$h$i$p+qnsntnuAvnwGx[w5Uq(?[s5=.Jmnnnn$1C]m.Kc&A\nn e #n6fn/HFS0eClUFS0eCl!haHdInotNeedEFIll#*s(ҺK>; l-Qn|n֏- q+l8lDQn|n֏- q+lSl]Qn|n֏- q+ljlsQn|n֏- q+llQn|n֏- q+l =Gry=iG}llM;t?llWmCĄ 3KOOllyD¢<#*=(llРD3h&ll \M}-mm#ޔM@jy֬m4mE-ıܹчHmV-ܹчHmkIZܹчH mI􍂱ܹчH mI􍪱ܹчHlmI2ܹчHmLǠ6 %?ammϝ'S@ۿ )Ѹmm1*@ە )Ѹm1ۏx )Ѹnn backupstore_gptstore_tblin_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsssssetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusx{ $printallmaindo_setifpreferencedo_setifcapsziz%{UiyЁЁЁ%{rb%~RЁЁ%{ <% ?\%hrZ%~{m%t%8|%{z %}|%{|%~|%~|%{|%{||||} } }}$@}0}<}H}P }Y0}b@}k}t}y 6}~ }} }@{ $init_current_mediasetmediamodesetmediaoptsetmediasetmediainstcGncp"y 7x{n 7 c 7`@n 7p"ymedia_statusmedia_constructorGP~W%H~\P~W%HPP%ZPZG%YP~D%,euPeu%xpaddr_match P P x dP<Psettunnel%{%print_link_addressessetvlansetvlanif~%X%< X4"setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanWZ]`sethidessidsetapbridgesetiffragsetifrts%-%{%.%{8%h78=h *%{N%%H%-`%{ 9W%( 9W= *%{ 0%H}%<;  ;#Аinvalid major numberinvalid minor numbertoo many fields for formatffs@ ҥ $!@X,5 G Obo @@= v vV[d imql# G P w@'+07 bnorripbgensbextattbnojolietbnocasetransbrrcaseins# G P@ w3R@@/,# G P @ w3/@R: $@ҥ# G P@# G P@ w@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror# G PR w@6nu 7 @ CS @ !rZ`is} @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv w# G P@/,C{F]sTgN%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@7BHCWFcI|LNOASabcefhXidkpm~norsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp > ` @  $1м|^t0 Non-system disk Press any key to reboot nnnnnnnnnDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYw;c!IqUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefFPFP*0 XXX,,x<<bitmask_printtT T!'Ty'<T!ITWiTv|TTؤ T08T0LT0\T0nTz TzTTTT)T<CT\rTTTTT 5TGLTZarߜߜTTTTbitmask_scan>' $Ghw.disknamesfetch_url$$2$Tsendrequestrecvrequest4"*}********************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]aOx O| : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data4"$\  +,,x:+4",834",|?H,Y,jr,,z\,y9,4",4",4",,v<,,'4",1 ,d:,w;DU,va{7,<n{7,z8J,|\[,}[,~Z,{[,Y4",w4",vJ,[,4",+,=,I4",U4",collectSO"Z;EOX_nu{x;l NAME= vimount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsZ;EOX_nu{x;l  edit_fs_type_ext _x H ( H Hl H \$ ]L k k,1L Hd It Hedit_and_check_label Z;EOX_nu{x;l disklabel_freedisklabel_set_part_infodisklabel_write_to_diskhiy  P t T l h  p  p   disklabel_change_geom !! outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default,@, ,|,\pm_from_pepm_whole_diskgpt_freegpt_create_new! `$P< @t (,X|d   ll  l  lllmmn l! T\]N]] 1 Z     v   vV [d' @limq m lgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - HFS0eClUFS0eCl!haHdInotNeedEFIll#*s(ҺK>; l-Qn|n֏- q+l8lDQn|n֏- q+lSl]Qn|n֏- q+ljlsQn|n֏- q+llQn|n֏- q+l =Gry=iG}llM;t?llWmCĄ 3KOOllyD¢<#*=(llРD3h&ll \M}-mm#ޔM@jy֬m4mE-ıܹчHmV-ܹчHmkIZܹчH mI􍂱ܹчH mI􍪱ܹчHlmI2ܹчHmLǠ6 %?ammϝ'S@ۿ )Ѹmm1*@ە )Ѹm1ۏx )Ѹnn .   5l A Y ! 1 A T bmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new ! ! 8ּ|$ݘlpļT|HŴƘ 4۔Ŭt˼<4mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************4"*}*****control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2 dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2023 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option %*b<cdQe /f 5g 0h 0iDjk 5l <m 5n#o 5pn)qr 5s 5=t 11uv 5w +x 6zCy 6A 6B 6%C .D 6,E 66F 6;G 6EH 1IrbJ 6OK 6VL9M 6_N 6eO 6nP 6{Q|SPT 6U 6V 6W 6X 6Z # 1 64 66( 6 5|~ 6} 6 6 6 6 7 7 7 7& 7$ 7+ 73 78 7> 7D 7J 3 7Y 7b < 3k 7j 7r 7| 7 7 7 7 7 7 7 7% 8 7 7 7 7 7 50 7 5 7 8 8 8( 86default_configread_configrt_compare_proto$$rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtrt_buildrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initz` < +G < < <rs 0? <script_buftoenvb 7 6X 7 > > > > >if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @DCHDdhcp_openbpfget_leaseread_leaselog_dhcp H H Hc Hdhcp_bind H F H H > Fa H A Hdhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifannnnnnUVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B LV,L L\l Lb Lh L1} Ln,L Ll LtBBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ L& L!)!1 L!-!1 LV L\ Lb Lh L1} Ln @ L Lt!!! LVX L\ Lb$ Lhh L1} Ln4x L Lt !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%KC00`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstring_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_number_alloc_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_reset_locked_prop_dict_keysym_put_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equalsprop_dictionary_set_prop_dict_keysym_alloc_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_equalsABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_internalize_decodeprop_data_data_prop_data_internalize_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_remove_prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynameTLS allocation failed, terminating ;Zx0Nm<[y1On%s %s%3d %.2d:%.2d:%.2d %-4s %s %s%3d %.2d:%.2d:%.2d %s SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesortsetup_seekdir_unlocked_getdomainname @_strncasecmpcreat_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'B@;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54<Ҳ؉9I#ը32D=%[όh(doC_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ<Ҳ؉9I#ը32D=%[ό (doCCAy7FnM8O?ZwH02uOs<_fdopengetcgetc_unlocked__sflagsfclose__srgetlflush__srefillhash_seq__bt_openNEXTINDEX__get_bufnewbufNEXTINDEXNEXTINDEX_mkstemp__gettemp0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzcrypto_prng_bufQuޝ3r(Ѿ唵V dj٧IY:Jp,.*ap+ѿ#K`crypto_onetimestream_arc4random_addrandombt_rrootNEXTINDEXbt_psplit__bt_splitNEXTINDEXNEXTINDEXj ggQR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx6|0pY9 1hXdOj ggʧ;l٫Ak[~!yB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHO_getpagesizeqsort__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEX~  L  T N'`_<  `    <4     ( 0 8 @ H P T \ d l t |        <) xD _d fl ,( h@4  x   X g     L @  $ \3    l 0V D     <N x   & ,, hh    XX X X        $( , L .0 4 < 8 < \@ H P X ` d h l p x     0 00 0<$, 8 @ H T `hltxhHtx  x|4!_!cH9<!cD!g8L!kT!pU$$ ${ {{ { { {0@DLXhtD!!\!H!D!@Lstngh"!nmbrl dict289x<100x10 dkey;7/dataKLKboolXTXX\aray^pd b\\  8D\h    , D1 P\D(p 4 8 @ H P X ` h p x        8DP\dt|pl    0!! !$!(!А! !!!!А#X#d#h#l#t#x#########@##########$$$$$ $($,$0$4$8$<$@$D$H$L$P$T$\$d$l$t$|$$$$$$$$$$$$$$$#X$%%%%,%<%H%T%p%x%%%%%%%%&&& &4&L&\&t&&&&&''','@'T'h'|''''''(((0(D(X(l((((((() ) )4)H)\)p)!,H@PĬìĴðH@PĄìĴ\!! !0!,24455@5\55556686T6t664$222444l44ChCpCCCCCCA=> >>$>,><=\>HL@T>P>T>h>p>>>>>>>> ??!?0?4"?H?P#?l?t$?|%?B&A?'??)??*??+??,?@-@@.@(@0/@8@@0@H@P1@X@`2@@3@@7@@c@@@@AAA A(ADA4ALATApAxAA#?lA$A%?A&AA'?:(BB )?B(B8B<BDBH7CCCCB8C8;,;8;@;P;\;l;x;;;;;;;;;; << <$<, DD<8<@~ bj8jzcfhklmooppp%q/r wuNt6v;dw>wKx Fx !]zw[zSBC~JdOnP}STŜVVXZZ   wl(s,uDs,,ws sL4tt({l{\|<s,{d\s sL4Fd  ~ /dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin'$}-+?=###%%%}''a EV&eF.I;di8LlEmMCnWf^dpkbruz~ƃƎq>OsƛƧh6v VVưx'4@=%v%ud fodqttL{VqdvhBq`nq!$q0 lG*oNp|m(=F\V4"44"I4"U_04" 4"hqp %w  ;5 ... ...->~> "`N%xT@SGSyTR%xpTzX%xU]UZ%x@@V8%x4"*%x@^^c4%x@cf%y@4"P%y@e%e%y8@eg%yP@fN%yhgh_juL%yjz$%y@jj_t%ykk_k%y@n7p"%yow9%z@q ՄD<4 \ܘs%{r %zXAabCdhlNsuvW:w:z%z%z%z%z%z T{%z%}\ L{%{l Ll t| tT| L{%zl tp|x T|%{%}| T{%{%} T{%{%} T{%| %} \{ %|D \4u p%|p \rs%{s %| \y#%{u (%|%~t%}%| \{%{(c%} \{%}4(c%}, T|%}H%}l%{h%~t%{h%{%|x%|%%| %~P%~,%~%}%}4%|%{%|L%{ lz %{z  D(| %{rbtmrb D|>%{tmtm D|^%{rZ \{%{h(c%~ l|%{| D(|%{rb DrZ%{tm d{m%{ {m dt%{ t d< ?\%{ ?\ d <%{ < \8 % l%{ l$Z%{Z l|Y%{~D d~W%{ ~W l}%{} \ % D% D%{ \~ 0%4 L X%{ d%{  \c%{ % \u h% l'%{ l%%{ d$}%{ } l$h 0%{ 0 d=h8%{ * 8 d= 9W%{ * 9W d.%{  \%{N x%@K:FAFFHLLF@TG{FYFE iE_G;FdGlFrFwG|F ;5  '@@# G P@ w@/...... ...... lost+foundAd.##.w7 "`UR[  % H  F bfY kb 36qE ?\.rZzt !"# 8$%&'(ju)*|+,-/1123456%x& <. (prog_root)` =& 9{V @B+ Da? Rq  t  ]/  4 =&  3bP CL 9  3l \n  `   I  fv  Zl  \r `4 GR  J;  M  \X Ct d(# c) c + \/  r8  @ 5  4D  ,<, F F  =Y G| 3 CZW  =  [  3lB J(a-  nF mL Vh  MQ hX  Kv  PH`  =v  W` `  PH  Me  sXeu  3j  l8wb  nr  6 C  =w  6}  m` >  M  a   `\W  ,<G  n bX  M  M  M Gws Ea E  ^s  4M  VDl \  Y4 St4 Rp4 TH|4 D$5 IC5$ Kh+5$ Khc5C ?$.5T ?5T ?5b O5} Os5 N?5 gH#5 OdZW+E=%F3P9caclPs9h9+ !"$'(+-.03569:EFIEFREF]FhFoFzFFFFFEFEFEFEFEFEFEFEFEFEGWG GGG%G,G3G,G:GFGQG\GaҽlGjGwG~GGjGG =&GE+TGEGF0GFhH FzH6FHZFHxG,HHHGFHG\HII'ҽICWIZG~InGjIGIIGJ%b%%L %|z  * . ` d f o404?sz _###)#*######%%&&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&''' ' '('('L'L'N'N'S'U'W'W''''''+++P+P+U+U....////0000>0A00011/11111122 2G2PMN`|ף0RTfhk`oooop"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|  ( ( ) )oK_pp0J#%')-Y[  : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----0*0-00ooprt} %&,,&-GQ).1256CCLL||װ /vz       8 : ? ?   $ 'FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB4@4@4G4Ujjk0k6oOoOoooo-0Fgi{тхыѪѭBD6;luuڄڄڛڟڡگ!#$&*06DJ%%%%%%%%""%%%% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<OOOO is a directory is not a regular file (use -f to see it)% % (R$RRRnRR"S>S SS(;S3 aa7S; SE SN S\#Si2Sv8S SS S(mSS!SS9SSZWT&dfT)TT(5T1eT::TDVB%TLTV6lT_4STTk Ty+T,T-T.T*TT?TET/T/U'UFQU RLlwR{ <RZRh RmdfRt"RR~R $ R R RRWmkRkRkYcWbkCkc kG ky wb YMYrWca%͠+\] ]>b%͘@+ \]f]B%͐+]]c%͈+]^ ^ d%̀+^G^b%̀A+^x^D%x( d^e%p+^^^f%h+__F%`+_8_bg%X+___h%P+``i%H+ t`>`^`vj%@ 0``J%8!+h``k%0H $%(H `K% +``aL%+da2aPm%+ahauan%"+aaao% aO% ap%H P% lEq%+abbAr%"+bUbvbs%!+bcS%!+c!c1t%̸ cAT%̰ XcGu%̨+cSc}cV%̠ w%̘"+pccdx%̐( \d9dEX%̈A+|dQdvy%̀+ddz%x+dd"%p te~%h!+te e-?%` #%X eKe^%PA+xejez%H+Xee%@+\ee%8+TffD%0( Df|%(+Hff% +D <ffg%+@ `g*gK%+<glg%$+8 gg%$+4 gg%+0hh*%!+,hChS%!+( h]hy%!+$hh%( h%!+hi%+i,iI%+ini%˸ i%˰+ii%ˠ+j j%˨+j8j^%˘ hj%ː!+jj%ˈ+jj%ˀ+k!kRk{%x+kkk%p+kllAl]lilrllnuljxllllllm mmm(m9mHmSm_memqmymmm+ZWmmRmmmQmmmnnn)%n/aon6n?nHnUnanmnznnnnnnnRnhW'noJo, (press RETURN) S %%%tags643{}abcdDgGhHilnNpPqrs tw xy !:#=,,-e^H-i^C-k^UK%%4 X % k$ %4"%d I4"%D l4" %4 I(% I|% J %4 % M4"F %4 V0 c4"F% U e % %d%D4"F% M ft4"F% VX f4"F%$ U gd4"F% U h %߄" %T} %$4"F %ބK M a84"F %M M bh# %; %݄%T o4"2$%| T84"2$%ܴ|4"2$%D|4" %4" %4" %ۤ4" %D4" %Z%ڤYb%dt4"F%$i ht4"F%e e4"F%لi Mt h m4 mT mtt i N M M RX Yt k m m NTt ]@d jc ] f jg ][ j] j\ j^ j LX MU! M$U M8  ML{ M`z Lz Lz L{ L{ L{ Lz L\z Lpz L z L z L4z LH ]0 j j jV SP mQ STR \SW S4d R T  TN UO TP T<Q TTR TST RU \lw K Kx K< jH= jX> jd? jtf Kz~ Kz K N N Nx [X Y lP lt KdR j8 O Op OL O [ Zp O Ul K,S KT| J| K} Kf Jz~ Jz J}# i}I i}o j} j  j( P4 P O O i P P| PX l l0 l i P k` k kj ik i P k k iv J|  J  i| i i Jl i` ip Q P l m l k iT R Q Q Q Q Qh \ Z QD U( k< iH V V V V W W| W` WH W0 W W J< JL J\ J t J, X, X W W i, i< I I% X& X' Xl( XT X Y4 UH Y Y$ X Yx Yh YX X YD $ HD Hl H H H I  I4 I\}~~/~>z~Bh< +~G~J~N~X~`~s~{'D1Kd/Xh^zk09]X /Lf7"Cdhp w(Ojx->A`Jr!m6ThTr9ez -Yew,!M$$^ )Ai\|3@Tbq,:FR`wzThf%-7AJYq *6|Hbn{4Pk^ 8Jcx&ì/GQ^gv (7C½Êö# 5ERXV[eqzďĶ  1<f{ŤpƈYpjǐǯBh~Ȏ8&ȫȯ=dɑɢTXbzF˴ 3:HU]p̥̹̑͑ WͰ;)ZCT_m΀Έ eΌΝΨξqϛ-Hdxhp]ҡҦҹbnXbnURԉ ԒԭԺL\r}՞ղGh֌3ׁ׈ mبٕڎ 7 "a4?hۑ@ܩ8U!Qs݃ݙݹ@ޢ޶+@S`hrw߁ߊߛ߯8FRX_jqx /AHR]cm &2=FSbv]c)>KSg~1L[lz0MUzc*4E[4Lew PCGLPVY]aa . . 2l *F/ ٸ t , iϥ   K # )  /{ 7 >r0 D J P U [10 c&n' j( s) z*+ , .1/ftp h@ f   o@ h    p 5= " > 6? P @Ľ <A <B  <C } (D  <E  <F  <G ' <H 4"X t4"  < H1t \1d t \           % 2 A\|[6\}0[7\ . ?$o 04"4"4"4"4"4"4"4"4"C L L L L L L > L Llw L ln  l9 L L M M t M M#  M& M* M. M2 Fa M6 M: M>M MBE MF MJp MNO MRG MV! Mg" Mv# M$ M% M& M' M( M) M* M+ M, M- M- N. N.s/ N/041 N2 N3 N4 N 5~6 N%7 N+8 N19 N:: N6; N@< NO= N[> Nm? N{@ N[s\ N\ N] N^ N^ N_ N_ N` O{ O { O| O,} O8}m~ OL -dd-ddTdd:dd:dd  @@`$,8  (#0#8#@#D#L$X$`$h$l$t%|%%%%&&&'''((()) )*$*0*8+D+P+X,d,p,t,|----...///6;;00 0(141@<H<T=`=l>x>?222333978:444$505< D !T "` #l $x % & ' ( ) * . + , - / 0 1 2  30 4< 5H 6T 7` 8l 9x : ; < = > ?@ @!@"@#@$@%@&@' @),@*8@+D`&P`'`@,p@-@.@/@0`(@1@2@3`)@4@5@6$@74@8D@9T@:d`*t@;@<@=@>@?` `!`+`,`"`#$`-4`$D`.T`/d`%tCCDDEEFFccdde@e##&&(08HLPTX\dlt| @DHLPX`  $@(@64<DLXd l t |@@@@@@`` @ p33333333DD3333HLPTX(UTC33%R%Slnfgmdg,lg33-339gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA&D&P&D& %T 33UU33UU33UU&hph&0&ph& &ph&&|&h-PCCCCCC@LTxC4CCDx   @ \333333333333333333333333333333333333 33 33& !! 0000000000000000 -3333l3333&&$&, (root)`33%hC!!!!!!!!%%fP%fD%e%f|%f!!!!&Tt|P,<H\`hlp(t@lhService unavailablep4A0aeabi&6KZ  "D|SV7xܫO\QLG):1$5`0ʚ ġ++4AB`*T} }7}(2B҂n<޴3y 懣rOv{ҖTX0']Vأ0WgVRYH[MG]zM=溝{Ww{|lnz|\kŸlG\rx٦3<6'3._ײ׭2oϚL߉W̗^kGo~jO]48h5=Ԥ>v\O|=Sgp=W,KK=v?WQ72wN8_ruիu*EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+}0.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BH#P%C<!<V%C<!<$b%C`!`g%Ch!h%t%i,!9,y%kH!;H0&x!x&x!xX-!xp!x1!~!*MSGTXTS626 5024 5049 5066 5088 5091 5096 5104 5111 5119 5127 5130 5133 5136 5140 5152 5161 5174 5203 5218 5762 5796 6479 6767 7475 7531 7605 7701 7748 7771 7794 7800 7809 7831 7835 7839 7842 7845 7950 8153 8392 8833 9271 9306 9321 9333 9339 9351 9370 9390 9430 9447 9464 9479 9526 9564 9612 9694 9818 9954 9995 10033 10070 10105 10115 10164 10314 10320 10325 10329 10349 10459 10479 10485 10499 10511 10522 10559 10593 10617 10719 10756 10778 10877 10932 10990 11001 11017 11069 11237 11444 11615 11679 11731 12003 12553 13082 13514 13852 14185 14298 14313 14322 14482 14653 14803 14967 14990 15014 15029 15104 15244 15421 15576 15588 15668 15769 15815 15841 15911 15922 15931 15944 15970 15985 16001 16014 16069 16080 16095 16299 16532 16561 16576 16645 16719 16792 16822 16860 16914 17368 17394 17423 17527 17633 17818 17930 18045 18149 18836 19095 19235 19271 19441 19482 19618 19641 19678 19723 19974 20070 20124 20223 20234 20271 20308 20335 20344 20378 20385 20410 20437 20472 20486 20500 20529 20543 20560 20569 20591 20609 20626 20637 20656 20682 20700 20723 20740 20755 20770 20788 20815 20842 20864 20903 20921 20953 21181 21255 21298 21344 21491 21647 21691 21970 21997 22356 22540 22692 22873 23020 23178 23199 23247 23257 23265 23276 23287 23297 23304 23319 23331 23369 23399 23438 23491 23549 23570 23577 23596 23617 23624 23647 23669 23689 23711 23742 23779 23801 23815 23861 23890 23924 23964 23999 24027 24075 24084 24093 24098 24107 24116 24133 24137 24142 24146 24184 24193 24220 24240 24263 24282 24309 24331 24363 24379 24384 24394 24417 24439 24456 24473 24486 24495 24504 24510 24537 24544 24568 24589 24613 24626 24645 24670 24693 24709 24715 24727 24757 24765 24805 24816 24827 24838 24855 24872 24886 24903 25119 25423 25871 26087 26351 26623 26675 26711 26747 26798 26815 26853 26867 26874 26891 26894 26899 26908 26920 26931 26940 26961 27003 27019 27035 27066 27083 27098 27113 27128 27149 27169 27210 27239 27287 27520 27555 27762 27781 27818 27879 27917 27956 28112 28127 28173 28200 28223 28259 28269 28279 28290 28295 28358 28406 28450 28511 28544 28591 28609 28748 28770 28893 28907 28917 28940 29045 29101 29217 29248 29253 29279 29318 29328 29371 29381 29397 29412 29430 29453 29483 29504 29530 29727 29770 29774 29780 29786 29791 29802 29816 29845 29877 29889 29936 29986 30026 30053 30069 30078 30121 30127 30135 30139 30159 30176 30188 30219 30475 30524 31100 31127 31159 31187 31239 31245 31251 31256 31277 31293 31315 31344 31485 31619 31632 31768 31770 31772 31774 31791 31804 31822 31849 31853 31859 31864 31872 31878 31918 31920 31930 31945 31962 31996 32028 32066 32095 32124 32146 32189 32215 32259 32395 32397 32477 32523 32571 32676 32778 32817 32884 32891 32952 33016 33020 33027 33149 33218 33506 33644 33785 33866 33913 33919 33942 33988 33991 34017 34060 34125 34187 34257 34325 34418 34637 34662 34666 34702 34720 34748 34790 34834 34898 34948 35024 35046 35098 35142 35181 35215 35245 35276 35301 35310 35322 35330 35341 35353 35372 35396 35445 35462 35486 35529 35851 35854 35868 35881 35893 35900 35911 35918 35925 35934 35944 35961 35977 36027 36035 36043 36053 36064 36082 36099 36120 36142 36151 36161 36188 36194 36204 36223 36239 36257 36277 36286 36297 36304 36321 36340 36361 36371 36388 36394 36410 36425 36440 36461 36483 36502 36512 36517 36522 36540 36559 36578 36584 36603 36623 36643 36661 36666 36672 36689 36705 36726 36739 36747 36767 36791 36808 36816 36827 36848 36854 36866 36888 36902 36911 36932 36950 36959 36993 37016 37043 37075 37098 37118 37129 37161 37177 37188 37201 37224 37246 37754 37784 37815 37843 37857 38058 38280 38447 38534 38551 38569 38586 38615 38662 38673 38692 38714 38793 38985 39013 39131 39153 39294 39313 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-10.99.12. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-10.99.12 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-10.99.12 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-10.99.12 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-10.99.12 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd aktivierenntpd aktivierenntpdate beim Starten ausfhrenmdnsd aktivierenxdm aktivierencgd aktivierenlvm aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte PartitionierungPartitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen?Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS626 5024 5062 5079 5094 5097 5100 5105 5113 5121 5129 5132 5135 5144 5156 5168 5177 5186 5212 5223 5759 5786 6352 6652 7293 7340 7453 7546 7580 7599 7617 7625 7634 7659 7663 7667 7670 7673 7795 7980 8208 8728 9079 9108 9121 9134 9139 9159 9178 9199 9258 9275 9289 9311 9356 9382 9423 9501 9619 9733 9787 9816 9848 9887 9893 9926 10049 10056 10060 10068 10092 10174 10180 10187 10199 10213 10222 10255 10274 10286 10396 10458 10477 10596 10647 10699 10711 10730 10782 10986 11194 11385 11445 11494 11761 12220 12886 13309 13631 14056 14188 14220 14232 14410 14607 14768 14902 14922 14955 14969 15038 15151 15323 15458 15478 15590 15682 15705 15728 15787 15802 15823 15838 15859 15879 15904 15918 15942 15954 15972 16182 16432 16453 16469 16522 16590 16663 16700 16726 16802 17297 17323 17345 17452 17559 17760 17833 17917 18017 18512 18750 18901 18935 19070 19114 19253 19294 19339 19386 19630 19763 19825 19919 19924 19958 19992 20007 20035 20068 20075 20100 20118 20144 20151 20166 20181 20201 20241 20258 20278 20299 20321 20336 20356 20378 20393 20406 20420 20432 20444 20458 20481 20504 20522 20565 20616 20653 20838 20901 20937 20986 21077 21207 21260 21520 21567 21928 22078 22247 22387 22507 22639 22679 22726 22736 22744 22754 22762 22773 22784 22798 22823 22865 22898 22931 22966 23020 23045 23064 23086 23091 23097 23127 23144 23171 23189 23210 23232 23251 23261 23291 23317 23344 23393 23421 23448 23501 23511 23521 23527 23537 23546 23566 23570 23575 23579 23614 23623 23654 23671 23698 23719 23739 23758 23784 23797 23805 23821 23852 23883 23904 23930 23943 23951 23962 23968 23992 24002 24014 24032 24043 24063 24079 24105 24127 24143 24155 24175 24201 24207 24237 24251 24265 24288 24307 24326 24344 24362 24585 24891 25309 25510 25750 25934 26012 26067 26134 26174 26197 26231 26242 26250 26273 26276 26279 26285 26296 26308 26321 26351 26395 26408 26421 26458 26472 26483 26494 26505 26522 26533 26580 26603 26652 26893 26926 27181 27202 27235 27288 27314 27341 27497 27503 27546 27566 27585 27614 27621 27628 27635 27640 27689 27727 27761 27818 27846 27891 27908 28009 28014 28091 28105 28115 28139 28262 28343 28453 28481 28486 28502 28531 28539 28580 28587 28601 28614 28622 28641 28674 28694 28714 28930 28961 28966 28973 28980 28984 28998 29010 29025 29058 29071 29126 29184 29220 29238 29256 29274 29311 29317 29325 29329 29350 29367 29378 29400 29578 29622 30324 30348 30382 30401 30446 30453 30460 30464 30488 30499 30504 30567 30688 30811 30824 30958 30960 30962 30964 30974 30983 30996 31023 31027 31033 31038 31047 31052 31079 31081 31094 31106 31121 31149 31193 31240 31256 31278 31289 31322 31342 31391 31491 31493 31558 31607 31656 31760 31858 31899 31990 31997 32058 32122 32127 32133 32242 32301 32552 32693 32820 32888 32925 32932 32959 33005 33008 33029 33074 33125 33184 33253 33300 33405 33548 33573 33577 33611 33628 33652 33704 33755 33827 33893 33991 34008 34039 34075 34109 34133 34157 34190 34210 34220 34228 34236 34246 34257 34271 34297 34345 34368 34388 34429 34728 34731 34745 34757 34764 34783 34797 34804 34811 34820 34830 34847 34863 34911 34919 34927 34937 34948 34966 34983 35002 35022 35029 35046 35063 35070 35083 35118 35135 35154 35174 35184 35200 35213 35231 35251 35272 35282 35302 35322 35335 35354 35367 35391 35414 35427 35438 35443 35450 35468 35487 35506 35514 35533 35553 35578 35596 35603 35610 35623 35632 35653 35666 35674 35694 35722 35739 35745 35756 35787 35795 35808 35830 35852 35861 35882 35900 35907 35930 35949 35976 35994 36014 36027 36042 36063 36077 36084 36098 36113 36132 36677 36710 36738 36767 36775 36812 37124 37301 37378 37395 37413 37428 37450 37500 37510 37527 37549 37608 37766 37790 37920 37945 38071 38089 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-10.99.12. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-10.99.12 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-10.99.12 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-10.99.12 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-10.99.12. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-10.99.12Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-10.99.12Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Set up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS626 5024 5060 5077 5092 5096 5100 5105 5116 5122 5128 5131 5134 5137 5141 5153 5165 5175 5205 5217 5647 5674 6250 6610 7295 7356 7434 7529 7569 7591 7609 7615 7624 7650 7654 7658 7661 7664 7786 7971 8199 8728 9146 9175 9188 9201 9208 9228 9247 9270 9313 9333 9352 9375 9419 9448 9489 9555 9667 9781 9835 9864 9896 9935 9941 9974 10052 10058 10062 10067 10108 10245 10255 10263 10282 10296 10305 10337 10378 10391 10516 10574 10593 10712 10768 10820 10831 10847 10886 11136 11308 11480 11535 11570 11820 12224 12523 12791 13152 13332 13651 13671 13684 13873 14017 14213 14347 14367 14400 14419 14520 14675 14863 15050 15070 15149 15247 15285 15308 15398 15419 15442 15461 15485 15515 15559 15592 15615 15627 15645 15913 16232 16263 16298 16362 16437 16507 16538 16568 16660 17151 17181 17198 17338 17479 17676 17795 17942 18109 18667 18963 19144 19189 19352 19406 19541 19577 19637 19687 19978 20087 20144 20241 20246 20281 20316 20331 20355 20388 20393 20418 20434 20457 20464 20481 20496 20515 20547 20551 20571 20589 20601 20614 20632 20656 20674 20693 20720 20747 20759 20780 20810 20840 20865 20898 20933 20971 21224 21293 21348 21409 21527 21686 21740 22001 22052 22428 22583 22727 22867 22975 23160 23190 23233 23243 23251 23261 23273 23294 23303 23309 23341 23382 23418 23456 23493 23541 23565 23577 23591 23599 23607 23635 23652 23681 23702 23725 23734 23753 23765 23809 23847 23874 23918 23946 23973 24026 24037 24048 24055 24065 24074 24108 24112 24117 24121 24156 24166 24196 24219 24248 24270 24292 24314 24341 24353 24365 24384 24418 24451 24472 24496 24509 24521 24534 24540 24566 24576 24587 24611 24621 24641 24661 24678 24704 24728 24741 24761 24795 24802 24831 24854 24877 24893 24908 24923 24938 24952 25140 25445 25876 26067 26302 26490 26532 26582 26636 26684 26706 26747 26758 26766 26790 26794 26798 26807 26818 26829 26844 26875 26921 26934 26947 26977 26991 27003 27015 27027 27045 27068 27113 27136 27196 27448 27475 27737 27755 27782 27831 27861 27892 28024 28031 28080 28103 28127 28156 28164 28174 28182 28187 28240 28289 28329 28395 28428 28472 28495 28596 28601 28678 28692 28702 28726 28849 28930 29040 29068 29073 29089 29118 29126 29167 29175 29189 29202 29210 29229 29262 29282 29302 29518 29549 29569 29575 29582 29586 29601 29620 29646 29655 29667 29721 29779 29814 29833 29850 29862 29897 29903 29911 29915 29936 29953 29964 29989 30167 30221 30912 30931 30966 30996 31042 31048 31055 31059 31083 31099 31105 31180 31330 31449 31462 31530 31532 31534 31536 31546 31559 31576 31603 31607 31613 31618 31627 31632 31659 31661 31674 31686 31701 31729 31773 31820 31836 31858 31869 31902 31922 31971 32071 32073 32149 32204 32254 32353 32448 32496 32586 32593 32654 32718 32723 32729 32832 32884 33130 33291 33446 33517 33570 33577 33604 33654 33657 33678 33724 33779 33838 33907 33954 34059 34202 34227 34231 34265 34282 34320 34373 34413 34489 34554 34648 34669 34707 34747 34783 34807 34830 34869 34899 34906 34915 34923 34931 34945 34961 34989 35041 35058 35079 35123 35465 35469 35484 35495 35503 35522 35534 35541 35548 35557 35567 35584 35600 35654 35662 35670 35680 35691 35709 35726 35742 35760 35767 35785 35802 35809 35819 35850 35869 35888 35908 35918 35937 35950 35970 35990 36011 36021 36040 36059 36069 36086 36100 36123 36147 36160 36170 36175 36179 36197 36216 36235 36240 36259 36279 36304 36319 36323 36330 36340 36349 36370 36384 36392 36412 36438 36455 36463 36474 36505 36510 36523 36545 36560 36569 36590 36608 36617 36661 36685 36712 36727 36744 36758 36789 36813 36844 36851 36865 36880 36899 37444 37477 37505 37534 37542 37579 37891 38068 38145 38162 38180 38195 38217 38267 38277 38294 38316 38375 38533 38557 38687 38712 38838 38856 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-10.99.12. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-10.99.12 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-10.99.12 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-10.99.12 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-10.99.12Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountMSGTXTS626 5024 5065 5081 5099 5103 5107 5117 5126 5132 5138 5141 5144 5153 5163 5176 5184 5195 5220 5232 5741 5773 6265 6554 7099 7145 7249 7335 7371 7386 7404 7412 7420 7447 7451 7455 7458 7461 7572 7757 7985 8461 8795 8824 8839 8854 8862 8876 8894 8915 8966 8982 8992 9012 9058 9088 9141 9198 9309 9430 9474 9507 9546 9580 9587 9620 9697 9703 9710 9717 9746 9858 9864 9875 9892 9909 9918 9947 9959 9969 10070 10132 10152 10272 10309 10365 10379 10400 10437 10647 10822 10971 11006 11058 11275 11589 12113 12475 12765 13158 13293 13306 13317 13463 13642 13773 13907 13927 13960 13979 14062 14177 14318 14443 14457 14565 14658 14687 14707 14783 14800 14818 14834 14853 14873 14890 14902 14928 14940 14958 15159 15398 15425 15442 15498 15560 15620 15651 15675 15734 16110 16140 16157 16265 16375 16515 16589 16665 16743 17235 17455 17566 17597 17724 17760 17888 17915 17955 18001 18217 18341 18409 18509 18514 18550 18586 18600 18623 18656 18660 18685 18704 18730 18735 18750 18765 18784 18809 18821 18843 18860 18873 18885 18903 18927 18942 18959 18972 18983 18994 19014 19043 19072 19096 19131 19166 19193 19380 19429 19461 19509 19606 19739 19785 19977 20007 20329 20458 20598 20738 20855 20990 21034 21077 21085 21095 21107 21119 21127 21138 21165 21199 21235 21266 21301 21337 21384 21404 21421 21439 21444 21451 21477 21493 21514 21531 21548 21566 21583 21596 21627 21652 21683 21714 21749 21776 21829 21839 21849 21855 21864 21872 21887 21891 21896 21900 21935 21945 21974 21990 22016 22033 22052 22073 22089 22102 22107 22115 22130 22156 22175 22203 22221 22232 22238 22244 22265 22275 22286 22304 22326 22343 22356 22377 22397 22417 22428 22441 22463 22470 22495 22510 22530 22542 22559 22576 22596 22615 22792 23076 23386 23566 23777 23965 24031 24078 24133 24177 24197 24226 24238 24244 24260 24264 24268 24276 24286 24298 24313 24332 24368 24379 24390 24429 24441 24451 24461 24471 24487 24505 24554 24575 24620 24864 24890 25144 25159 25185 25242 25276 25311 25453 25470 25519 25540 25556 25585 25590 25595 25601 25606 25645 25680 25710 25765 25798 25844 25858 25937 25942 25996 26010 26020 26044 26130 26178 26284 26318 26325 26340 26367 26376 26415 26422 26444 26463 26479 26497 26529 26548 26565 26722 26753 26760 26769 26777 26784 26798 26816 26835 26845 26857 26898 26943 26972 26993 27016 27035 27073 27079 27087 27091 27112 27129 27138 27157 27303 27345 27855 27863 27887 27905 27949 27954 27959 27963 27994 28007 28016 28062 28188 28279 28291 28355 28357 28359 28361 28371 28385 28400 28427 28431 28437 28442 28451 28456 28483 28485 28500 28511 28526 28554 28598 28645 28661 28683 28694 28727 28747 28796 28896 28898 28966 29006 29051 29126 29192 29227 29308 29315 29376 29440 29447 29453 29552 29608 29884 30008 30119 30181 30219 30227 30249 30298 30301 30322 30367 30422 30481 30550 30597 30702 30845 30870 30874 30908 30924 30949 30997 31033 31094 31148 31229 31251 31290 31327 31359 31383 31410 31436 31450 31458 31468 31476 31490 31503 31515 31539 31580 31606 31623 31652 31976 31979 31993 32005 32011 32027 32039 32046 32053 32062 32072 32089 32105 32148 32156 32164 32174 32185 32203 32220 32233 32259 32266 32274 32291 32299 32316 32340 32359 32378 32397 32407 32418 32432 32450 32470 32490 32499 32522 32542 32553 32568 32580 32599 32618 32629 32639 32644 32650 32668 32687 32706 32713 32732 32752 32777 32794 32800 32808 32818 32830 32851 32867 32875 32895 32915 32937 32945 32956 32979 32986 33000 33022 33039 33048 33069 33087 33096 33127 33143 33170 33189 33209 33227 33248 33262 33282 33289 33308 33323 33342 33887 33920 33948 33977 33985 34022 34334 34511 34588 34605 34623 34638 34660 34710 34720 34737 34759 34818 34976 35000 35130 35155 35281 35299 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-10.99.12. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-10.99.12 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-10.99.12 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-10.99.12 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-10.99.12 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-10.99.12Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-10.99.12Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # Rapid commit support. # Safe to enable by default because it requires the equivalent option set # on the server to actually work. option rapid_commit # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostname else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime [ -z "$rdnsstime" ] && return 1 ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers [ -n "$rdnss" ] && new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime [ -z "$dnssltime" ] && return 1 ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search [ -n "$dnssl" ] && new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf return $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" # Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log run spool ... ... ... . .. lock . ..