08V?g<  V?g_Bt tV?g@@<@T 08V?g<  V?g_Bt tV?g@@<@TU V?gt`AV?gV?gV?g$h V?gV?gV?gAV?gV?gV?gA.V?gV?gV?ghpxAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gmDT"V?gV?gV?g (08@HPX`hpx$V?gV?gV?g8@HPX`hpxN$)V?gV?gV?gK$(V?gV?gV?gM$CV?gV?gV?g (08@HPX`FAV?gV?gV?gCV?gV?gV?gAV?gV?gV?gAV?gV?gV?g!V?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g4!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g B!V?gV?gV?g B!V?gV?gV?g!V?gV?gV?g"!V?gV?gV?g"!V?gV?gV?g"aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g?\!V?gV?gV?g>\!V?gV?gV?g=\!V?gV?gV?g<\!V?gV?gV?g;\!V?gV?gV?g:\!V?gV?gV?g9\!V?gV?gV?g8\!V?gV?gV?g?\!V?gV?gV?g>\!V?gV?gV?g=\!V?gV?gV?g<\!V?gV?gV?g;\!V?gV?gV?g:\!V?gV?gV?g9\!V?gV?gV?g8\!V?gV?gV?g:\!V?gV?gV?g7\!V?gV?gV?g6\!V?gV?gV?g5\!V?gV?gV?g4\!V?gV?gV?g3\!V?gV?gV?g2\!V?gV?gV?g1\!V?gV?gV?g0\!V?gV?gV?g7\!V?gV?gV?g6\!V?gV?gV?g5\!V?gV?gV?g4\!V?gV?gV?g3\!V?gV?gV?g2\!V?gV?gV?g1\!V?gV?gV?g0\!V?gV?gV?g2\!V?gV?gV?g/\!V?gV?gV?g.\!V?gV?gV?g-\!V?gV?gV?g,\!V?gV?gV?g+\!V?gV?gV?g*\!V?gV?gV?g)\!V?gV?gV?g(\!V?gV?gV?g/\!V?gV?gV?g.\!V?gV?gV?g-\!V?gV?gV?g,\!V?gV?gV?g+\!V?gV?gV?g*\!V?gV?gV?g)\!V?gV?gV?g(\!V?gV?gV?g*\!V?gV?gV?g'\!V?gV?gV?g&\!V?gV?gV?g%\!V?gV?gV?g$\!V?gV?gV?g#\!V?gV?gV?g"\!V?gV?gV?g!\!V?gV?gV?g \!V?gV?gV?g'\!V?gV?gV?g&\!V?gV?gV?g%\!V?gV?gV?g$\!V?gV?gV?g#\!V?gV?gV?g"\!V?gV?gV?g!\!V?gV?gV?g \!V?gV?gV?g"\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g\!V?gV?gV?g \!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g$!V?gV?gV?g4!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g?\aV?gV?gV?g>\aV?gV?gV?g=\aV?gV?gV?g<\aV?gV?gV?g;\aV?gV?gV?g:\aV?gV?gV?g9\aV?gV?gV?g8\aV?gV?gV?g?\aV?gV?gV?g>\aV?gV?gV?g=\aV?gV?gV?g<\aV?gV?gV?g;\aV?gV?gV?g:\aV?gV?gV?g9\aV?gV?gV?g8\aV?gV?gV?g:\aV?gV?gV?g7\aV?gV?gV?g6\aV?gV?gV?g5\aV?gV?gV?g4\aV?gV?gV?g3\aV?gV?gV?g2\aV?gV?gV?g1\aV?gV?gV?g0\aV?gV?gV?g7\aV?gV?gV?g6\aV?gV?gV?g5\aV?gV?gV?g4\aV?gV?gV?g3\aV?gV?gV?g2\aV?gV?gV?g1\aV?gV?gV?g0\aV?gV?gV?g2\aV?gV?gV?g/\aV?gV?gV?g.\aV?gV?gV?g-\aV?gV?gV?g,\aV?gV?gV?g+\aV?gV?gV?g*\aV?gV?gV?g)\aV?gV?gV?g(\aV?gV?gV?g/\aV?gV?gV?g.\aV?gV?gV?g-\aV?gV?gV?g,\aV?gV?gV?g+\aV?gV?gV?g*\aV?gV?gV?g)\aV?gV?gV?g(\aV?gV?gV?g*\aV?gV?gV?g'\aV?gV?gV?g&\aV?gV?gV?g%\aV?gV?gV?g$\aV?gV?gV?g#\aV?gV?gV?g"\aV?gV?gV?g!\aV?gV?gV?g \aV?gV?gV?g'\aV?gV?gV?g&\aV?gV?gV?g%\aV?gV?gV?g$\aV?gV?gV?g#\aV?gV?gV?g"\aV?gV?gV?g!\aV?gV?gV?g \aV?gV?gV?g"\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g\aV?gV?gV?g \aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\ !V?gV?gV?gi!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g!V?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g B!V?gV?gV?g B!V?gV?gV?g!V?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g!V?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gV?gV?gV?gbpf!V?gV?gV?g $V?gV?gV?g$V?gV?gV?gf$>V?gV?gV?g$V?gV?gV?g$sV?gV?gV?g$V?gV?gV?gAV?gV?gV?gm V?gV?gV?g$V?gV?gV?g $V?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gel!3|O| X REr+ WVs_DuDB W-n2zoozC*03>EbJO7Af5 1Yyke"Z xVk3cl(9=kZB~`6*k\-Of];g"| ;KOry~xb.Wu*&/`\RƳ(:$vV |FkY9Ԥ4ujjI(p_Ъ?$S"z@>ax%z *_RgK̳?%um/p|Aʂ#+qci^,gW]w <" dwiLK-1ZGR I$$ȇt쒰M5*rK+ppuhIx51~k@v4I(*hT)?nAacI4~y]ABQjVaf WE-Ot-;a8 :O^IsBs&4$a{6xAiNIFG=1,N6f }t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4"4 (&!&!5!e%e%lLL5!e%e%NetBSDpmAPaX NetBSDearmv5hf3D0D 0p@-&5"bLcp>&H0`  BR` pR RX X/6&p6&@-,u0 SKě6& 000/B&pC-P0-` M؀ @+{ A (+`P40 A00{{z )ЍpY@B&$%6&00@-@ M @  P  ЍÞ t1A-0XZ p03 9@P t0S@ ((@0X;0% )P- u U @0`V/PtX`! pt0-S ]@|@PhP UPP@ U(p0SX $%ОڞB& 6O-M@T  @P Ѝ  sp` @5Xp0S 5%0 0 |5X 0S_d50S&<0pP(@`0SN50S0p  8pPJ400<T$尠E?00CS0 ,Pᔔ Pp  PYU *0 P00CS0 ,0 X80: S  +M +pP p Qt  X0 0 0\3$05x000,  00 Q00S(D 0 0 `FQp8 p  000Y H 1(#  0P U@븂P~ tK0S@zK"I 0R 0[0YY]820#4 [ p00R0S 100S  0 7(^ Pʨ0S;pa@T c@P@ 0R?o20S 0  H1 0R0P( @LP @0S "P0S $P X,Ty P0Rt00!bP B&$%5B&B&B&B&B&dB&6&6&B&B&R&B&B&0@-MM@ P p  ;0U$C d6P TTۍЍ08 P0 (0P X%$%2=B&Q@-@ TP DD^,P $ 0P@$%2IB&Q@-@ XP HH?",HP $ 0P@$%2TB&@-ir0 ^6&0$/S'0$/R'@-$@-$@-$@-$'um@-1  0 0 Ѝ<S'@-1  0 0 ЍLR'@-1  0 0 ЍXS'@-0  0 0 ЍdS'@-0  000 ЍR'S'<00/@-0  00 Ѝ S'{R'<00/@-0  00 Ѝ S'S'@-1 0( z 0c Ѝ䞠S' 0@- 00 f$0P@NЍ誠(%,0C-`!A圁圑M!pW0 |! R0B=00 B  Tn0L 8 R<B 8!4100!0ЍPP #==cP 0p00S  0 P0P      0 3/R ! 7000@080L#D0R' S'S'u #=?YS'w00p@-|@PtP00 R 0p800 p0  B0Sqs S'S'R'0 0 0 /S'R' @-[#v 5@- @-R#v 5@-80@-M0@@(3/P $ G#H08 : S( 0h 3/ 0P  0 0Ѝ000  1/qpp0S 005m8@@-@ VPЍ@ PЍp@-(`Vp80@ 0 3/PP#8003/(Ppӡ@-@P`P v80 (0(3/@p PipPЍpR'3 PO-MP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 AMW 000+ xpt| j  ЍO0 P % Hpp 81/qp4 "  ?P p 4 n" p0S4 tp0 0 0 0 "i0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0噽004 8pX  FЍR'T ܡR'56R/ R 0 0/\\CC B 0R00!/0"SSS S S S S SSS SS SS SSAQ0A/C-MhB0 0  T>0 0 8 6  ?$ Ÿ ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!d!!4! P ` !/4a4 " BXX P!d44a4 " B   !d4 4`4 # B  d44`4 /0h8p<0@! h` @d44`4 ЍS'XMb0S'ĢW  3U@-@RJG-A `00P4 82#&PP0 (1/qp $ !봀嬐pUЍ0S0C080$0( 3/P 0 `V`PED 0  Z $ "S'5 S'(%m@-MTA P04 00#!8 0 (1/qp$  P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0080p p0h( 3/pLp #U0* 0P`/RP `R'5m@-@L M 0Q   0    cЍS'WތO-IMwM0@S`. 8S+ #='00S( 0 0t0B"h ! !;x00#H #4|0 0/&( %)IލЍ&Z 0 V0 `S 0E0VS06  S  S $0S0 600000S60 0|60 00 h6Rd|_ 0Rr0C0C00Q0 0S. ,B< 60P X$  ( ( ,0S 0 $0P0,0(0000 0S $Y# 5%k(0Sp%0 h%00   0PP5 ,0S 850 00%0([5$`VM / V 7* g 0  8f8 04p$(f g 0 f`,00 0t 00,00 (0$ @D@4 0@ ` P% g840$0z'(0吃# yg 0吳e&p4`00S0 ,0S#$`V 0 !40S l"\ /\ * Pg0 ~f 0$ Cg !5#  0$`[d5 0 !{0$ ( , r0  !k,00 0X 00,0@0 (0$ DU81,0S 0`QP L0P0V40> / V Ё'* f 0  <f< 08p$(f f 0 f0040008 40 D f880$0y'(0吃# f 2!p8`  0 @D  0p jCS' ԣFw0%ɤS'uv AcM3(bLRiBv Vd :إv ƥߥ@-pbPP@`D1 fP Ѝ`3MU@p@-XP8@T`@D p P<opQ<PpS'A-AP 0$ P0 0 SQ ( $0AP kIh d`P, 0R1@a@qU`0``00Pk, 00CS000    0,`0CS0000 (00/U R Pk8 4UD 0$00 0$ @T'56&ܧ@V'1U'T0 S 0SP/P/S/@-g@T'j p@-XAXT0040S+@! PP P0P`04 PV R@40 0PSU40 ^*00"  0PE`PP 0P4  S U 4P0C SR40P 0P = p@V'@T'4%U'U'p@-@8P0 00@0@00000pU'U'G-PP0 jP0 ,(p 0 R`Gv@0(S  &Pj. (N+?$00 0(0 f\0V0? 0"ej8 4j@Ђ`Ɵ56&1@T'ܧ 0p@-?0 @0P_P@\ 0P 00S/S`ق8Ppp7p@ \!P(#D8<pU'U'-?3@T'xT'Lf5ip@-@(P |"P 8@i\ 0TP9p8PP(P 988P 0"p@T' 6&@-P4@(P S"8P !8080@T'HH @-yP(0 00<0   RX'6&@T'@@-< P9:R?0jP0: S 0SRP0: S 0S 0S 0/S&@P3EP0SLP( ᤟*P x#0 PN+>d0P 4#]P] P T/P/PPPppLP! 0S0S r EXG X00CS0kX pp Pph pYWr TT{\H Z0Sh0S0?o25c 00?G YU.0.0 ePG=0JPT.0.0 SPG=0INP804@p1l0l 0 0  L00S   5l6&7 yZ'Z'tZ'$0\ 0S   Z'7 5 L R/   / @-M R    !p|pЍd d@` Q@X  B ?2E 0Ѝ@8Z'@Z'TZ'W\Z'~XZ'P `00CS`0p S00 P0S X0X /X6&: S@-  S  S/ I* S  S%|@=1A-`@XPTMp !\@T10S H10S. 00 00,10'pf e@0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?D 05T00S g00CS0 0 /O-`UDMp .E0%00000 0000S@V"4`0p Q 30Sa4PZ|lPZD0d$1000 0K<$PD $00V 0030p Q  #P0 0D#00V0030l#PD`#00L3000DЍp(0: S ]0 S" P 000 S|2"00"0 0R0  Rz2`2Vn `i S0% 00 08<qpcD0S 唠00 0p) W W)2`V%  ? > 10 R0  S0R 0!CQ:++R:0'WW`a~0@ 0 =T04[@T ;0W ` W00l W0~, ~l0`Z BP* BP*Q*S  Q T0``%Z']'%l%(['İt%ް}%+m8@''%}D00S/@-~M0@0S~, P~܍Z'`%@-0p@$0l00S Ѝ00 0y;0Q C, /qP`%Z'\L0@- R<U/P 0 0 I/Z'|('A-p`P@ `0PPEU`@T@A-p`P@ -0PPEU`@T@p@-P@Tڬ` 0Q1@Pڄ0  Q @;;S p!@P00T@ ,C(0, D/( .`%Z'' @-,BPU` Vb0P$00 p?W0 pGWhPhC0 SV.00P ЍP#ڀ;;S 00 0:0Q P?PpH1p0$ppQ Q (% 00$0SP ( .B0S00B0ES00B0S B0ES $0Sn.B0S B0S B0SPU B(0, .`%Z'.d( Xt!0SX@-M`Q0S T100CSD:.Ѝ0S0SS/ 0070S S00.S@0S0T0pS0p L:Qo 0<p T0 :Q0P0 0P000S$ʲ/Z'`%%wmGG-PP`0  ,p@P"ڴAQ"9Q 0Q P 09QAD  .ЍP 0S`%Z'@-PtaMP d1@0S2 SU@D;00U0p0p 90QA!-Ѝ P0S(0S 0y9QA  Pڌ0U 0?W;  dW-0 P 0PA 00 -`%Z'۳ 7\'gm}O-Mr,M R(`RX0E@FP0 0S ጒ000 S (0S d  T"CpL20 0 ;8"0J6J? "00/To" ?=܍,ЍT 0S =! !!0`2 10Sx1pp1 00:8!0JJ?08!00,q00$1(`(0 C0娀J 00 $0 : 0x  0  ` 2 Tꬖ%6&Z'd('Ĵ(wa']'P'`% C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S Q1  4 0S pP (0: S0 0 p10S10S P`mP D0 0 0S q4j 1 300 0S00p0000 S(00(000 P@0S 000S x0<;P 0+P0p09 0X$3`%]'Z'(0((((>['%L(nd(u''zA-MM0 P?#,G P?",RB$0`SF 0`CĂ0S2t+p:P} :Px 0 u S( .p`+l^+h2Lr0`0CSXXU+R+HP+DN+@L+<Z+P,:P000 0;+2 `ލЍ1+0S  R  sS SS YSQP+yS+$qx+l +<+P,z:P 0S8 4q:P( 911P *0S(*PP rnP0000**(`%Z'((t%l%%Xж  T C(:[Qp$@ aϷ00@-@HpSp`谖%O-L|q| \0S(P1`XX@P"@U(,L0 R1V10S *@DT  A%0d#0UPTP*PV0S tw*`@`ꓢ"H 2/L0P ! 咣#, 0:蠖%%['%['d(O-@Q0p`F@ f[ PppWPH=* ЍPT10S ,*p@ 0$0 3/P$ 0 R T  A@?% 80  3/PtP`\00Sd `) Q < 02/P " "d(['%+Na'['t@-AMMP/P=@P+ p`p%P/00P Up0p *AލЍT0_"/0P0 0, 00`*a'ȹ['ܹ00CS0 0 /O-0S$M00`Y P$Ѝ$P0,03/P00`T30S ,@C@sFP7PPP 0030SY  PV e20S v!P!P x4 CSR P8 ,G XPa=7"y) H70/SWP1/ A>$X | 10S  P0S !S 0l!202;/P Z ,"81  0S a0S 1100C `]0D0 3/`7 0S 0S 0VP0x0CP0&P"P0403/Od(X(a'(H((('Aa'a'((['('@-<@P<( (.['[@-p @@< (x@-@p< 0(@ꌺp@-MPp@<0S  0C0< `p 0: S@S NS Ѝp{<`C-MzPЍa0H03/P0 03/P tA]pP@ 0AS0 @0a3/PE0 0#P)3P/P WP0/S4P. A#00 006@ <t 8(0(03/\ gr0 Pd(a'a'a'p6&6&(O-MPЍe0H03/P0 03/PP㏧D50S 05$P ;%'50SuJG>P 0(03/ #P 0AS0 @0a3/P|4C003P H4 C(P(40S  P T 0 0  P 0R S = $ `0Sd003p0St00PP p@S`3`0Sd00/SXP2-, A?" S0 0  P0SW 0S = $ `0Sd002p0St000S "SD p 0 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P |1 Hb X RP$PP ,1PO.0 P E @ ;/0S0S P0S 000[\000*4S 0S 0d( (%X('('T(a'H(@(0'a' 'a'(($((( (%(G- R@}P T T 0 4&@H03/P0 03/P0SB0 Y Pq0 09paMP P: 0 P0(03/P@F P0 0 @0S 0' 00OP@' o?P0 0t0 0S TPP \0 CY yPd(ʺH((0(a'((n(('T0@-0S\PP 00H03/P@H(d(O-MMD嬀0$0& PP PpkP44( 2 C 040p萾(0@-PM@ aPh00S Ѝ0 $ R\ 04 0R\ T(ľ0@-MP @;PЍ000S0: S|.PlPU 3H 0P 0:'3 0T(T (0@-M@, 0000S# Q0S 10S P'0S% X0 ?A3c000S&!h0 ?A3c0 'P t30NS p3` 0Ѝ0h3D 00S ּp%%Mb*p@-@P`˽P p P $0&A3 0Yp(U@-!@nP 0&-30 @D(sO-P0$/SM`p//$@P7 mP. jp /00 TP&  P!00S  3P HP0 Dx Ѝ(G-@P 00/S (QP 00Q G 㭻⑟ZP20 0`0S Uc뤀夐p0 咽eP20S@$<jPH0@&48 @岡D(  ((A-M`P@p̼P5(10S Ѝ 0RP  0RP 0: S_-P PE2 0]ዼPW iP 12 P W$ 0@?T(T 6G:(40@-: SM@=0P - \ 00[ P0 ^p 0: S0 Ѝ000 ta:P/  0 fA-pQ?ZdV`޺P1P!0@1@0S/0(DS7 (1!0 0 =  "4S pպP1p 0Ϡ 040Ѝ@$<@0(DS PL(DPL(DP 00 0ꐾ((%%(O-J#3(tQJM0 M`p P 40CS񟗄`3i,P x30S ᪻P0: S* XP2,3,0(So0S| ( 4S~ 0S20S 4m0C?o2 000! "p"p1"0 ,X 1Z/ Z\20S0 P"0 J>0P@z=0 C᝺z Jލ Ѝ   Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40+Pz P#P0 0`0 + C`\ \0Q0O0S0(4 008 00(8(((%% (u(/O-Mp@ W 0DQ 0S8 00<000SPP0C080pG0S `0S : 8 00 x! x3  P< 50@0  0R X2@ ?@'Q*"0@0 :0嘰 R cP` hЍTT ܜ  ` `@^@((P((Rs@-Ѝp@ 0@`P'Q/< 0$ ᣸P/ 0v(^0@-@MPP˸00<00S =  J"Ѝ0(G-`QM MJP Y@ #p ዸP p 00PP=! SR J(Oݍ ЍPJ}/8 = $ HL0RP J(L00 06'QJa/8 PTG- QP 000aq@T+00CS0pT0 0S0T@ 0 S@ 0   P 0S@ 00S 0 S P ((,%6& 0 0 S@-0@0R00000S0@000S `ǛP PP40P8(<((,( (p@-PP 0Sp `ល@P`  @P0/S000000f PR @@@p '(h0 RX R  H R/< R/ $R/Q/ (L(4(\(l0A-0S X0XPX`Xp@0T R S9 y0@((56&NC-@b,M 0S0S/,Ѝ0 0P50C S>#$#$,##$$##x20S X00 00!P 0 000! " ,PPP  0!$5$!0 0!0 㓝z I XB-(4 : S>  S8  S%  S04 0L! 08!  J1(P6 S  S0  S04=! 0400S -Ё ;ЂЃ"040+0 4堶P-0P 00  0  O(({ (up@-8M@  =D 0`P`6 0U` @P8Ѝp x1A-hM0@S\ }hЍA Z`(5="(<p@1Wpp P0 0000084Y40CSH$0"60"$K0( F4 CR+x = hЍB>'T4S+<  {(5W'` 92v@-=XM"@p:(Ԙ0 XЍA7@-@Pp  #P Q Ѝ00 5 W Ѝ0@W0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-@@+0CQP0"S : Q%R0W^$B0CBSB 3b 30O+@pQ0^AC S*p P@-*0S ^*00 S R( \000C R@30 ? SR@*:@ 00 C@ T \A C@T2  0a0C R"  p@-0C@0 PR"S :$B QN%R02W" 0C@Q `@ 0*PpANQ0 C S*80P @-  //D(JA-@4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<=2 @ 9`3@ <2 3X2 @ .83" *2 @@ %2 @ 2 L 2LP 20Aⴁ娑00 RK aR eB Q P0AhAhAhAhAhAhAhALAhAXA`A !00000 00K1]PJd1 J T1 I 0 I Hꈁ 0010 L01Pd H((((%/&%(6&p6&'Z'T(%((%L((X(n%%%%֖%̖%\(% (L6&y0%nw RL`(P(%(H(- . 6&ſ(E D('(?@(ej<(['8(0(,((($(%(L-['N( G 0.d(%/&(% TP#&L#"IP'0  0 G 5가z0P  ,G#,1 F  1@ !P00F DP|`1*PE1 E 1 D s1 1C1WPC1PB 2 B 02 A @2 A P2 p `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C ~0 0S3# C*SS8C0U Pg000Sv|30Ueڌ3PEPhPN0000S3 Y0P  /(l0P/`0p@-0T L@LPP@0@( P6 B(d(.]6&(A-` @PA?\+ \ *\.  Q R( [\SPQU  !\@@]^.!Lo \0S8 /0S 0R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ \(p@-@@0/SN00N P`RpPQP`Q*C0CT0@"03L00Q*pQc 1@-M MP AaqR P/kP 30P0Sۍ Ѝ.S@T|`l @ @(4d  O-cM M33 "p@3]PW00 `00S 0f00 0=P` 00 `;RSVz 0 0@;T* R`DV:  cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 n 0@&P\P   (0 0CP;T+ 0S( `0V"p0S 0 0S ፯0S s :0l 0 x|@T *0S0T00  R S ( 0 ( 2o6&LC-`PMM RP  p\SP RT P0S #  0SR[\S R. gS PS$ SS GS =F(0 0=pS sS0S00 R @@@(PP!P 㿏@P p P ; 80  ۍЍ'(A-PP 0Sp`pᐏ@PL P40 pR `@ @ @EZ(X0A-TPT`Tp@0T  SU ᕮ0@(56&`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0 ᆑ04P 0S/  00p0S/  `00 @0/S000 0D$ /(L(\((A-0j40@TPp 00S0o`0 00/S @Tx0T0oP0 SD fP04(L(`(2A-@0PS' 0`.S0.S0S/S \djP 0 Q CR S.R  S.R0S/S { 10S410S 4P:4 CSR ! Q`V 0/S0S.00 pl y00C0V0@0E `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0T T0A0 B!"00t=&A-@QpW : J(S20d 0200CS1000=P   0 R ⨁0≎ᩑC  S.@ 3 b 30  J(LPu[[0P001  =ЄЂp 0(ZP0<x SP0@ LP00 0 CPP t00 08P` #PJ>PP P >(X;((// Qp@-(0PS$ l` վ@P|t 0000\0 `%V0 $ @p`(hO-P`P Ѝ#a:J084YqW V#\/0p00K0CSt3l IPk 0<00D3  a  d 㒝 (|qp  }? $00040J0H1GP tq@0 B<(1P lc<0 㓍 H K06S 0S 3 CRU88gSy K CRZ 040r;;000(4 9 xS!04(4:(404(49(408400C /Q000Q($4S::  $R (4 @ 04&"**0000 02S($0 *4($0)40($84  R  KS 0 040r;;000 0KS8  0( $ (((O-z4MS@- S `cV:60VS0d`F`0PS/S`S 0EoᨂSXA | 0CSЇX0LI{pP1 0pI *! *8)ЇX0I4fpP 0p4 *NЇX0G RP 0 pptk 1  :x0p!z 8 PpX  :x0p!z 8 PpX  :x0p!z 8 PpX  :x0p!z 8 P!  N8qPpX  !L8@ Z:w0@! @ 8P@W p W0p(5@- ؝К6& 0 p@-P@T 0Q00S0P0T`00000ހ܀ڀ00CS000S p ( (A-ph@h`0P000SP'U`00CS0$00SA (( (p@-@H`P0S@'T`p QP(G-0a000P60@ R'QS \!0 00CS000S V0 딀唠`D pYG60W0?Y00CS00 %W 0p (( (%0@-S R'  (A-pP`V@  @P*Pp@-XP>@P hDP0P 000@aT8@p(A-ppP000`5@50 050000CS@000SA ( (p@-P`@T  PV 0@p@@-PG-`=0@T3 =3P&P 0 V@0P U VX00CS00 gV 0 00p@(%%C-3sPc 0 p3@0! 0  0080 Bd 3@ 3 00`D]5蒟 0@ Ѝ/R@R R@ ?&@ B&Qꄝt,,,,,,,,,,,,,,,,,,,,,@,,,` ,h,@0=S 0 "?R 9R:BP8؝|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R0'o  -R0(h )d%b#`0 ]t=& (| ( ( (G0 @- (w0s@-P0`0Z0`0S@ P 0R@P@5  P@-0S00S %0ST P000 R  Ѝp ((%HB | @-L ^`Lx ,Сġ\T @@~, \ 1#P? L 0l0̠?00à cΌ SQŒQQP0R0R0P0QPQP !O-`pu딠 %RP@@ &R X(4! 0[00 @ P@P@ Ѝ (0@-4M!@p T` 0 P@4Ѝ0@P SWP@V P@ 0 F2P@( P@* W (lp@-@P0)Sp (O-@D4M`pTV TY T( T) #T! @$TU "T 0#S@P  +4Ѝ'0DSYG x@W'0I S@ 0 0S@P'Y00!p0p輘 {W! sz!P l0 @@! `0 @PWWM'T@@p4 @P@ᆘ  (-lO-M8Pp`4! @00 R@0DS U# 0 \ 00S^^ :U 00SY` p PU@ 0DS Ѝ (Lw C-`p 0BS00@SP! @00P TP@@ Ѝ (G-`d0SP@! p000 PP@ (@-M@`P2PL0P  IR NRpp PpEp@@0SP@ $z2Ѝ (?PG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 P22Sp0@1PH0@P 0,S@2W%%((5@P/-0 /RRR00 (@-@PMލ0/S\ ᰖp ᫖p 0RP 0RPT p@-`\1@&P x1D0p@115 0"SP Vp. |g ([p@-T` RpH0@Q 8 PP P1pp@ (%rO-pWR 0S)P /{B000000000CS020S @T  Ux U`WLbL1w82@000/Sp?EpPI0S0/p0CS0oppW001000pA0P00 z000 hVU` RU00CS0810S 00CS0 0W00 pR0S/S0@D001@ P  R*0000t/S0S xP 0/0CS0 pG0S 00CS0001@1@1@ ( ( (or(%%T A-pP0`00 P 00CS000S B00CS0@X00S 3X @06 R0S T$0$pQ@$ ( (% (5 2G-p`BM8&0@T"U@P$ 0SM .S00.S0 00/SSC10 s PPBePpZ% ``VTZSPP@ ` / E` 0Eu@Uv`0-S0S0@T@@UP0ޔP0: SVP >PЍ蠗%v(Cnyy  (T @-A$0Q @ T@ (rp@-L@Qq70P000S LT#PP 0S}@@+P 101P00CS00 1P 0 P0p zT2( (%G-PRp p@1`0V1 Pp  Pp `b\TQ @0T! \0DQS񟗀l̶hԶ0@ 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 O 0 0SY00CS00 O 0 iO 1 0h1@ @ @ @ @ @\@@谘%b!$A-@ ` PR 0R 0S S8Op0S0 R O0S  OU  OTOy xO Td@00CS00 O 0 ANꘘ% ( (%- 5% 0@-P9 0停 (40@-@Q JP (@-x0@T   @@@@ @孑@00S 4060S [Ѝ ((%-$0@- R     (-@-  0@- (-@@-00 H@-P@` =-@@-  3@-@--@-00{ " ЍЍ/p@-P@o p@-@-   ЍЍ/ L 0P< < @-N,P / \w 0 (0/ (p@-@PPPP 2p` 6`P &p` *`ps@-P650@T x0 6 N N2h0h`@T POT0 0 @ Q@DЍp(W% (B (s@-P`@0S'<0`&k PG{{'jfk[[˒06S 00S\ Ѝp @0t0S0T.S N@ (0    / (@-@TЍ0Ѝ0CSؽؽؽؽؽ,8 {000 P q0 06@ 00 0@-M@ PU 0 PPp ,P   0HPPp 0  ^ Ѝ0 v0 0 ( %%@-@P 0S0S 5P 000 F Ѝ(0G-`S q0P00$됡@T0SXt'@d1$@00CS0D10S ,Ѝ00S P Uw7  R *P00CS00S UC0SCUPۏ@ ԏ0S# ( ( (C-@PcM^0P& S'E,똓sQ@8 |\PtS#$0@30S SK0S 2$P@@T L^0S 0S@,T ^0S$0 0 @^0S 0S$0S 20S dH+ @@$@+,10S NH0S FHo^0S 0S$0S @TM$@P10S 0H,10S 'H 10S H00S H  0 $ 6 $0?o2$0-0$ R  h00S G 6@_L<Ku+  Ѝ蠗%0( (8(%G-MPp@Q+0 뤀夐夠`APP u+Vx0$`W U ^0S W P 0`S5+Ѝ(%% (P8PG-P* @0䀟0 `0 0R0Cp0W S `Sp00 0 P++S p0@*PD0(00$+0 $ 0$/ᘗ%%( (A-P@쀟0p0`0{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S S (%G- M䑟A^`PV $`*pWT0尡p0p00WZ 0S- |1|a4JKlHK FK00CS00 J 0= +L00CS00 J 0 J  oN^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 R* Ѝ蠗% (((%A- M@ p* 0 0P\@T/ 0S0$`V@ 0002P `0@0T$0 R ^ R 0 R 0$0 $0 * Ѝ`0( (%G-@ဂ`p0FSo᪢' 0S$ L2LRH23J8JY8(JVJ00CS00 J 0 IQV000  'P7 V a< 0$000CS0l10SG  E FP P00CS010S %C00CS0 VVp00S $00CS0$|00S 0S0S0000`3J8J0GIꠗ%(%( ( ( (82p@-M000000 20S 00S 1Q123 `II0@TI1XIPP& |1 1@'@0S @T H1ږ iD@I8I15I0S 1 $ ލpA 0 000 0BP00CS0 0@ a0 00x0 ?00CS0 0S xIlvID0HX00S @00S  (%(%( ( ( ( (0@-`0000 00o^0SP$M4P @m(000P pv&P 00S ˋ?Ë000 p0CS0(00S q($Ѝ蠗% (! (?C-@0mM00@H0?_00x?0 0P@,@ (0@ L? `0d00@T 1PoP0 `0_@Td0 0n 0hP@plPT 000Pl 00$0`0S$'`0 S 0D0\>60S @>0S$0S 00D0$ 01C 0>0S$0S h@mpT@ xP H087S 7S) =0S*00S6 -00000,(00 0p(0PX @=&0S(7S%00S 0 0S= 8 < , ыp@ P <0 M<8 <, R , ,( %P000t<|<0S @A @X$ 0 $ ` 0b<;q1Hh@T: =pPZ`P I00CS00 G 0PppH@T4`@T @ `[00CS00 G 0 H@`@T0j PU#00CS00 jG 0 :KG00CS00 VG 0  aBPP @078:0P +@PPHP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP0077S 0C8#8S0)SS B708#8SCP0 Q A!Q>8 R 0 00 Q0 -PP -P R 0S0(0(00(00S 8  @  (00(00@070040070<00L!P7 X7H 00R}0( ?$0SP007GQhJ 0D'000 00007 ('00 '00(07$ 10103/$60 G6& 6& FL0S @Lt68 H6  @ R] 4 0  X $E@(&00CS@0 pPr60S IⳓP 60S%,0墊S55$5 h0 L\5,,0( g0000*,( 0c#E0$0(0S,N $5 50S 4,0S pt<$040S 0 @0 BPDT(? 00<0$0 0C0 000$D00048l \X#R00CS030S -P) 40S*T0SXRK38 \3 X3 3\ `30C*00H<3 0 0S '|0R"C"0 0 (3 B hGL00S0P0x"0C0000Q:K\28 ,2 (2 B 2\  C*00 20 T0S!00CS0 1 R   01D0S$mߍ;10S +0!SS{X1 08 L0H@dKq|10@0@0S0  @0ST1 0$ @0S 0 @0s0 R#0S0   B  @0S @0S7S@<[H0 L00S ;(( (((%Lx 0( (!( ( ((%0TLȘ%((L-/&%%%2 ( (!( ( DB (@a @,0S0 =,0Sh@@P mFH0,000 H hG@T(0S p00tw ,0 0r,#oD)NHE0/ (0 / ( 0/ (0/ ( 0  / (P@-@ (P@}<0 QP cR   c ( 0S0/ (00@-/0M0@0P iP Q0: Sp  Sd PЍ0TP0 : Sy# PP(X up@-Px@x`M$P+00S r#0`000``01"`1#$Ѝp ((@-Pd@$0'0 RP  B R     (//C-LM*8⁒8 p(0@<P@ `D `$0 DLЍW%A-@P`~{pWU sNV" 00~(fp( (O-pWC R``%` P0S:S20EԐ@ @0S,W@  @C0T/S/00h 000S00P R:R0:SPPP@DOe"S"萗%% (@@-PM/p 먐PK  0 @ T9Mp0 @~0!0P 06pWZ0S 0 `T0S 0S 0 S"p @K" f`P T T T0@@T >0DS (w A-@MP`Rk1000  8p"XZU hCB Q PBLBQ<C 00AS 00CS00 ~B 0* 00CS00 nB 0 ЍQ PBB000M 00CS0 TBBHD00S W0w(5% ( (p@-P@@Pp 0S%Sp0P @T p@-P8@Pp 0RPp@ԁ L0L-  R0S P P\ 08% (G-`@嘀0唐0P0|Up00CS0h00SG0S0 S 0S00jPPp ( (8% (0A-`0@0pP Q Q:R@ @:QR@P0SwppR %RwDS%Ppp0V:SP0@w@('8%A-`P倀000|Vp00CS0T00SA0Sp00Mj@T` ( ( (0A-PSp R+ᘢ`a@T"W p000 l 0 @0 0 f00CS0H00S D`5P `@ ( ( (p@-P$@Pp0@P0ԁ @-L@000@00 1j00CS000S@ ( ( (O-PM/`@ 0P @@@ (3P000 0S 0S 000Ѝ#   P@ |\CP @bPR R R R 0S  0  " R0""  " /R0 dpP>Z0 R"000  pPZ m P2 @@ 0@00Q  0S/R10SZ $P %pP A0000S R pJt#P7 R 3 R /({P0 * R; R 60@@D] P R  Gr T@0000S R   BR =D R9 7 a(8% (%  ( % (O-@M`p&PP'0S*[ 0ᬲ000`0pSw|2!| S6hB?01 P@PЍbPEUL<$,4<D00p`@[ Q V  0P!0X ZWYV M10 0 _0S& 0s1TP P*X 00SW0 0 S0 P 0S8YT 0s P k~@T'( (%1 ((8%p@-P|`0000S S@vK000 00 00000CS0p00Spp@ ( (0@-Mt@ 0P0000X0>00K 00CS0$00S Ѝ0@Ѝ0 (% (@-gP 0S3KO-SM@p`%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩00S"" 0RqPW>= >0@ TW 8L> P 4>>0 R @ T Ѝ>>A00CS00 (> 0 00 x100/PXP!  vZZW Ys>p>T*PWf>W~`FhWxWtWq ~W 0` @ p`">`'(5y W]%(k(!$9VO-MTBTRp.0 @0`V' VV:V  VF /V   BR 7` F R,,,,,,,4! R  |a[  0000SH1B@P p ~[/R 0/S 0귀J]P Ѝ] @TW 0 BR  R  BR    BR  Z U ꘗ% ((%Cn~ A-(A0S 0PS0 0aqP0S00 P000f00CS00S P 0SRh`hp0P RP000e000CS00S ( ( ( (s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ ` c@0S00S=STL00 <0 R0AD1U0 S 0Sꌗ%((A-``pP0@S  R R00PH @ (O-MrP0B0000 0000,`⼂<00000Cq5<` P\00$00CS$0E0S00CS020S $ P~P+0S 000P P %e(P F10S 0EC{0P0CS0\10S Ѝ000 @P$[ [` V0 0( R P0 Q BP 0 SR 0 0 0CS00 S00C0~000`0C0  `F BR V00SP 0P (% (%( ( (~ 1O-p0PSp0 Ѝ1嘱 @` 00Y :[V0S @ xQB `P V' Q`:00Q @ @% Y0S" SP P@P PQ DoP @@` ($( (ܘ%A-XPX@X`P0p00*d0p0CS00S ( ( (p@-P-@/`(0 @ p (Q@-pP0G`0S `*00E@`PP P `R@ Ѝ0P@@0`SP0S0O- Y X0 S@0 S@HY" \YX0 S@0 x00S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x^\| ]\Q000``S XSQ0 0 @ 0000xQvS^ P[Sd:Q" P-Qf]Qc \QQ PP $ ` $0( XyP1 0$0 $`( MyP%L0\<0PP QPQ P !$ P80QP*00$cP c`0]S0 S 0p@X'\PP  8QP4\SSPP0 SP0S p @3c| O- MP@0?S*S3 [S;0^S!S00x \/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xPS@0/SR"@ RA0$x RP  R \$$ЍY}PX9$P| 0U0/Sd 00E6pP $0S/00E0S``0` xQP 0S V/00D0x RP0  Q: 0  R/00@>0P .Z. B/o" R  P V0 ]$ (T !O (0  Q0@-0 @\C\0CC/x^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S& P q$$$ma0$000CS0H00S K 0S }0P ( ( (p@-@ PTp 0@ @@ (G-p 00 SQA 0P `V `R`F@ V @S`` S =QQ RU  0P   P| G- M⨀0`@GP0 (q000e U00SV-00ED`PIPE@T Ѝ00CS0@̨( RO-@@0M-S`P S! C R,d$ddddddd?So @Sy 00C Shr0 0]`j0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 D7Dp@,PW@A0S 0g0CS00  P6FBЍ666E0000Q00S h6h pR`&XV(0 0S 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 RI 0  U  Ṛ~0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   S ~ M   0S  QAQ$AQ!   Q R V  BR + `w~   0 BR儡  BR  ~ ~  `K E a Q~p 00S T 00 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00((~ ( (y y %( (%$(ܘ%O-0$M00 Z0 0H'0=,W0J0p0 0 7'0` 0`F#ZGF@Y0/ 0g`6@P Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG, A09 6`0`FP 0 0S Z?0Y : 5% @ @AQ TK[Y0I Yi @ ZD5  A0B F0  %5T 0  Z@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R(&,$$p%p%$$$$#$&$&$&$&%3  AQ AQ~00AQ ~ K R  BR  ~00  BR n~0 0h @0RP[ 2 20AT[ @T 000S[@Zp Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0000 0P  00B 0C 0000000T00 0`P 000l0 GR00#S000 B0S0p0 G0 B03[m$Ѝ|00S[0000p0SQ| ((%%f((~ (~O-0M P0 4ԄдД00C0~Q 0 `p0 @Q Q!:Q =Q Q QX   L  BR  V PR AA KA P񟗇*(**+(4(t)(,)W 0S@ЍQ Q@Q =Rp( `p(``# P  BR  wp& w     BR u    u   BR    ( R 0BQRQ B  W `   BR  v v 0AS Q AQ~@P   Q @~  @   }@P  i  ~Rf=Q0Sa 00 j   @$(ܘ% (%((x1G-Pf0lAlS 0000X1Xq0P0L1 ` (V0 S<000`0`0CS0!0 0@( p X 0   i 0  R 0 00/ 0p ꠗ% (%%(( ( @-0@ꘗ%O-TAT`0$M`F; (%(%%5y O-@b r  DPR0400异Q} R    00h2`TP `8 T_ T@-@FT+: PR0CZU * TR Q  S0D2@ P80Z0Y0S@@T: Ѝ@FT: P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C`F0T00 0 D0C0CS@0 000000C00000000ꜗ% ((%C-M@Pᬐ` 00000吀0p0p00CS00 p0@V h@ЍJ00p (%%(A-Pp@}0A00CS00 / 0 ` Ve000CS00 / 0 ` V`&000CS00 / 0`qV%@-@-00S/ R<%T0QH0 0Scq o/P0// (<%0    B / (A-@P堀0p000` R$ 0 `0T    0 0C@ S000SAj (<% ( (0A-P` @0p0W0 P 0X S S0 000 00 0h0    0 0$PT QX00CS0 00SA0<% (% ( (G- b B0 pWcr 0S .. 0R@PP0/qP2b000r0S^00CS00  0S 0Y0#S  q P   qP'/0  0p0P0 R R   BR   A   BR 0E0CS0000`0D00S .00}.`<% (%%#@%%@-L@00CS00  _p00CS0@V (@-8P@P 0     00000 0$00<% (A-P@`000% ?qV |`0P%p0PS ^ H0  0000CS0 00SA8 (5<% ( (@-p0a0M0P0q@PzrP(0: S$ 0 pP  dPp)00 0 ph(%TpL00CS0,00S Ѝ (Zhm (A-Qd@P0`00 PHpP<0`00CS000SA ( (<% (p@-`P@00P0!%P V 0S00V0X 0000CS0p$00Spp@(<% ( ( (0/<%p@-@,`,P0SpSTp<% (p@-P@0Sp<% (p@-@Pp P0Pp$0@p<% 0 R/D% @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0(5rOD%A-R0S20SPB`T p z$opp 2$`$PP C-1 N PpW!pp p 0P 㞝)) )o qP Epp]W  tPp,QW o P *ppBW  ZPp7W $00(((`((D%4?%(%0S/p@-@PP1PL1D8a 000P0R 0S"00D05#0s  0C?o2^0SPp2P Vi x0CP  PAoQP0S*00CS0p,00Spp@((M5rO (t (p@-@\P0P00 ,U@00CS0p00Spp@ ( (O-@LM` R0 LЍOV,ؐY) PPY  0SPs  0 S S S PQ 00SЀ0S@LЍ0S~22 F! R0+  p  !R -  x" ,lp 0T"0 , `p0 sT$ P0T p+00CS0q+0p W +㴱p^ Z 00CS0Z+0 00CS0N+0 | 00CS0B+0Ѐ YZ!+000t + #40  +  +P S#4U 0 0p@ gd w+pZ*0㙃#ЀCw (D%5rO0 @- S  .^\Q0   @S0C ( CP/o" R O-PP10 0%SW P n0@S!!Q@ C$0S 0S  R-S %S +S D1@@YZT X@1 r9 002#00S 0S 0p?Sp  ,P T"@` P>P `0@00SJ R Q !" R @D%(G-$a$H0S Qq0m0@SZ @ *ĐР0Sʰ00CS00  * 0 [+0 R  0 S !k*(W(5rO5%W%A-pQ@`P00Sxt10P 0S XjPp pP@ gP`WP P11@0*@V Q@ T0`p0S0 *@00CS0)0 S 0 000SJ 0 S 0 0_c((5rOw }]%800S /@-P `(8 P  /Q 0SZ//(`060S/P00S/D0Q<0  40 A!0 S00)ꠗ%(%(5rOG-`Q0SS@00SjZqP000M:?@0 @C$ Q 0000CS0L10S 4q000$100S010000<>00V 00CS000S 0S @pWZ00萠 @0 ZQꙂ! P00 R @( ( (%A-`!@SpP% K 'WVV |1N0S9 U 0S0PmPlV81NLp~+S!1@! !&0@$$060S& $$$V&&U 0S PP Pk\8kP HH~V WT$0  (%D%|% (((D Z08 N R S  0S  P ꠗ%O-pRB0M`0  pP  0S0S ЍP8804000@00 #"P%:T 0S0 10S 160SdTf P c100CS010S 0S 02, \ Q R05S00|) \~  ^Lo \ \ \W@~  ^Lo \ 0S 00=TP 0008( (((%% ( G-pPE@P ?P1N0St `7K@kT @kKpCQ {㠠`@0S0S 0S0S#`@Y 0 X 000 -ꠗ%D%j%(A-@P'P PT0Q 0S wlP@ pP@ ZP@v|06 R0S@@d`Q 0p) 0 0 Sk(5%%O-PXdXt,M @P Y< U0!00S5 @nT pTU P300SU00S00 ,Ѝ 0[(P 3,P x0S 0SH3 P#Zp `X*00SM T0 @@0 0000 QCZR00 RjUX *Y ^  `2pP R  Y RQU@  )260S& p @ Y00P'  P0`0V 00% 0V0S(0S0S 0S06 P 0Q p$@I0S 0S @rԀ0U0X0S 0 S0C0 j0SY UX v) @0S 0S(((%qVp@-@hdQ000` R 0S <1eIp BP!q0S 0 00D1  S >` 4` V0P 40``0S`0S[00CS0X00S rp800P0V0S & (D%%(5rO (@1A-Q40@Su% qP`0SP00CS00 +% 0 }&0Hp O.L!P%lP000T00CS0@800S (%55%D%% ( (@- 0@0W(@-@ @Wp@-`@00  p 0Qp\ PU&%00p(A-db 0@Pp0U RP@ЍR R =RU "0Bh 'Rf 0 BRTbbccbbcca1) PU ^ S \R 0R  p ` Q\1 0 0A Q "Q."   Q1 010p} 0$ S0." W p 0p: !0}RQ 0 0\ d0$ \0" 0z Ux 0"  PE@r(!/+2L%5;A-@$tM`Tg 0SdPU ege f fe0 000E000PS V 00CS0l00SG E  P0( `0`00 (%( (T 000@0A00CS0/00S/ (% (p@-PPP`@ P T @D@p00C0C0p萗%(p@-(P(`@0@Dw00C0p萗%(( A00C 00 0C0/ᐗ%(-A-(M@@`DHpPpPVP u ST(01 0P @ @p@DP`U(ЍAЍ/T (01 p@D0 P (p3X4O- PtPTa0 W X@  0@xtH  Ext?Y  : p~ Wh @0 . W0\ @0 "T0 S `P4G0SM\0HS xy; 0 ! 0\1Tbhx (tx 3/ ~%)< YFh(5 BR00/00S/@0S/ R /0@-@0000C S  RR R1\ *UЍG2000C S0S//p@-PP @P  tP l nP TPFP 000C SPpppp_ UrQX0 0@-^ @P U@R000/᠗%p@-`@`P6N0Spv@Tp%_:_%_^@ _ 0  p@Pꠗ%(-_G-pPR@^Q6 b@0S 0  pW@A00CS00  0aq吁 @ Q 0S  @TPL$aDqD0 R R @TP@00CS00 O 0 Q NP @1@UT@Q@`Q ;PGD`V0@ X렗%c- { %Lyr80 \%P0@-9렗%0S/p@-@PPEPp@DDA-@1S @D`pPU 0@P00` P (O-@Pq刑00`0S -R  RF -R0SF P +R: `cP Z TPoP0S TP T``T |0|0T0rP0S \MT PT<0@@T0SOz((%A-PRB00і 0`00S 00S0S006X pWOP KP6p60S0S60N0S60N0F0 0CR?o20S  0-S0F01PQ00SQ0 0SAP   000S  00^0 PA! R   R0 0ꠗ%( (P0 f@-X@000D00S 00CS000S  (( (000C S/ @-(@P 0  (G-0p PR 0S5Q 0S 0@ 0CC10?`@! ,g`` `@_@j ``m -R \ -Q0S `0@T0:SF 0R@1T0:Y " @`-@ `0 T 0:S  @`@?:\00|@Y00 X @0 CB!08( @ ЍqV;$ %WP@-H7D0P  Q 000CH ЍB(( $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HPP0@:T  ($(xeG-pR@ 0S PP -R`@@$0P 0S 0S@0-S =@T 0T T@1@DSq0000@CA!0`@S:0\:0l0#1@ T030V:0 000CS0 10S P3  0 #@0Sp` 0C  0XZO0a0C  R0 0CS0H00S @0S -A( ( (p@-H@HP080Sp0u`0CS0` 800C80$ꄘ%( 0R @-@T A 0 B   B /@-@0S@p@-@P0S0ڈ00@0B2 ! ! !!  !!p@-@    @脘% 0S/xQS  00 S/00 0/0S/0/| 08 0/=P/P/0/| 0 0 0@-넘%p@-`R`@P:P t00P pd0 Pp0-S0S0 0pV ($00080@p((%O-MR 0p0뜒b"p%Q  X @  [c { R00CS0`B``@$20`0@Ѝ X @ ,\[8R /d P0  BR (000Wp 0 S B R  [000Dp X R  [R.@@  B@'0   Q P Pp P  Q  R P000@00 w 0 C @%%(%$y %0-@0DM P R`D0 Ph h "  ;UP 0T<0< 1 0 01 0 ꄘ%$y @-M@P0} G 00SP p@`T*vpPT @Tp>PLP @0 PЍ@ꐗ%%(l000S p@-XP@T T D0T@p8040@p 0 /ᄘ% (2W(@%(0@-@C (p@-d@dPX\PpU P 00008  P8 ? Dp@@@%%A-DR0@T @ B 0S 0 @0r 8 0 00CS0!0`)V*V V v va A x` 0F SꨝО0< V0@000 @\V. |V ;V&P0 @ ;P0 @ @0 Ppx&P0@ @0o|P0@ @00@0@p P  00P000K0  ꄘ%@% ( (Ҁ G-pc00@ T T+P,0S)㰀" ^PP @ @@`P  0RP `FFa@@T 0  脘%y p@-`0$P P g 0R$, (@R   RP3Pf    Q + 00000S@p 0 BRp@ Q080@ p脘%J@-y0 000脘%@-@oPp@-. @fP P @0 000p` P 0`@`ꄘ%O- С`P0 $ @CPp/0 CR00SY%3PB'V0  H100SD (100S @ 0YP@0@Y PX s@PW W! V! d0 @00(pGWVoP0V     { 000ꄘ%$y O-KM 05P0@00400 Px400D0$ia`P p 0S = 4 0  |4 Wat$0000 `SH4 ` ,4$ ($00CS0c 0Sf@pW 0䃟RPp *0PCp0pC0 Sڈ#sV@0  0 0C0Ps000<0 000CS0030S0@2 0 2 0 02 P B1 2R Bz0u`0PUZKߍ20S dd2h@d2dpD000 0S V0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PA@0000 7@!00CS0 0000DP3) ."@@*pb0PC2P \00&0-,M00CS0`fR {00^ꄘ% (% (@%%( (~O-pἯ弿M"/0ϟ/0 QO  `00202280 00\/20S0S 2Y I꠲ԪдT̶pX/Q00S; P.Q00S2 0P0C0p0000Pb\.00CS0*H.0p210SxPpNTP"Pg KPEpE U0@#S?T,Hh$`p6p Pw00@ S0P@ A0@S7P@a0@SdWP@Y_ P H'P 0p@WZ00@S"OWR'PGHp0000Pg<0 0CS00C0~000P0C0l0P@100@S0P@$ Y p0P0C0t0E `0@? @?o2;R0S 6\P\Pp ?PPpppWppUpW 6;E SD 5:0 S0 U0C *0?0%3?P00 Q ~ B  PA0U!*00%60%3?00 Q ~ B  ?PA00 QPA~P•3U5*00%90%6?00 Q ~ B  A0%3?00 Q~A• ?P B 00  R P B P~   B u300%<0%9?00 Q ~ B  A0%6?00 Q~A•  B 0%3?00  R ~ B   U?p00%?0%p0PU 60 d0 e00CS0? 1P@0H21SZ0 0#<R00SQ 0SJ'0쀟SPV 0P@0 P>WUT@>P0 |P0 &PU000@$P0 Ѝꄘ%@%% %(} ( ( %2M((t=&| (%z (z Ҁ ~ P 0 ,  0@0 0 S 0Q >W @<P >P" &P0000000p0p0 ((0 P0(0-P   pO0YP0  0{P BP 10 }0 010{W0E000C00Q#PpIM}PP 1 " )00 0: <}P,p / 9Xp@- P@ Ip R  Ip d0 Rp Ip Ip Ip (%p@-@PpD0 0RPPp03/IPp (O-0$M@@000`p@A 2 p @̒V 0S2" 0S2" $Ѝ2@0Sڐ2 R@00CS 0SP P 1 8墷`IPz^sPP jT ZI0S_ ZPPZCI봡P000P000 S`|1 0R  .IdpPH* B R% #0 ( C IPP  R   IPP UP I R rP0 00CS0t00S T0 00`Q RP (%Ș%%(( (% (O-`p#pCpspM0P` `00 3p(V, PEWUCc 0 pW` u@p00S0SP20SU0SR0sS vS ʶV`p0+S -S X弶 @ZD Q4 @R: _f P    %+PU 0 P0SA<0OЍVF p p0 %  " Q  %5S' &Hp"$/ Q  0H0pT 00 / B X0 M IU00 DZL-/&L-v<((!z %eEA-PQU 00CSQHq10SL R@ 0`0CS00 `01L00<S0S  50qL0S 0CS>S0SS|l R 00CS00 - z qVp@-@0T PR R R& 1S#0 jPpR!Q QT " "D0600S0T0S 00S0c0( ( (%@-@-P @ .PtSPzO @-@P SP 0 I qV<(QA-@ 00CS00 |p|P ` ?U UH?U!P0P0CS00 `5XG-@Pp000 T` 0000CS0H00SG0S 00S ,@ (0( (P P0  /\ Q0 S//0(@-@bM0pS910S5 0SPPT,2C 02S zp? 0Sl UX U` Pp2 W`RUOS@D0>T000 0is00 EF10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ 0((%(4PO-`@TP P@P 0P0FpS@` PCPBPP34 ٷPP`tDa0S! 000+U 00CS0 PT40S ³00CS0 40S P@U00P@s胟`1 R 0PU TgO@`@VT c刃@Q0S 00S 3@@TP@P @fPP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X PбБ@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR *pVP 00CS0\00S IJ0U00 P6 b/%0( ( (. XVd %5A-@P⠀0` Pp UTA0S 00S 0@D0@o000CS0 00S |P4(0( ( (p@-PD@`02S@20CSp޺V02p0(40T0P?o20S 0S//0(C-p@`1010r!Q0@S10C1 ЍqXPU X2廼PPH?*뮼P 0S ᱼ0( ($0@P/!!R /0(p@-8P\2Sp@?<9\Bp0(0-MM01`"R !R X"R   1 1d"1!d2S ,NNPl1, ,ENP L!0,00S |00 NCDlC"!0310( ( ( (0@- `"dy0(p@-@H 'P 0PPp0C/U00pz p@-T@TP0 0P0 m)0 0000CS0p00Spp@I (% (A-@R`P  B0PPEU`pp WD0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000 00 00CS0h00S sDP`00000C0 ( ( (p@-@P@0SH00Spp@00CS00  ꘘ%0ꘘ%0ꘘ%@-@!Pɰ(Ѝ-@-  Ѝ Ѝ/-$0@-  ЍЍ/ᘘ% -p@-Ml0, @P(0 0`0CS0a0`1@00DЍp@Ѝ/G-@'`P$ 0S! p0S00CS0>0 " u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' z %0Qꘘ%@-@@ꘘ%@-0rS̯0G-p0 P0R(0帐@0=00-=`)`F@VPpPER000 S=S B`` R`ĥ`PG@ꘗ%(%0@- 4@ 00C000 04CЍ(0P P PR00/0@-@DP^ ^ R0L00| A-( 㴀 R T(p`@pW p0S 0QPU  0S 0S   3/P@P00(0SfA-@嵩PẩU p`pp0S'STP@HAM'xPP,  EB!<95o6 A-P0@S`p    3/@P@PX #W p0@=S0U 00 00CS00  0 00CS00 x 0 T ڢ%O-@00pS 00P㜠Z 0  @PU* Ѝ`V Y   [ QʁiaP`0p(( 0@ R P=R/=R/A-`P0S=SPERPU@'\0\pV!0@qpT 0S `|PVpp@((1@-`0@S @ PPV 0 `% Z h  `R Ѝ@%Dq   R <0 2/0`% 0R , R  00 0000@!L@0P U U0 R00CS0`00S Ѝ@蘭Y0#L 00P P Ѝ蠗%C (( (|0-GM00l00 0IP @0 80 Gߍ 0 0  e ( (A-`p= P x@VPp P^0DP @SO=  0V  @j!`ЍA50CV\0-GM00IP00$0 0  Gߍ (p@-u@X@0`P"%@0U<]0 `00$0U p@(nu-_-!0$MP00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ]$Ѝ(|( (%(p@-@XP`000T 00CS0p,00Spp@裬@ ( (s@-P@T@ aPP0 P00Ѝp@n` OP 0 @\00000 00PЍp{ (A-PpU`A0  n$0i$@TP@ l0@00`( @-@P 0S   3/P 000A-P@`T PP 0    R   2/P @@@ pP =ᛦ@@ (C-pP0@rS``PW! 100S T! 0  ЍC]nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000 l @0 L @  !W Pᝫ`(s@- P`?@P 0 Q   00 00CS000S UЍpQ     R\ 0000   I#0  D# ( (y A-`pĀ@TP0U0   .#9+#0S R   0 02/0 #00 0000(%%A-pP`@P 00`PPEPvT` eTp` fTxTp`X @V R@(PP@-  WC-pܑ0P000-S`@TQ 刲@ 000@0CS`0Vl10SR ЍC荪 Y@P=P ~0 @0 0 0  0 00 00000   0  RP 00 00=Sw Tt0T 10=S100C0 0P00 Ѝ ((%% (  (p@-@PTpt@p@-驴PdP@ \ENP@ xP@ IP@P(P0 P pU(00@/0 S0@/s@-@ݲ0 0P`Բ0S в0"S U1r0p%!*0S`0X000 @0C?o2R0SЍput=&@-M@ <P ލ<P@D 0RQH0PP0@-M@ <P ލ<P@D0 SPH0PP0@-M@ <P ލ<P0RP 0RPA-@`<PI0 0SC PP<UA O<PPP]pF<PJ! 0RAR!@- 0-RS# 0S00 0a; Ѝ0SX00T0 S00080 , P${ h| | { 0@-P0M!S@0SPЍ0P{ 0SxPUo U U ݧPo U <P? <PPEUR$4Ddt P  P  P  P  P  P  P P p0St00@;T @u;0(S0)S0 0qop@-@`P(P} 0Sz00CStHt=oop5P/*P0`@,TV%@`!VT`@V@`@ P`@P`@V@)Fcv0S0!SPpp(S0)S0S pp@-@P弫PPE綫P.U)||0op=Pp0\0!S0P p(S0)S0S 宧p蘡@-0B㱧%(0@-0 00 㣧 (%@- @  R1P\ * 㫧ЍzO-@M`< T0pD P-R lRC 5R -R| `\E@P{2 000E @PppGWP PW pGP™儲PE0%S``PX剧pW ;sR R`6pTP`2xPU W@1 000 PPP@U aDP@ 1 kEp EPt %h9\ª@P D@P0S0Sp@HEp꙯0 0S X`0 R P!q *S0傯0 R dS  l8pv \  TTs]8oWt=&6 O %5HB ` 0@-DM70   0@@DPU#8 @0 6:    90 Pxtt, Ph DЍ0=ӠP  ( (t-qV_ܘ%A1};-_d$p@-R00S 00x 0p p0p@0   PU P@P0P H0H P p Pp ( ( (%( (Ș%%%%%p@-90@@Nv0 0@0PU@0002l0A  R 00CS0H00S ʥp@^@C0PC (%(% (H( (P/p@-@PTp000@p@-@@aPTp0   SC"""""""""""""""##<#<#<#<#<#0#0#<#<#(#(# @p@ :0000  )0000@ pd 00C \ /p@-@P5 0`P  S'$ $d$$$$$$$$$t$$$$$$(%(%(%(%(%%%(%(%$$0 0 000@0pN0 0  0 000  00 2  0 000  d 0@-@PM  0  %  0 00P0 0v@Ѝ0@-@`PT@ Ѝ0000p`@PP000/0P/  R /P/ 000/8( 0P00/8(A-@pP 0` V  V @00CS00 a 0@ 000CS00 O 0`8(%A-p@`xT [TP'T/ 1Ta "T* Rᾤ1  !\0DS$)'''',(P)''(X)'''''''`)'''h)'p)'x)'(@@7T/T @0p00CQPRApET@0P@0  aCPBW0CACP70C00CU@W pRx_h0 p \@RTT<0  @ @ @ @ @ @8(t=&@-P`p@P \P 6/)0 cS 0<0 Ѝ0S0P@00 #10#7Q00AU@MS0-S@6/P^S   +@^S@0?S08(t=&0 0 (%@- P@p( `0P LὣD0   ЍV@@T ģ0 58(G-pT@P@UHᲣP00`E (`0@08(7L(@-@ R Q@@80  "P 刣O8(w7@-` 0PU 00  @Tk Ѝ08(j s@-0PU 00 'R"R@@Ѝp@k꽫 @x`@Ѝp`@8(O-04iP0T0(9,M P1@01-%LPx @0  00P@`V8 0S5 0S1LP T Rp|80PEAU,ЍP@@\V $&(8P00CS00 b7 0$ %V0%S@700CS00 I7 0P`0p*SAp`0.S0@*S7p@Z(᳢`pp@0xZ0WZ%Z A0J R'X0J S40000000000000000d50344d5d5d500400000000004000000400400004Sd50P400d5d5d5WЕXP ᨜P Xc 0\\ s00vZ t 0 5W\\#LQ2122222 2 2 2 2 2 2 2 2 2 2 2 2 22b '\ \\ "\  \ M\^0? \@^0-000fnrtvaet 0P030  C? 1 01ᛡ똓\P l` P\ f `  P`  xݨ s0v0 t 00 p B\0 0c 0 t0  (l cv t0 < <"0P 00t a |j  v t  Hj 0Cet 0<^h0P $0'S"SSF`T0S$ L rv t   0# 8ꏩ0$0$  Yxt 0#v t   0t 0NVBT^0 <ڠ8(%]f/&]t=&$D&(&5[0C-Mtq 0P` dp 2@P 0H p2@PH 0p W  ; PuY <Y1PP0 0ES, P L0ES^Y0?S0 -S00PH0,Ѝd 00S00H <PH7 %F0s@-@0 0 \*4XPX`Q yPd 0Ѝp@400 4 P O-Mp:dPZ聟葟衟000SЍ@P 0S =JPP Z00 Shc[lᘣP 00 Ta4i[H፣P 00 0ᆣP  5h 0$0l[xP 0 0o[ nP 00 gP h 0(0 `Q 0 SUP00CSL h0 0 0S ¡ }]&,0K00M00P0D0 0C0D080;800,0/(<0Q8 00,,<008 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@0@-d00$ 8 Ѝ@-@4000@-@4000@-@(0(S00 0?20,0Ѝ`t p@-@0PPe|lGP[`8h<f@dDbU^\\`, 80`0V0,0p踏@-@480,0@-@480,0&24$ @-8@2 ( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ 1PY Ѝt3@-1PYnt <@-1PYot F0p@-MP`0@-S00(000 0P  Pu0P 0( RX  0 0 S40,J03/Ѝpl< OA-@`PpQP-U@QP00  PP 0-U  `0p@-@Px @0P ,pT 80$P< D0TP$ <0<Pp꼅 T X p@-P @0S 100Pp(Q+  0 BR @-1 M- 0 S^0@Q 80^  ? 0  / /qV((p@-@dP`V P1p?`HV4101 10(wO5. C-MPp`@T H1V@P G1 @$       @     T  | p d X@<  Hy <u@ 0q $m i  e a ] YU Q M@D@ <$A 7t@  < S S  SH  D6 C"VyP   W        uȅ@0ST  l0" 0X@ x0@W d0t @ Dx8l ,` TL@4(@  T4 @QV \ T@Dt8 0d| \ x Lt  @p8l(h d`3[@V RNJ FD|B@l 0@:TY /Vl2<08 *(@@V  S W   2VxApr`VЍ00 d @@/V   Q  1/0넑 @0l %/ Tl@ pOo (07?FLSY`jqz?G `v /8>EMRZairy'08/7F@-霣 /,6&00@-( P 0 0 /,(6&s@-@`ឣ0 00#S@OPᓣ0S 8 U00S 0 UЍp50S/#Sp@-@,P(p0P 00p(y@-PRP@ p`p 0R" ЍR0"S0SO 00SS  00@Ot=&@-TPL0 p@,0"SzUЍX(h@-TݗPL0 p@0"S_UЍ(p@-Pd@0S 0S 0SS <<< U   S(000P 0p( p@-Px@Ql %UP L0 P      pp@ @̈ (0@-@MPP 0SPzH00Ѝ000 0>P0 0 (O-P`Mp` 0S@V;$ ,  P 0S ߍPꃯ0Q 0S 6s?@0P P@ P@0 ST WpU: 0S L  09/PV 0``(/UPs@-50S S S8 4 Ѝ S$ Ѝ-5U7@-lP$ R`]T;@ H $0S p0 UT  IT Ѝ0((p@-@P 0Sp@Ó0PS P00᧹00Sp!@-鷡H@H H`HpHP0S*00- $+6&}%C-PMP` 0S|00(p0 /pAP" @/Q `0p0@1P T0 p'PH$0@@ 00Ѝ((90G- @TT- HRD2DD1<#w-( 4 s-, (o-0 k-8 g-4 c-#4R! Z-!4S S-!4S L-!4S hE-!4S L>-p!P0S t07-T!T0S \0- ,LPp8W }ЍG蛔0S. a`` C0 - 0 -0US !S| !3  \-0US:3 0U  $,0x ,pPVp6&̈ ?QWBB76 F6 (O-Q ,@QlP0QT 4QP@yPQ,s80S,00 80<0S804 <0P<aPP<ZP1 QB"9P묱`8X0apS pR  ? <0R\8P 00< S8.P0S9`(uQ !(nQ @P0S0 BS `a 0h R  R* P*ha (Z ,?Qp(m*O-;$M p*b 0P$S   ߍS 렲@PT[D @P늤4 婫0X ZS' ("$0f0Qf/ jҞ,2!S!R !SS衟01,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2,"b"!4b4# ST 0 p^#> 0"448#8 R* 0S 0pKj9 P 0S 0 p=1Sq j  @*1S j2 f/j ]01T T%HM ((>VEW}}WEVWf(p6&A-P@p%`P %R 0R000005Sw D $0f0Q, bQ  (((p@-@,kP  P$p@T`$0@-0S ,P(@-P  (O-@4kCM: MP00 8P( 8<PP008⏶80p0S :sP  @00 xY | 彙P 1(p` c pD 寙P$4  X p:0 $0 %P$0S M$02P P pGGqrᅙP,圙圩$ pW 0S$00k P$00 P$00$0 P$00  @SP pWa 0SY] 0 0$0P @2 8$ 1\ x$ ](P $0S  S;Ƒ8D0;RZ,( P  %P   P 00$0P$0S ++RP0 0   P  00$0gP$0T0 @٘ P  00$0VP$0`0 Ș P  00$0EP$0X0 ᷘ P  00$04P$0\0 ᦘP pᡘP  0 0$0P$0d0 ,ᏘP  5 0$0 P$07 } P  l50$0P$07 {l P  (50$0P$07r jh[ P  40$0P$07a Y(J P  00$0P$0x0P H9 P  00$0P$0|0? 780aJ0S0S  P0X:h XT0 0I070t 0 ST 7 . 2Z/ ` ᬴0S 1 س#0000S05 0 3000"0$0   00$0 ]P @$0!SL @0$0|2$ 2 , u@pCލ Ѝ0S 0|  QP0 b0P!A"Af0S 0崡0S 0C RS񟗚k`k``k`k``k````kL '0S0 0S Pz  0S$ ږo 0 S Pe ~ 0S$~ Ŗt 0STsl 0 Sk PI b 0S$b 婖>W (K!IJc Ow((( T,+9FJU_lw(h t=&0s@-`PU V  PA@P hЍp`PD!˚<0 ჉0@zV h EN$00S %&@-鯛00%p@-@5S4 0PSP p@@Pp0S 5S 1S MPp5S X `Pp@ LPpu$(( PpM((`oedArdAs@-PA1(`(000;a5S 4 5S PH0S D0S005S  Pt p0pP%"5S ЍpH HlP8 (WEVfdmd%(p(gd@-@P f/ @( 0 I%(md0S/!  -3@-P\ P 0S S@@ P@Ѝ0@ Ѝ/6&p@-4@4PQ<p@`& & @%+ 2 @-Mp@p0l Q d P0cS CS SS 4asS00ۍ0=(T,Q a 0@-MMd@ PP 00YSP ,?ۍЍ0mP    0 p(p6&@-@M,0 vP !ۍ zp@-$P@ 0 p@Op6&(( @-YMMt@ p\YލЍ<0< S <fCPژ10YS<0<0%rdA   *@-0gj z gz z4 'z'&z'z{zgzzz{%Ѝ5* 7@-P0@ 0$S0S> 0S6 TQ+BQQ+ QP10S+ 8@0 ᪓ 000!C0ASDu$u$u$uu$u$u$uXu$utu$u$u$u$u$uttuc0A Rx%t% Ѝ0zg{{' Q{ zg{k Q{ { { @=(> M @-MX@X0T Q L P 0nS yS0 $J00ۍ=(5U  P `00CS`0p S00 P0S X0X /X&6&G-P 0p`01?@P K$pG6T@Y @0 @ H^Pp Eѓpᄠ 0  ak U `V` ` XSЍ sp6&O-M M@hP`б\%\TuTT0S0#!pD P P   P'p0 p( P  nTt`(p P  XP `"$ZݷP<08 Tt`( p P  tXP #0(0Ss`, p P  ]XP #0,0xSXs`0 p P  FXP 4#000$Sr`8 }p P  /XP #080Rr`4 fp P  XP l#040xRDr`< Op~ P  XP #0<0 Rq`$8pg P  WP t#04Qq`$!pP P  WP ]#04xQ`$ p: P  WP 8G#04(Qp`P p# P  WP 0#0P0P|p`T P  WP #0T0ۍ Ѝ (p6&D 9  3 - O  r     .Px;^|O-M M@Qp PS `V30S0`S9P`P8apEbWWnF`0E `F 8ġw됳0A"S0#1` pvp P( ATsPH#<<" 5 G>P0S 3/ PA  P,ࠐRx%.A <p P" 4SA4`S>594`P92a0C" 20< S :A(h""YA`"x5|%.A p` P0 x5< A B0qpA="A 0Q<0PAHx[0x5< 0RA | 2\P 00 00S pP0`(V R s S 0 00 0`PX!ލ Ѝ%D 9 *iF(p6&=(  - BR0 R #A-P@r" R1!j"0 e"0 `"X0 X0 t{X0 `u ( HD", <@"0 0<"8 $8"4 4"< 0"$,"$("$$"$ "P "T "?p0 1R0S*0X`p\PQ "Vl*Aw_0 8fp|$4CUu" ſO-pᔀ 2MSR R@`aX 8QU ,[R 0ܐ0 ֐  G0"@`  8 Ɛ,  ῐ 008"@ ( 0 ! !R21` ! 0S 0C RjSgꀇԇԇԇԇԇԇԇԇԇԇ  1 0 0po!8QI T f!<0P+8mQ* 8 0A0֏ @N!2<0P+8SQ *ЍOd0 0 0 0t+! d&!8 T ЍOuЍ0 W,9vZ$A-@Pp(D!@,`8SAu 0`?O 0`( "4`#/A-P @"440 "440 `lpГ ̓((,,004488<$"444$"444<D$"444$"444$"444$"444DPPTTXXQl`pQ("448(@"448d0`PV@P ~ {0T0A0T0A T"440A(@-@l40Pm08Vf/IWEVT@-@P TP8#!00Q@/WEV(80@-@0S B08f/( 0\ P0//@-LL@LPL`0 @ 884 R 0 %6&P7@-@ PTP0 08P8 0Pp0 )F Ѝ0v=(vdw0@?o2P0S@- p`Pӎ@P ΎP ɎP ĎP@V@l廎PH@T@T p0 8E@@ Ѝeҥ=(udwP0@-M xdPd@ p HE 0 400+ +Ѝ0=(zd@s@- @p E0  0 0`P   0   0  h0  P0  8|Ѝp=(td@"/F^W|p@-( PM@`Pő }p  ( ๑V V h OPЍp (H( bp 00P  A0P 0Pp^ 0Pp@Sp@ 0xV@dp@U@@<Pptcidyaranrbmngnts_ 55g0D S/ 3C5C$1 4! 8<0/A(0@-0A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @A( 213/P/A(A-PT0p(,`@ ,0T@@DA?@?A(@-?00@0 (20,20㜈0P!P30A(> 0R//G-0`p(,BP  E҉@PP W ,20CS(20CS G0A(p@-M@`42S%^  E 82<"@ 0(2,"Ѝp@7<"82El@`*,"(2H0X"\4Ѝp@A(h%/=Gg>s@-P`P  0SЍp00S@?0"S1Ds@-$M@0 0 0 00(W6&vA-P`0 p @Tʬ^@ /,s0d  ? ׅqp  RЍAL`0S`@D@, Ѝh% !!A(A-0ppP@`plv!14P S H d" R S R, 0750 P00CS0:E0 Y@oЍp@Ѝ/6&1"7FO-0` p>Pp/B$0e@O 0qp Ѝ  R ЍO t`$0S 0qp `BE,( 0S h%7"A(p@-P@2S t`0n/(21!41#41U @0&"UU  p@@PC @ⱊ@TpA(@K(C(G-@r,1`P 7>` VPmYTLE J$r,0U !VU ! [E@s_Ps ⿊X2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@t000A( A-@PXPAds 2Fb t B B$Gr00C0A(O-Q40 Ѝp0QSP LaXR XF0 pQ 0>80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ O"A(z""O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q  32 $450 (, T02Sx Y< ЍPT 21倰[R RS$ [0 0 2S Y P<Y 2p00`@p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$"q00C0@@PAy`d1S  14 8<   P00P2S. Y  a14a8a<0#d1a#h#0)S |Z0)S uR0 lQ !P^:00 0j0@ U , 0S8&A(F$( cO$W^$h%{$$$$$&#&%9$%$!%)%I%Uk%%%%#%%A-4RUP@P@DЍp(0PPB1P@XaXaPTS <ЍA0 !14!8!< 1 11p1 1!1<0 1 1 ?01!1<0 `1 P1 ?0<ЍAA()W+&;&J&[&o&&&&&&&O-0P-4M`@,0 q 0Sၴo_l,P0`("p/o" R 8 0 0(  [ 0 U䢑 Zz @ pD H L( @` 0t0x0| 0XS T0@˟`( PX=0H @`21S /0.30010204458<0 TTQ6 R:HL"T 1"R. 功4Ѝ0(Ro_0hP(0|H 0 P(u( 0 P(lx Vt  @D H L(@`0XB`(@ Yw  0 pt0x0|9pW2SjX 0!h ?  49 ܂,j  R    0$  $   00@P`T 0 W0S 8`p@W 0`S$0 @0u 000 V 0S@8Xr\" 0`@,@ `SRp 00 RW00 0w,p0S| 000 72PS XU9 @`@ Ṅw@ ` 0R('0Q0[042 @`S`Q $ 0q ^A$ D 0 H L@   @`021S  "/0.0010T0 320445 8<0 T @` @`2S 00 0P52S X@U @ `@ 0S4 2S H"%>0$0 0 0S- 1S*  X000P$  00SX0!14!8!<!14!8!<X $ $`LLD(`0 S( 21S$ / .0$40 81 <X S  PX 32 $45(, X\ 00$0p@`\3"Rq2S. l H70 00 P 40 00 PXS (00D#$0 #(#< 0'4 0'80'< p 00pr0 @2S` BT0`l#PX 0 1<A 80@@,2 0C0@0@p`(2? 00@@0`Fa ?`1<A 0?``@@,2 0C0@0@`X(20? 0@@4`Fa?`?``0S 2S@ @TJ041S0Sg 0s XPX2 0 RS  0BPTo_P(LA()&*'WD(8'+ >'{ '5]'''''''G-p@B42gS0̜,r,bP42S_ 0P*U42S 0S 峜qԁP 42RSfP:夜42S]1!$1(1,ЍG10Sd S'^`兤d 04Y2S L` ` 0)P"PR S0SЍGX+@D 0ЍGSP 0ЍA('4uA('-(3(:(k((O((((@-0@M0@ pp`PLpߍ\ e0  0HP \ t02S 0S " `PH !SR ⴹ0P#7((A((@-0Xa0 0LAP d2S8 P($!p! 2SP0U0 $tp" Rp\EU$p0 00P d2SP ` P@ Ѝ0P0!!1 h%A(mdA()S)@K(>)A-@T2 @P}P }P }P@ `p@T 00S p`V@}PD00S @@}@P=@k(%A-Pp`Q%@.%+%000 0@@@A-p@`T WtTtPPe%( 0@^ @%@UG-M0h4 P@ TPD f}P @ 0`}P(4 00(0 4QT(0 ,0%4@# 0, 0@,0S @@((,0@`00P0s刃0C@0P>P0 !0P1P,30  ,3Q #   Y c0T T0<  p@8 PA ,0S ,< 00S< 00@ $_Px&0FSʆ`$P0S -S@= wsP00@@PW,0S ,^A0 ,TP |8800   0 R00S'  410XAXQXa40C 00x CF3~0S0Sw0S0S C  0S C CC$0#4 ܍p PS P@k(W?, \ v<=5=. +=1=%7 l=bE w0/4l(0/4l(0/4l(,@-@-  ! { 6&G-P`p@0S ]  0S X|T  U TI Y0S 0Sƀ@ 9  4l(>i>-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-   C-M Mq@` @ PPݍ Ѝp!r ddPp=0D@@rO P,0: S0RP00 0~(PP  P81: S  S U r(PP--P%PPPU r2!PP @P4l(!O >Dl(5>>?6?@-=0P  44 0!  Ѝ    Dp(S?b?0@-4S 3/ 4l(@-00 @ 0 $@< 4l(@-@c@@-p PL`@@0 7/0P S Ѝ b00p(O- MM06@  @  @ 0p$000 (0-P(LL@ ܍Ѝp 03/0P0  PI @$0SP  (0SDUI,`P 0 W U euX0YY 0 `p  W cp[ 0S $P % 5 v e@uUT \ 0d @W0SU 000 !00S# 0S,aQ< hq00CS0"6@ T 00CS0!6 P @YT Y@DOoB 0Q    @OoB\ 0 @0  0 0 SNTp(@@6&p6&5U@@-0M 03sc000@So }PP* R!uPP<] 00@ |  0PS PQ `Ѝ0S s0S m0S\0S \ 0/@ L\0Sp0 @ 0@^vp 0S0Sޕ @g0Sӕ  @"  @0St @D LP@ @0 @ `!0xP|"%#   T`    P @@``a/ ] x Zp h 0@`p(p(p(@dAA7AMAoAAAAB1B~BAcBG-0@  0 P 0S< 0  Q*a PPZ  o 0P` f pЍ!URQ PB l !{0 p H0 0W40p P , 0Q0   040 04! !$0 0 0( 1 0, X02`P` +PD 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0ps00 QP    0P jAP ydApP1S1S1US1S 3S3S3US3S,  pP0p* 20212 1300p 0ps00 QP  7  ~ 0Pp00S1<01@040  0ns40  QP   ~ 0PA0O  A0@P 4W ء 0R  N eYX`V P0Eu 06#++R`HX< $0S,0,  RT0CuD0"#1P0P  0QL \0   0P 00P00h00dl0d@BPBBCC7CYCuCzCC+ RRaArrAaUCCC D1DTDlDDDD@-p@`P 00 P0Pr 00QP  Ѝ 0P< !@ !0 P0r 00QP 4 0PPYCC@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  k 0zP000 EZEG-`XpP @ LP W Ѝ0!0呗 02rXY DF X0 @X0 PcEEO-@,M0p@$0l@`P Ppr$PP b@,Ѝ x0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S 0 Q q 4(  0L $ P 20 2 p(p,"  @ "  p@! P0 S@  2"!"0  0p@EEE(FFE0P s s// /0F4F_vO-M`@PpP0S Ѝ X  H r0A D00 s/ r ql  `*P0p@P q x `0 P 0 00 P 0 00 ` P s `0Pt P0 0X `<P ;F+ oFFFFG,G@GGGGR0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0 HZEPO- p`0\PPX $P  qQ0 0\Q@T(2 R0@ P" R S C0BTX t0D s  3 0 TX  R 0 0 p| P YP  L BPTR2 Q PE%H_HHH HO-X`0Mp@PPdЍ v0Yl0L 02 R0 r00 P葟P#ر 0 STR rH 0/KP v  0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX0!  0Jo0 QP \ :PcEIG-@@P`pP0S 00S <0s+@qa$0S  0S 0S,0(  0  `0S"P  S`pl S HD@pP q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hTPP 0Wp0RQ@0&I[IaI+ [v4!I@-XP?`\@#@3P@T@TpW @@T`Lq(O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ00 0Sn Q P hP0 W:00 0@n Q P PLR 0 /P<0T 0qBp(IIO-M@L0S<`@DHp S!-P PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:IIJJwJp(0 A-B?$@[`/p0S g0ES PC tp@@0T?  C0p(0 PK %/p(O-pcM 1W, 01 SP0 S@0Pp(0@@D0 0$04@|D0' R$ X0`1#b#<000< 0,00m<00 QP cߍ0P@4p(0@pD0 0$00 C``02# , }PV00a280`F0L0L08 SD00S   80< 28000,00@m<00 QP  (1 0H 0  RR R0(10D04L0 `0L0C < *9P. (1 0(11  J   4 ,0B0 D0P 0D S140S  ZI@(1  0I@0;+ r P(10(10@4 40 0S_ 0@ H @0(0/os" R$ 00 ,P 0s0(00$0@0 pS@0! 0C@0@ 0㓲" X 0X  PP  :X R: U$0p 00pP0 4n U00 00pPd(@\Q UpW$     Pp PK/\]s g0x!P0p0p0q P$ b QQ#hQh  0 U P p$pp000 000 0p,@Pp0S*0  Q b.0 Ab  @ @bρ G?@ L0C@s PQ*W x 04L |1r 8 <|1 0W4 8 <1u0U`0  0\}xQ1PP|!R \  P PPL0sPP|!I6@0|1|Qx1U0P U* SR   1S \lhP@ 0I 0000@010hnPP 1|!RJ PP 1@\300 0Q (0R{ U$0 00ppPs, uy`00U0\`0) $ 0(\T P0000 0 0T 0P0 0 0,D@W 0$ Sd1Sa I^1 S0(0XRhnP0S 0Sk \cxQR P0R*02S 0S0RU 0\2SI\D|!1xQP =PPx 00I@ s 0 |1P &P#P PPPPPPL0Is0PP@1@S U @[Sh&nP=PU p|1WS P@ |qppL0Is@ppP !SP{ p<PP 0 1|10|1#40L0s_?00010PP # K/\qPP05P 50Ph00h0Ed 0ES:\P |!d1PHrH"HP : 00|1@2PPp78 ,Z80PI 020SP0 S0 U$0 P 0c000 000 00 0,@ D00S< 0,00)j<00 QP80,R0 PI Pd01S\+!0\&P %4QIP0%8%\@0 Pjp(II~JJJm JZEq(JJK3KK(FT LKKK_KwJKK2L_LLLLMLG-@p r W pP\aPP Pp( PK/pD08QP0Q:" 0PS00  Q pJxPhdP80 "8 R 00 05 !$xp(!MEMiMMMM>NNp@-@5%SQ% 5%QPR 5UUQQp  0Q   0Q0  p(A-`hPp5{@ @ 0% Ņk@ŕ\p(O-OMPp0P* b5S 5唢@TE  AlP@ ET \T 5d 50 ! S$5"R$%P0SOߍdP  RR @`0d B2" 0h JQP d d0P Eh0K/0h0 o0D! ,qr0d 01( o j  o  }o,10,1#40L0sK?000/1001001#40>000310 00 000T0 Cth(%,5QP Hd gd0P BNp(NN(v(`NLNpN- N@-@ P 0 5p(0/(v(0/(v(0/(v(,@-@-  P ˾k6&G-P`p`p@0S  0S X| U TY0S P0Sp@ 5(v(>i>-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @HPPݍ Ѝp!rddPp=0D@@rO.P,0: S0RP00 0PP P81: S  S U rPPEBP%PPPU rPP @P(v(!O >8v(5>>?6?@-@-0P  44 0q Ѝ   h8z(S?b?0@-4S 3/ (v(@-co00 @- 0 $nWo@ (v(@-Qo@gRnnGo@G-MM`P@p`PR0 `: SW/jn0P  rR *o00A 0C @H#@ V& 0S UP0P帐`0\PPJ0: S,^0"<P@TP&P@ jP  8PP @u3M`@ S @ S@P>PZ PPn UD e-@+S R U5APXp!t0#}&PU\00`0L!0 @P2 Pn0S`X PP0 PP W80% ܍ЍnPUz fUv TrU NN FNF F@ 0`( "4`#/ p@-"440 @"440 P"440 "440O( $0 $(m XXmddhhllppttp p@-"440 P"440@ OOODDO@@OHHOL`LPPTTX~X\{ \`lp` pl p@lp@-`"Q@Upf@p@-@PkOhOeObOpA-P@M4Q->CSO->?n}C@X=X\:\79>@O9>:>C;O:>CF7O 0? AC>.OC>mG)OF&OE~EnF!OGO 0X J~pXW}m  $$((,S>,NS>GNFNHHLLPPTTXX\\O-P@`Pp !"441!"441  $$((,,00Q࡟\5 S L5s`PҀp0,$ $Q p W SvTrTpXnX\j\`g`dddhah`l]lpZptWtxTx^N0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 Pk000 40 04 8 40 8 0 0 4 8 4 0 8 0 04 8 ` 4 0 800 d&$$( "8",0  oo$bR`V S<#0#$0 `2"$2(2 48M $!4" (2 !8!"2LABLQs@-@QPsr  i]+ P`1l#oj0AL 0 0 0B0  0C 4 0 808#<4 0 #40VZM $!4" (2 !8!"2& ЍpN@-@0S7}(00S 4 /{( 00S/+M{(00S0`( "4`#/{(\2O-$M00 00 0P 2@2 0 `` X0 p#3WQC wJW=; 0RX%! RI t! RET@S000@S0@0   b``@ 0@S.T 0 0'W (,0P000[0S 00S$ЍT /T 00C0CV@Th00S \00S0S@ FP0 P P}(x}({(8{({(d}( {(N2O-@0t4p 0 /0PQ8"R000U00S.  =`P'0SP Ѝh6  0p  X1P0``` 0(00,0S/(0, ( ,R00Z P000 `0` R0( ,0 0Q  0R000V00S  P0P`(0, `F0S(00/PS0P, \6 P P X00 0{(P}(O{(p@-@@PD  ~/P`,00S !60 0ppx}(G-P@D[@T@@@@pu   0@S' l`h r紐hX 5p DPT 0 0 0$ 0p x}(|}({(A-P`1 p@5p0S 50S !SRp5p0S 50S!SRP @P @A-P`p@ `$P`P00@AO-MHMQ R&80< @02 0B_ `P?c VP( ,PHr 04P`P (0, 0S/(0, ۍЍ10S*  1q VQn8.#4n4#0.4ᶀ4(44 0^ 0 0" R?"R0`00L8<Q"  P`k O0 0 @Є"44003/) 0 0 0 "44 0^00 0C `O0* 0Ol060S )<'0 0&OP}({(X}(x}({(|}(X{({(@-AMMP@p`(% 0 P@4U0:t0 R0*d %@1P 404   P$%AލЍڢ8{(?O N1 7@-0 Ѝ0@-\M`PpX @ g0H0`0 `'DP!L00S L P \ЍpLt3t}(PO-`M0M:6Y P3P#PP#Y0P#Up ލЍbX `@0f0x0L6408t008S \`" :x"0S1 \ L0008t 0 HP( $0000S }0  0.P3 p\t.P#0 0;"0K 0 8 @   0 0S r n  P1 "].P ЀL00 0P0 H [ y 0?0 X0p20J0  000r00S$ 2j0 H0 h0H [0 Z0C 03#  4 S 0040EP!?}x1 06^ 02^0  k000C0 0 S  8  0000 1    m0000 0 !0vs  000S G{( t}(NoOyOz(%dO}(OO{(OOOP̯P8{(2PXZPqPG-P`M@HXpAZ 10S t10S 00 0O P<ЍG(PE@U> 1 RP1H i0  P!`. H'0S$00S U  0S y|0S G B@ЍGdX0-P L0 ЍU{({({(Pz(%N PPPPP{( 0`( "4`#/p@-@HP081200@ 00 /00 @5bp{(00S 4 /{( 00S/{( 00S/+E{(P000R0S82O-@ `RMPgD R0R0`ď080S  C/ S ! R 0C00 0@ἰ? 0\\5p!Sp 0 0Ϯ00 ?@U '  ϬR7 R  0W \5S0 00/70/0 0 BЍ  [ T R  P000 0080)/@{({( {(PT Q#QCQ\QP0O-@P:1 R0* 0똑嘡0 `P3Qx 0 T B:\50 0T\00,"1p R 0 0 !Ž p 06\`0 C c00p0S   0 .0x 0\ T0 0x 0\400,00S Ѝ8{(Qz({(T}(t}(#0O-p PQM P*H PW0k:, `\5 0 0[00O,"2@ R 0 0 !Ž  @x 0[`0 C c00 d0@C C@bA c30B$ 05 , Q,040(0PÏP089,10S 18P0XpC9 ̡PWEʸ 80,80<01p!0<S0<0<0Ѝ U8  P\EoCEEkCkhC U00aC0 S0TP0S0<(԰?0WTEFU  P 0R0SE ?Z0:P0EU 000Qz(Q{(Th}(`}(t}(d}({(|}( 1G- 0pP `[   050@ 0S 0 0 80PS `P` 8UH0ZP000PS [`4>\Q$,$ (,`(PLP8{(Qz(t}(Q@-@8P 8080z(G-ܡP0S100 B?pZ PAP` 0@`8@Pp1 ?Z\10A0I00 00 0 V0 (p"(p p1 p#(,` W Vp`0PQ%d0SP 1@0  XPP00Ϡ^P0d000 At}({(}(}(}(}(}(RP0p@-P @?3Z800P( 0^!SRp}(}(/Rp@-X`0SpL0LP0@1CA0S000p}(}(}( 0 0 /}(O-H0MS MPp` 003/ ލ Ѝ30 P00 +0G000 tp¯0 @ S 0V  0Y0W0P3p!0S& @3Q2Qg 0*"  10 A 0[0 02H+ 2R2 t R9X:000\P  $$+ "2P Qv{ {  Qt Qʰ1+!!0Q3 !03H0 R0C?o20SF P1 B <+B0((P4 RP& P "x P 0S 03/     0P  0`V c6{(\}(t}(d}(~FR{(gRRR{(0O-S㰄0`P0 V0RM#@M( , : S T \p"(5R4<R P  RSV 0 0 h0S  ]V ,]v0 唓B?PX0` 00p0S 00W \ 8ő @5D0LT 031 a> QP!000T00S 0C600>*%P( 0ˏ d 4 0T0 C c;  뫴 h}(8{({({(ST}(`}({(U HSX{({(t}(({(x}(O-lM3P@ 0pU`!\P  ? 尢 ? &0 CZ2儲0S0 S 0h"S 3S Tn@X Y820p] 20SPs \`X00X010S, Z#'00X0S 0 0 `0\ *l!00ST06 0,!S0\P 0_PT0 20 00 04$04L3 2$ @  *A0(0S 0PX P& PlЍSu pp5\t2`d{(}(T}(`}({(U kS̯t}({(|(({(X{({(O-Pl20Pp0@P"`V 0 0 Y0 Ѝ 0k Ϡ?R 4G g@ WULQUW TV A0 %00100 @ T @TPTpF@TP T  @T 0  P T 0 !00V02 0 %` 0 S0 S[@P 0 000\000 %00S0`0000 {(t}(SO-Pࣟ4MX{3Xp0 raPp0 g3G0 GA3B3w T 3(<P 4ЍhT+a83 0p R OA 4000?02@20000<T 7T- @ @TpT0y6@TpT 0 0 0 @T p & T 00  08m000XC` 1 0b(P 10010SZ 뉑  4000?0娱  0 S0  SY@ $0>  10@(Pr 00 p4000?000S* A0 0000 0 @0S$p0Yl 0 `00P $ 0 00000 $hQt}({(SS@-X T6&s@-@P `_0S 0S 0  ЍpwTO-MtE M`P0S 0S Hp P 0Sލ Ѝ 000S  P `0S 0S 0S >0S} 0Sx 0Sdu0SP.0S 0S0 08Sd s/2#' 00 " " 0D@? !? 00? 0 R 0 Rd!! 0R0 pPd0SS "04 0 R0  0"? 0 , R( 圠*,4ï0A8?S% 78P0<P0Q R0" |U0S lPhbPUt @0S HEDb@PUn ,<0SP@PPDPtH0S  `Cn* l>xl%|0S l,l?0p00S00/%P 0,0UA:000S 0S PL1 H0S 0S,0S P  *P   000(4P 0SJ P PP P{(TTTTTU UCUgUUUUUV'VqVVVVV]VV(~BW!O , 8WO-PH0pS`M W0R0: P <"p`G,"0 S m20SQ oЍ౟࡟ 0@ 0 000CSY?00 1> R. !P\!0  S  L P (  . 80< 0 @`80< P0 V P0  ?$0 S@ `00 R 0SQ Q\ 0a`~(*X{(DXT}(L{(_YX0{({(sXPX{(00S 4 /{(00S0`( "4`#/{( 00S/M8{(O-M,M7L@"p<,W $ :00S`HW ` pP( XP 0 0 00؍,Ѝ:00 (P t XXPh0S  0D j@ P i0S  , *U ; [; W   054%00! ?0S S :00/0S 0 S :V0 0#03 R00S l:0S7 `  0I2P: 0S R< jP0 zS04`Ə@5 K)Q9000 B?OpQP%90S  0 0  0L 06P 090S, TXP09 SPp0 SYQ980S5  V0;R00*h0S- 8((d0 #0 (P ed80S (0 0x0`  (@(T<70S 0h0!7'(5SW/V S:'<V  3 #\  RHSQ; 0 0B D U0$00(p aL7 UPP0vX ZwPe P'000z 0@PP6BPx" h0SPp%Q_'qQ PpQ^q U0 EpPQ Ppt ?A7#Rp 10S0AL 0( + Z$0S 1000S 50S $0S 0#   t ?sN$0S 1000S 50S $0S  < 10S0ꊡ  0_000 04 0 S 00  000 0n$0000 #600SH40S l4P P @pt3000 00S1 LPX S00H00S9 0S 30S2 \P&  0HIDP 2 prLtoPd<2 0Q\00&& 0:00@0S428040/<0a0#QP8`\@P 1P0H080a0A`ppWNPPU0\(85  @5D0L 0T 32 b< RP1Q 00pZ800 3/ UV 0 P` P00S 4Gl0S@ 4H0S*  0 # P0L B#P]8ht}(8|(|(|( }(XR{(|({({(`~( {(X{(X{(X8Z|}(h}(}(XX{(({(YPX?YYgY~YH{(L}(p}({(YYY+Z`86O-,,Ɵ,|M@P,0S%40AHDLdP T0AX  Q5 $00 ᨥP 0@, R<5@|Ѝ 1o\%v' R  `  0p`oQ0P  0_S /  p!.p{0Pp?00 1> p'@` 글t|$\5Sc%Ϡ<# pD ?'0 QD40S<40W SW ,4,t`V0x@@0`S 0, d+M 0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A 0 Ń># 0S  90S\00T0 @T`0V T?  @`@T` 1 0X20qA000P0P0$V$ !P00 0 pS ;*00p0 VTX0 @ @ PX``W0`3V5L R 01`7: R 0@ 0 00   0K0 TR 1VS0`   0P W@*  A 0hP 00}({(TT}(~0{(({(\}(}(`}({(t}(H}(QZ6&{({(U {(ZyZZ`~(ZO-`pܐܰ 0M @ 0 0  BRЍ P PU QP ~` {{@ pQ RP Q @px~(L{(_ 0`( "4`#/O-dMX P0P0\1 0X1 PP1PPp 0,0SdЍ0S 0,`@dK0 `/00䰟@ 0D RpT0 :N`P 0R0A ST TX0S @PptS{({(x~(H}(Z6&t}({( 0000@/00S 4 /{(00S0`( "4`#/{( 00S/2{(O-MH@@`MVP`,:0S 0P *S *`0080< 010S y0 K0P X P )  P9`0S 0S T)D P00 09 #R0p0,0S01000=(0 0!"4410< 000800$k0P@ ` [_V@00C0M N100 0Sz 4K 0PtE0$S 0S '00P7~`| .0X0S01,000<D'0 0!"44,'1px 0pp00ppP*0S  YPa 0 16`YMPU `@  6 680< 0 80< @00C0 Ɵ0 00 0Q.*0S  P  0"pWWލЍ0S 80< 080x5 0< S d/h0 00$001 [6_ P 0S 80< 0805 0< S h0 00`S $`! B("( p 66 ᴑ16P@180< 0 80< U00C0 80R<.PSR$ .R  $PPP3P`080<4l3 R0 *30 0NP2 0 0q$Xp0AS񟗴(Т``P0SS 3 00#20S40000LP x2 =#R0؀20 0 #R0tQ& l20S`20ST؀0  P  : S000 0 0 #R0 Q   0 FQF?d!d  @10 S& Lg#R0 š!ɡ0S  0R {ؠ 1P 00 00lPd0`P00C0X?P8\  t}(|}(8{(x}(T []{([{([["[[0[[A[\P[ {(/\>\N\_\n\u\\{({(j[b[\\\\\O-WM M&0AS}Xܥ8ܥ, vP7 _l hiP }P7 00[@ , 7 TP 70S 60V6 ;X uL0`06`00ĦĶ100V0:6 Rp0S8`@aVwPV}Wލ ЍT P@P (  5l 0S ` F Lq@0 v00@(0S S㜕u%ptH`pG(pP* 5 0  B, !D ]850SU 00(000]/0n 0S e(0pApHH0SpG(pD bQp(?T,pK40xpS@09Y(0G5 A,0 S1 #(R& S000000!Y"!"7 dxhp9  (  ]/%   ,0 S1 #( R S),)-*-{ {d` p 0S(0S , cK2 p2W (,@R@ )'Ax 0T!W"!"dh ZR@ )'A 0 T dx@0 (0S 0$ QP 0  s00 } 0$ 0`10S x10!l10!00C0L10!P0 X00000C0!" }pH0S|@0{ 0 0C0v 00@q\P{("]P]PXx}(}(}($H}({(X}(9]]R]n]6&t}(P}(]{("q]P{(P {(]]00S0`( "4`#/{(O-M̒"0`1Ca2@Tߍ0S p@FDAG@DPds0l p`00@00C0 00 R2PU 2PUp0 0S0S)P@R1PPUPRPU P0:0000S 00"P D100C0(P X `PJ0P0!p!0 000LS" dTaX|!Pe 0 0w  W000pATt}(}(H}(]6&{({(L}({(z(!^Otdt}(H^LeO-`쳟p3张PM @?D \P  ? 匣 ? c0 I`30SX30T ST H0 S 3 S 0!@ 00000CSFTYr P 80R000303L32   ?D` a Q2!,S Q0pB*1`2@20S P P B PЍS x 'Pi?00 1>!  R1[ 10SJ0!T  0 S@1`0 ? (D00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0{ {<0 PPp@{(}(T}(`}({(U p^X{({(T}({(0{(00S0`( "4`#/{(O-lMX ⤒夢Hp200,0SlЍ0S 0,P@dyD0P PD00040P1@ 0 0 0DRpT0;:`1AQ \`X00X00@SSĶp\t`d`V %P 10S  0@P=P 00S  0f 0S  Q\ {{00垸 0Q  000T  L  <0C{(H}(̯^6&{(t}( {(^^H{(P __!_O-MoM@P_00 G0|2?0SX0S $5Sڄ0SXxPYX0S $XmX S R<f8?`0Vd2 P\20+! `" d" BG00!X d"B1h21$\Pl2ڬΟ\0C00p21`t2QB1l2? 2l2V0CL0=SLq Q\20B ,( 0S 0『$5> */d>X>0S +0 0객 S0B$5111`R B- 100 ST $| 0S% 4 0帀- 00$%BR㨁0`S<B11@%L0ᾶPP  U PN 0S <P| *堀G/<<0S 0 00\0 bA?L0<5A?X0 =<0T0.H0F; 0VHRQX0h0@ @0F8 84<ϠQ bx{ S P,0 SZ?^@ } P< x;0S @ A>+@B@  CFP$; @@ F000P:J*.: :0S 4G0 0؍ߍ0<00<`/  `!.0i0S ,pd9B 0  00y+\0#Q  0 i ?T F0܈St90o So d90S 0l)S 3S  0S 4 r0 0t80S 8 0S8`0`80`O 88o;\Ş&"\ `  0 0Ϣd h  pBnj `b"368+?P囓)<TPD  0RTT07P pDP0W`C ?Q `,00C[ZS +Ϡ\<#Q  0h ?\0化S  7/0S P#D60夦h -60S 00t&\Q`\uX6PH60S6@65;o\Ş&"\ `  0 0Ϣd h  pBnj `b"36e  `$5S8Ax( 0R #0", 2R #,2$24"00 (2S W08" x S0! 2'E 2D%S\2/< E 2%Sd2/?L EW=SL5s45`?? p`00SF[ 2$Sd2?/0?  (2l$0C(2 2Sd2?/0?  (20C(2`D0P ST0030^`0 D0 d^"{ `"{,00C[ @@ ?A! |"k 0ASxxx 20 2(2@#0C(2 2Sd2`0/0!!!`pV0: 0`P  Phdqz q08PPN$20$2<0S4 d8@ 2,"S\2/0?! ! 2"S?ԀP5/`20PZd@p@0 0 @ @000$5S `0t63 03080D ` ßD <R ,2`0,2! 2Sh2/0^>^00\0/n{(}({({(E_hOt}({(_\_?_v____|}(T}(xaH}(_6&T`}(`{({(d}(~(<`f`}(8 p}(` {(``X{({({({(}(a{({(]a}(aU >a$5St2h ` 0pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0P P3 00ᆡp`Y7 0$S\0000S7囡!"pW`㵏X7 0 %S\0 000S7囡!PpWO-PLL`@T(p  W @aaA-Q0 % C@*r`! 10" q0SU 10a)0 a*x*1t10S 0 0T 0@# 03A0S4 "\@ 5*< 5P*000S 0 0@TPOUAJt0Tp Pd0 0S L P<0 0S {({(%aX{({({(baa{(2b0/|~(0/|~(0/|~(,@-@-   j 6&G-P`pB@0S L 0S X|C ᙸU ᓳT8Y0S 0SB@ (|~(>i>-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @PPݍ Ѝp!rsddPp=0D@@rOP,0: S0RP00 0mPP P81: S  S U rPPP%PPPU r!PP @P|~(!O >~(5>>?6?@-0P  44 0 Ѝ   ꌂ(S?b?0@-4S 3/ |~(@-B00 @ 0 $AA@谗 |~(@-A@%}AzAA@P/00@-@0S / @ {(Yb0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPPp  P R 8 4 Q  0/TTT8 {({(X}(\}(`}(T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/p}({(T8 T 8{(0p@-000 0 00@P22=000=000X0X0<0<0@0@0p \0\0.(H3H3L3L3P3P3T3T3u/"( (h p@0p@-000 0 00@P22=000=000X0X0<0<000@0@0\0\0p 'H3H3L3L3P3P3T3T3u/' 'EEP  '4444K4K4h ' 5 5d0d00000-P5BP5H5H5=Ch S>S>p@80 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//t}(4O-M X hDhhdhP@quP@D@:0 0 P\kP SЍ ?90p  P\PP0S 30S30S x]p3p#0Sh d#S\ P P0S D=0RS Z$c*&0S O@"\5S2 2\5\5" 0C"?o20Qh [řX24 q'8d ps$2 ?9:010S?,A!Ϡ<#\ Ÿ P  0B ? 0Se0S 0āh &0S |!\5St1\5P l10S(` XA. L!0 0@! 0 *Z& 0S  0 0 00O X@hpİppHT* 0R A {( }(X{(h}(cnb`}({(b{(b{(bb{( c{(8 p}(Tt}($c~(}( {(>c{({({(l}(b{cc9 O-M *0M08xpP\P?嵯 Y80S  :P>墯 p0: S \ gPލЍ48H0,hSO )000S &007 7009   ` 8 8 ܯ[V``Z`T7P`VD 97P Q P  )zH8P0 086 R>0 0p 0<&0&0P7p0p(60pw>0 H0p,p2S# )Z9P )U9P ).qVPZ `Y 4[ 0SZ?관X V.+0=  80 ,\:PV, 춝 Q3C ?7|PeP 2Sl3% 8 S20#"20#20PC 2SB404040$4,X02P&V20A2T0@22 0J80C`8 `Fb>8 0 lk7H ? 0`P#tT#0\`P`Q=S/0 5P` ( 2RV0 S0SVc 5*< 5_$3 30S 0 0`20S 0#0 0R V 10S `2R\\0SD{2= C0 ,0|"t000 00Cpb&? p0("l `0S10S!0 R=S0S lD $000E p 0L%000X30P%,;q *#, 10S @S0 0l}({(c{(cu{(~(ddP{(z(}(*dZ#d}(}(Od, |ddddd&eMeT|e f+fHfeeeeafTff {(fcf gsg-ggRghhh{(Xh{(hiFiki]{(j@{(T}(Zj{(~j8{(}(}(}(}(}(}(j{(Rgg7hghh^hx}(i|}(t}({(ii}({(X{({(~(ih}(`}(d}({(BjPX=SZ0SR Tp0 <<00X3P%0*J#0 |00S 0 00S5 0 >0S tPq 5*N> 0:#: 5!#(1u 10S 0 000S(PPq00*#1U 10S i|0 00<cQ0,zPr 0<0*"(25 20S I\0 0倂0 RL%r0L%r0H00q" T 000cH00SPFPr*"2 20S * #0 0 00L40q"  400cL00SPs*"330S #0 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*R"d4\40S $0 0 04t R,5S0%45S R! t004e0SP*""$5v50S T%0 0 00刅(0S xQ$ V0S0< x (%0S8Pȅ*!5I50S ]p&0 0 08%<5HSR$ ( H00850<S_^P*!660S /B&0 0 0܆@%D5LSR$  L00@50DS6/P<*!L7D70S |'0 0 07 70S ,帇 0R" 0Rz7 0SQ `@ᯫPLX  +9p@ Tʰ8 @/  @!. A@O@@፫P 5  9,@F$)P0 ( 4   Q LIϠR  5d)l)t) ')p!)PWpp \9  1 P, P'Qڨ0Q, D0 0S }Pz* :: :0S NaD*0 0 00S R0S0QQ 0 0S KPz* ::0S / +0 0 0P jR0Sh dR0S ^R0S^Q  "Q  LR0S&! FR0SQL<Qk >R0Svq 8R0S0 2R0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*5 <<0S -0 0 08=0S 4=L=0SHm* T=jL=0S ~0Mh  =w P%L5s0SB B-000=0L50P5?T5V>X50$E- 0 0B0T1 `R.B!!@tN00 00L 00*>>0S ,?.0 0 0@P0 @DT@8 HLd Lc B 0b03"4 `@P Z( \?0S  8 H4L0d @ B b"30P?0S  0p00P6r@ ᝩ|6PtE h0d& 5000T60S 1S < e3P06  (6@ Q V @ 0`P@@  04 8 <%c#!$c4"%S 50S TP 0 0 G ``0  0 04 8 L H$C0 5L5s0P500ߍTm {(n`}({(0 \P/Q/ 0 Lœ|  ,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*K3`30S 0P 0ThSXSpTsjP`UU00Q AP 0S ?@?+JH`P"hR0"00S8 lr003Pb0S* xB0S* 00RE>0X4* 2p610S J]0 00SJXP10S J1 PQ`1*X1` H10S 00 0H10S <gJ,1 P0*0`00S 0t 000S 0dP`1 0׼ 0儺G聺|}({(d}(h}(X{(l}({({(Ln{(}(t}({({(}(}(8~(njn}(}(cBnB{(np}({(n {((nO-PPMp8 R B@0S 02 ?Q00@aV`` 0[̑ YP t \P  ?HH  ? }0 02r0S0c Sc 0!S 3S  00@? 0!0! !!0S`0 0 0 `Ul!Ϡ0008 L3R 24  B # R#  B ` 0Q" P*0`0S '` ` `Ѝ0hS  $  B$ $ R$  B  {(@{(T}(T}(}(`}({(U p^0{(X{({(t0A-P`p`ATR K@P<[0S @ /1p0A}(o80 0 1S/ 0S/}(`0 5 /H0P 3S P 3S P///{(^FPO-0(P,0@4p8`S P P0P` 0S 0 S   000 00 00S 0 S P0 v0        {((}(Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS@hp8Q Q 00p 0爀ቐpH l 0` RP/! 0 P  C1  1 @- 1o0` Rxho/ 10#/C!000P/@- 1o0` R@$  /  /C! C!/! !/@-, 1o0` R  /  /C! C!/! !/@-e9 1oO-$5 SW@ lPphU0 01X` 0000$p    @R ![ 10<T+EP 1 @C 0ό2 @D R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RMXr@ $PP8 P(` `oP P7  p u.0S   ߍ<08 H(00,0 0000400!4 04$0D0(0P HWP h ĸpJH Ᾰp < 0嵉 0 `, !p Sp Op Kp Gp , qp 0`?`a8SsPb   00*P*00  0* Mod@edAdozd@o|oooooA-CMMPPp`;8 %p@P  0PAP߶U00 ## CލЍG-MM`P@p`PR0 `: SW/,0P  rR -00A 0C @H#♸@ V& 0S UP0P帐`0PPJ0: S,^0"yLP@TP&Pŷ (P  彷PP @u3M`@ S @ SK@P÷PZ TPPn vUD e-2@+S R UPXp!t0#PU\00`0L!0 @P2 ኷P-0S`X 6PvP0 lPP "W80% ܍ЍnPUz fUv )TrU "NN FNF F@00S 4 /{(00S0`( "4`#/{(O-p\1T1`00Pʟ 0 b& X 3#ˠ121@ R` 0S&0AP!0R00S! AE% 0%#s(0!ZXl000Z T00 pp8P,0}({(((p{(^h}()p]{( 00S/{(O-,Mp0됡`P@0V000,Ѝ00 ?U0$p$000 000P$00S b00 ?%$0P000  P@^1@610010000/ 0 0    0P@4P@ 00 ?U05:00 0f000P00S /Ѝ00 ?$0pp%&` ) Xd00 0a'%v0 S    t}(p{({({(pp}(&O-`P6,M0|F0x6xvp0p匓 Y rP!0i 0 CR)422114242 1 50SP 1 50S 0C 19 Q0 l 1 Q 1 <  50St  C 1 0 0 0 00P 0Q. 00! 10 lt40SP B0QZ 00 0p00`P 0 R> $C0ğ^ P Q P +Q 1 0 000|BYq `ePl3  ,Ѝ8[PXVPD3P0QSt? #` ᛖ 33 $`Q0B$0 $0h @bPX$(`0 $0R. 000V0A+㌗P2  Q$``! $0@-P$ S0 000B`㼱"3@0 $0V' 1 1S2> 410S tB$ 0R00 00?000P+ 0y(P0$00 00{ $0 0{000 0 R  000`@`00S  {(SbNb}( q{(R,qRLq|qqOq{(^FF^q{(Ot}(((X)q^h r]O-P1AQ P1a`3$MS0_ 1Pr1100`00 0pB000P0@T <ͱP$XpXT 000/ 0bP'0Ġ[@    0S TA    MP PD0$Ѝ{( SbNb}( {(}(q,$r{(frYr{(p@-P0 % .  @Q 0S pPb# #3 l0# #:>0 @0SpP p{(^F{(lrPXrrR/ G-P `$ 0p!@V` 0!@`` V`@&!D`( G-PC4 `p&00ȠX㉑ ,Ƞ0 ,$ Ă Ƞt h,Ƞ 0 0! ## ?Ѝ  :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  %0@`S ppJ` 0 U 07Π 0nÌ ^VQ 0V>  0P" G`p P 72 b0 RV1Q0V"0  P 0 P$ ` U P ``Ѝr 2 r0A-1àQ`P |0| ||$0@Sp࠱ P$` p@QL ࠁ PQ rĚ e rp@-@PaSl0l ll$0C800S   00080P4 PR*Sp0 sך  r(s ,0S/`0@-@0  L{?,0,0080S 0  X$0@ޕ,(?s(s r,0@-S ,0, ,,F$@TP ʕ@ǕXs rO-p-\MPU`@8 U810!@3 @#S41@D2s2@Ds1@DS@D5@D0  00 0P± U0#03?\[[UX9 `0P$0<5Q 4姱O0$0 |=D 0 XR @="<p!8pL0(0$0 0H(0 0 `,0`4  0 4$#HP$0 PT40  (00\ 0Pf,05S00SUSP3S` 4 $ `UQ֒V  `F0$00<040@00 C3 4`00DHpL`<0@ RS80 0 ,H0 PpT`_@P,Ph3Q 0Q+ 0CQ 0SP THpPL`P@ T@P" P0ᐒT`V@ !$ޔP` !T@$00P0 0,03p(0?D00T P rHL PT0RP HF>t0, `S24040S@p( D08 0 P  X Z 1!<(H >`4400 0Q 800800p?(00T 0`RZ@p(0  0 P 80S0 0C800S   0J`lO@  D e$@$\Ѝ0$0,(qsLBAWss |rst! NBAW\t)t4 sF  ;tG-0,0S0 "Pẑ@`00qW40S*Ѝ! 0 P@P   l@PpYsX $ rA-0`c,0@Sl0l llS"PpQ L0< H 0P@DT@Ysk > r|t? C-0`c,0(PS0 '"p@Q |0l x@PEU  0P !  0 P P ЍYs O r|tQ X0sC-@0Ђ D`P 004 0ᝯP 0 Ѝp,(d}(tX0sC-@0Ђ D`P 004 0ႯP 0Ѝp,(h}(t0A-PQ W`p@0P R   T0! ^@P 844~P+{(0(t,(Hu(uPX@-,@P,0S ;000(@-,P ,\  D Ѝ0(p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRppt}({({(27@-0S S2+, R0 ELi `Q |xPC㔬aQ* Q( PDP <4B 5*< 50d30a3g  220S ϵ0 00@ 7.Bp#x3@ Ŝ ' 0P `XA 5*< 50d32 81,10S ᚵ1 @ d3S, CQ,aQ$ 0AS#VP [@0a3d3* 0Xt00S lH0 @ S Ѝ08 {(,({(uuPXuuX{({({(0(uuv @-YoP O-0Mp "##@0` @ 0$0!ȃ ᥖpPs0S@P-# 00" qp*$9lU tU bU0>p(P)$T @; 80 (P 0 @0S ,00#!( `$G P P0V pЍVp FpP`4 \ pr P`P0V:P0V cP p<0[0T$$0 !: Pl  @1!0 00$ 0S Z(0,  $ 8 w*p P @p!0 00$ 0S Z(0,  $ 8 Zp @0P x  P0 Pq 0 ! P0P v/&%'vFvdvvvqVvvG- 0pP@P` V   00000G `00000O-0mM`t $P0@004080 0 zp40S+ mߍbP AP LP d8廐4幐cP iP0p8. 4@0 0H4: S@ @0(0D0,00048`0$P  P 0 0! xHTd ⾫p 0Q= $ 0! $刑匱@P 0V$0 0/SV<<`V $pPpI<G0"<9P0<0`P< `v Hmp< 0 0 n?C0 < n?n/֩0P < < !$ 0#$0@0P!SM `V|s 0S `0S  R$ R Z m0H $8H Pp$`G0pR $ 0pK ppBZ  (,PQ(,PQ S Rh T]w/& %gwzd@www/x.7 AwxxFxcxO-P-D,M@p`$P .p($0S0$020S'$p P V 00 0P0Nd 0 #fP AP PP \cpP$p,Ѝ`P 0`P , ?o  00 00 `& p 0PEqp p Up`x/&xx$% yUyG-@lpP ᕓp`:D10S:- ) p% o09 6X $$ Upp+ P%W00S $$ E`p YPPU `fV rV GTP$$ ) Dp$`O`/&Dyay}yy<%y @-oP A-@P`pP0 hhX` .U  HA<M4  E A m6&@- R0Ѝp` P@lP 0 R SR  R $$20BR R P0 L-, P/00#01"$#ꘛ O-@  @T \ p `? T00 Ѝ@P 6 [ PP P7 U  Q*"ƌʠ? ,͆  RQ*  R*Q*"É?   C-HaHqP@ @ 0^ \ ^0᳀ 0S@ 0S@ 0S@@00\ ?\CT:^ *$@A0607;00@R0@Q 0BR !C 3O-`$0P@P 0z'0 0 Q P d@ Ѝ PC-P$4 p咓`㓁(`@ 0Q P Ѝ  ަP404-0@-  Ѝ Ѝ/-@-00@夎 0 Ѝ@ Ѝ/-@-P 4(: 吓 Ѝ Ѝ/O-MPp`@PЍ 7P P 4S x 0T0P$ Q$VP 0S 4S $ X 4P S $ḌSG30 0 !0!p`0  0 0  0 @P 000 00 0 0 P 3 0T0哇+ P#(` ,`$`V$R ڜ  0`  xB   @"\PY 00pP0Spy(yz+zRzNzgz5kzO-$MХ@pPP? 2R 4S  0"$Ѝ0m Q Q0   RSRQ"  "S 0 0000 00  0 PP4S 0S,  00 000 0 P0P0 <00SS PẐX  , 00`V4S 0$R V P0 RS  0 000P\ H0H 0000 0   H;pFyUzzzzzz {G-`Mp<P3@P$Ї@#TC^t E@0$4$ 0840; ^p+p :xpx H4$$: S! R B.T lpD $4S8 (4,$0.B.  \p 0 0"dR04<$4,$(4$t0K>Ѐ 0  E  00`d؀E$t0  yP0`P 084S    0p 0Op 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY":{O{5|[{d@g{~{d@{{{{ |@-@P 4B BRP åp <L4( VЍ@GЍd@B|a|@-@Pp P P 4PS 4 |||A- @PP0T p ` `Xp0 p})}$$ QS40ŲEA8Ѵ#8"( 0 / 0T 00 /$4 0T0 / $4 0T0 /O-`Pp M@6Pట`  `P0P0000ᨦ V:Ѝ 1000 0 P嘦`P10 0 ᎦP U PA}W6&7A K}`}AC$$0A@-0P@-@ t`RdbЍpP MP 4U R 0 L-v}}}O-!PR0_otM`@R(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 T m0 $8  P P  <P }A-@pP`P 5/p 4 5/p 4 }C-(00pS4P Ѝ$d@ 0 R  l 0` 0D0 ( 0`WP }}~O-0 0P-딀匠p@T Ѝ` iP `VH Dp 0  @L-v< M~A-P(`(p@0 @∤T蘟 i~O-P$Mp `@Ȁ뼰0     Q  x0 p `p X0 \ p`00P0  $ЍW ( w~O-PQ04p@ 00` ЍP P0S* E g0`P      04 p p#p p04pp  ~~~~~0s@-SX`@ PGe0 ?o2R0S ЍpL-}@- iR sR aR p` 4e~p@-P@P (`rPp FpL-p@-@T 40`PpP>ppL-,iR@-- 0 aR bR LR( *sR% tR@P 07P0S`00p`(j0 PL->p@-M `@P` P00͵00;0S 5 ЍpWiiQG-@MP Q  ЍA~␀ p$㻅`Px hB~0 00  0 `PP  ҆q7#O-$MH@`P ,`$ЍPP 0 0 0 $ Y># P0*Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ <P 0000 0 piP _4  *$\ `  0V,S( 0$84 0p| $Ĕ%{!#,[PP  {T P R*L0Sh 0p_ L004 0 000 0PM 4$$   $ 0$$@ip7 /In(00S 0@-C^M E@$$$E0j 0]/PV/Ѝ0 @x("(!"`#XT 80 K @ڡP8ס/&T%с-AqVTf0$ 8O-LM P`4 ⨡娱 1D0!2p  0S# x! Rl!LЍfR lRG  F 0pS  NP W@P  2o [@ ԀP ! MT  0㐡 @  T  @ @ P@ pL-/&xAl%6&,A-p`(P@݃P 0p`P @00! 0$0@-@P$0S @O-,Ѝ( p`(P ȃm@- XXPX`@8 L0@PDDD(<<O=@XT7A L OW6&DžR R R D@-R R/////1 Rp@-0@P! R!ꘑ,,,,,h,p Rꐑ,,x,,,,,,, pp B R"Sh 1` `@㱝T0P pppppppp謠 P4(UO- 0`O@PP Ѝ0!S R ᷁0P(Pp0\4SH 00$$1 $0P8 S ᕁ R RP304S ڠ0"S1 @D0 ] 40 3/p 8 H0 0($  P P 0$ 0 0S (0, PpꐆWEVĆ P4(φO-0,,MP`p$0  p@20S$`|P 0 0!  pT AT fT 0@,ЍsT00$Ip0 0 00 0@5qp 4 `00p x0804S 0 Q51!0  R@ 3R602G/ Zp p 0oo`@ L 0 bp@ R @s0R R 0Sh0S0  00` 0` 8 H0 pp0pW$00(p,0`/&%8 X8CPt('A-@ĔQM PP An``llph`paPP Ѝp,   0 )#7rG-@P3p% U4 d! A~ⴐ崀 p $$ 0 P ! `" $`p P 00`$B~ 0 #7ȇG-P-M"@ងp ЍG20SBP`,P|&" $R  4S  Ѝ4SP 4S]P  0] 0"VU [ o $ RQPF 4S4 P:P 0H  0 pP( , !?o  0_0 00 pup : 0"p?P   U0p 4S 4S  0%/&Ox yUy@-20SK@0SD007@ DP 0SD0SA \^<40$ 400#qpp, 804<0XP$ 0I,00 P ybU@qU H04 8PpPTЍ$$0 $ $(`VxO0Y `0 XW0 0 0S$ (0  [ P/0W0 000$00(0 00qpp 0 QP Р 0 Z$p , =p p ,  //&P ~ԛ%z9ZO-Cnpሕ FDM@P# ‚pX50S L#DЍqP sP 80Zp#  0"qp PPp0#F$$0x`P P  0@!0P0  0 H0 0$0P   P 4  0(0$0 ,0  4 PSk 4,  (WUXt[P 0T 1 T00 S :0 U 00[( 0 4040P (, [0V [(Q,UX? U0U0Xt3P p (V,#X@& 06p8 0   U 0 00P_ Q QXX 0 0  4p P 4\ "$p0 0S 004  $ 0$ R40H Lp $01S 0S p0`8#8&h$ r/0$0s?`rph4 4$$  /&%>|RtP L0mC-P$M0@ p` P!! Ep*0S00 P 0SP0SM \^H 0T' 10S#!Q `T.NP. a@ P P ꌧԧTipT T |,$ЍP`ꩋ/&%Op@-M(@,`6#,P X0 P00͵00C0S = ЍpWi@-WM M`p[@T8 G0S @^< P 0$$ 0$$ 0xw 0rxP xe xx 0`lm0 $8PL#<D%Wލ Ѝ)@5qVcԍ @-0@ n 00 0r  0/ЍqV@-Ma qP@PwDpxЍ@觗` 壗 p囗Ѝ嗗|哗 p!80pp\XT0 0 (~8| P @08 0@TS Q2P  Ѝ@_] $m0 8 0 0 ` ppxD1S1SDPЍ@7PxaWgqVvFW* Œb̌yЌP `00CS`0p S00 P0S X0X /X]6&G-MMP"` " b$'2㠢堂堒rp@TݍЍ   `Vj @ܖ   `"0<0 B7BP *⽖0S81 B#BⲖBᯖ孖$ ! @|<#JP%$ !P<# pm0 $8I(卖$勖# b#@B~0 Bu r   E0S 0CS 080 [ + ܌{`qV5c(3Wmߍ G-0㜂MpP `@ P! ~pd20S$KPD#@6 lP`Pa@ PꜱıԱuP xP @ЍPP p/PPP0S00 P 0S0S \^ 0 Q  ȕ ĕ&#0pW ᳕  ᯕ Q ᦕ  }   up ᖕ /&$%+ ܌{A@-LM@P`4 p ' 0D0 }p T$  P 00S 0TR lRxLЍT pT83pkP ^/&O<% @-0$Mq` 0 0@P!! }p$0S00J P 0SC0S@ \^; 0T 00S!   0*a@ P Եܵܵܵܵܵܵܵܵ4Tt!pT T  C$Ѝ͎/&\%O-,M0$00 0 00 00 00 00 0 00000000 S,Ѝ7@-@ P00U0 0O0 0I000 P   S Ѝ0C-M@pP `3 /0 0)0000 0 00sS 0lSp@ P$0㓄( p l@ kP 0㓔) p Ѝ@T@Tp C-`P`C$T1P YT Ѝ#PP Y P9Pc0P0 `P00$$0\PslV`P x`P (00\PT_ XVD0 \GP $0  p4 QHP 4Ph0P 4 <Prt pP00000W000000S 000$0`P ``0P(0 jPP DDDtW`P tW$sPP04 HP 4`#P `rP @ FPn H FPh @0 SD00H0 RL0$ 0l` 0qpD  R$4,, 0qp 0`} ᎍ$4P `$$Ⴭ$4P`V``P `P d&t`P iP'8,0 V`P V8&? ` 0Yqptp yFPp3p o  FP   |FP  uFP   nFP  $ gFP  X `FP q@ YFP  ( RFP q/  PFP r IFP 01S 0r/Ss?p, ղ Ѱ  3FP s/ ,FPz$$ی$4P(giP䳟z [V`P  [V$$0` qpS, p0x< GPj <pP < <(< tGPZ <P EPO  EPI L EPC 8< WGP <$ 8 EP3 8 Z* 0c$ Bp $ jP$4`  0`qpp$ TY$ 6< }800$00(0 000M$040P08\ p,` 0$00P00T0  ^XZ0`$$#qp$$$4P000H00L0p`<$4'` 0qpf$$$4P `/&%L-ד](wv1|rIJP + Nճ7zxN)U}ɒ֒E'M˔ ()H0@-M@ P  P bp@ @%8 Bp(0Ѝ0耩 z'i@-SM@P, k0H0P0X0`0h0p0x00 00T 0 0\ 0$ 0d l 04 t0`@pt 0 \00 DL`|`pB >D Sߍi@i!i@-@  ,  s0`( "4`#Ѝ10S/!p@-MPM@P% PA. (01P A!A堍P8 0`0?oS c`2 06P. 0I0前0 0A. 00P0~P A Aq000 0ШfލЍp`_0 0A. 00PH0TP A4 4A@Gv`G((WÕוЕs@-6PP ,P % )@`TEЍpP  00SQV  Ȍ@ꎩ 0 R !O-M@ Pxp*p"`P"  O K\P- a\P:\pP ap|\P a `BP 0"h 0R00  p!  BPr 0SohQl @ Ἃpal a! R R RZ  0PW l Z ` tX (s<kW 0j0S, @ hᆋP@ `ဋpd HQ L 40R !01Sp0S 3/p\ U 8 Xap \ [ 5@ `Tp Ѝ蘩 z*2Q<5KkA-p[@P@\PP[X^\\ PQS\P S`PS@- >DP Ѝ<A-MP pB@P00p`ЍpP ; 4 p !0 CCi@-@p @A-P`[pP^00`P@U?0` P FA-P`[pP@00u`P@:7?0w` 2 F@- $BP!00 ЍU p@-8M@ PAP1!~[P K`0 Q0s0S00_PP  [@PDt `  _< P[`PV8Ѝp褖, i0@-BM M@ w 8p 0S 7  /  (0P(@0S700$0/ (h 0pdP(@0S Bލ Ѝ0q@i@i.Cp@-Mt`ZPP _P@ T0T TV_  o4 p 㷱ЍpS iu@-M@   pЍi@-M @.AP0 C p  1Q0r R08C88 1p`Ѝ褗, p iis@-`P p@@@@P0 H@PlS^ P@ LJDZP 4 nЍp, {  *%7@- P@=pX X*PGZ P@00 <<s0400Z@ Ѝ0芪 <=G*7@- P@p` `0LDZ P40 00FqZ@ Ѝ0虪 <Q2Gp@-M`ZPP00Ѝp^P@UxVk@Pd̰P0 +p@㻰8 P@ PP m}Qfi@-$MpYPT00$Ѝ^`$k@Pp d0 pP㋰HP P`@ p$ㅰ_mݝiј@-Bt ЍWޘ@-0M00 0  Pဈp `j@PU ` @opp 0 dpRP00bS mU 8Pxi )5s@-@`.PP  1p$ l0ȆBp@-` MP@/YP ] ЍpX (   ]  PrY@NDvi 0@-,M@ Px?P0 / p,Ѝ0 0R0s0S 0 $0Q]PP 0 :Y@TNDR, fp@-P-hp@@@XPH0H HH]Q P$㒯mlpG @- P@?P-00Ѝ  p  hX 5@-a@-MX @>PD0D DD0< 0~ p$hЍi` , ʪ i@-MX @>PD0D DD0< 0] p$zhЍ'c , ֪ i-M0( 00G P Ѝi@-@01X P$0$ $$] X@=Gߪ *00@ P/a CRWC/A CR=C/@-00@- M@ H0, 0 pٮ ЍiјP@-M `@ @u>q {< <G  Ѝ  ;?W @-9@WPP 㦮mpL`P`0 P000Jt0@`Vm`` X0h@ @@@@P0D 6M,03/` Ι%W™ș6&//// 0L0L0/% 0T0T0/% 0\0\0/% 0D0D0/% 0d00d0/%p@-@pP 00p00D S 0A0CS0$P>P 0@p%@-p0( 0`P/ R/%O-04M@@ !T20. DPƅďůp 0$ (`pVD@PT P p1cehT6l PP@ p 00JP`p R  P Q R/6 0TS $ P\(P  1/ P ?@0S jp "SR(0Sdㄭ\ 2/P W0 [  )( ɚ;O-MMPp  X p`%\ pP$ 1000$ ⶡ-K c `pf Vx Sp Q X/ 8 p$0Q $_ X@T /X00@0 0(PT 0 @0 ,0@4@p 0rg0Pl0q 0X 40,@pDg 4<߅i0H0S $P31ЅH0S=I0S:Z`@T 0 3/@: " /렒M0S:00%  p""pM0S  ៅ&@ ᗅ@03/@r J⤜I0J/ោNpI 1Rua`"%J` 1 0 d1 T|p 1 d\!1 HRD`#%Js!1 @ t1 x!|1  P@Tf 03/@0 3/ݍЍ z-;iȜ~iٜ%ii͝(p qi!2g   !9DO-@PpP  p T RT@PTPT!֫xT`P `ӫPTU D1O0S ㉄dJbJqW yP.Z  rP'  =P! K0S 0 L0S 0M0S 0 N0SO0`S PPV D a#B N(<p6&@-,MP@wpP T`P(  p 0S hZP :P00@ @N0, @,Ѝ k(8i(uh @-P@З0P ,뱡G-@LTPP0 x`@ Y㔀 YpXğPP  >ppP  H@@@g@ɡ}b { 2ӡ(Hs@-@{T@P00ЍpXPXᐟ@P <` >Pgu (s@-@QS@P0 XPXg@P T` Pgu( iЍp*}b ӡ(A-@"SPP0 `@~XppX5PP ʗpD >FJN@}b ӡ(@-@d 9PP0P PPL 0 S@@00 >00Ѝ', ӡ($"6&10@-M@\SPWSP RSPtMSP d0P P P P< PDp$Ѝ0*ɡ(7izs@-@廖h  ۖP LHPH` P! ,Ѝp@5/ v<G-M`@PK `ppP"ԩ(  4   p% (&( px" <@T t8P巂l2P\専 UR T Ѝ0 PE=e@P㒩 $@孁p 刂t 0R k)8 6` p\|Qqp R%P\h $mKP;ЍG7fQ\ 0Q    1 0PIP0 RSЕ 97 # 0` R P U 0pD```` P  z8i(i uҢ6 ; cW / ޢPp@-P`@jQP V  xR`P G`G 00pWQTpGA-@T 00`Pp X 0p @-MPPm00Ѝ`0 000p@ 0 P >V0PU 0 p 0 `P0G-@(PA00`(  P1r0Pp*0X!U0"R0 $"0!0"SЍI0P 0,  \p 0 @0@-@P F @O-`,@pP(0V0S 8bP$P$P 40S 04S 0S(0p(`8P0$0S(PdO-M00X $000Ѝ 0Q`?  0Q> 00 7PP; XTȜpP ,,pxA,4@[T /@P00 D;0800X5Tl (a( R R[`5"00adUx 000 Po0"0CSi 0BSe 00Sa25!445^ XpaPPT  Ჰ $pP T+dXB  0 Ap; 0STw /PPZ!078!10#R0 0i8XdP Z@ H0 YP@T 0CS00x C00 X ^0:T 0CS wQ0x L @0aD\W@DAD\ 7@D@SB@0 0#0  0@D@ TqT@cTl p֦ SPPlE< DhE0 0 0`0U v<HB a i %A-X Pp@`;PX00>0PO 0 p 0 `P0O-$M`@ HpPX8 P W0  Psp` 0p0   0OP@0-S P(Q Q R3L  4  OP OP.U P  0GG\G R0 0 p 4000 p0=ɥ0 ꈣA-`p$P@jaP0`0 0P@ A-`p@PWaP0` P@ A-@p`PPPU00SPqb`0PPP ! P0000SPXbA-`(pPa@P @00 0  0pP>b@ C-P,`p`P X0 (0$ (0,00(00 0@pb Ѝ$ O-M8pP`@ DU[B! R:   p DB!U R:@DDA< @Ѝ 0 0R 0@R ?F/  R # R #8 [p v]ꠣH Ji6&1A-0%MS@F/ p p<8u 6p- 9`08N/p`S^ P@8`px0 pdXP,000N/P,00T0($0`|%ݍ舋(KiHB 1$ @-p̣IiKp@-d`dP0S s@ Ppmz {p@@pP@@긣%(O-P(Z` 00S<1 000xSP 1p @T Y  0P P `GR B`Z     >P W:h W`%*P@W@D0LNWL ̠DLL̠ @@@Pp=&t=&g~QA-@P00S 00QQ00S xAt3|p0 000xSX*|Tp`V#|`   @0t=&Bp=& Jp@- MP@ kU U( 00P Ѝp0 TPTT@ !O!0P!!`g]PP  @ 0 A-p`Pp@ @P(Ţ  Az~ p@-M@P`  `ЍpG-SMMPPx!x㠢ppX!\ U p@!H F/ $@T SލЍ>`P 0S0 S 0!9(00 1 ,0zp[@(0#70St0 00#00M/X0``VP41S 80X4M/,H{ȷ ziʤ(2p@-`M@jp 0+SЍp'P    = R #D 4zp 01S 0/S R[o i 00S/@-@zG(A-P@`TpP @ 0SP 6&A-P@p 4`PW`X fPH0 000 0 p`$Nt=&:i@- M @ph h㠡` 11PE00 Ѝ00 1p㈡ GS9i[@-(M @p w 2P00(Ѝ 00S L 0P02 0 pQ zS9i[@- np 0QSЍS   :zgn/ 04 8 <\ S $S DDD S/8 S 00,/(/$/PP9PP 04 8 

@- Mx @/Pd0d dq\ gpL 0D 0^p,0 ЍM, ץiiA-M< Pp!0P 0(0, 00` 80p0@@`@$`4 <0J^PT100 0(000808 !p'   ! P0@ @   :RԀ00C@p0 00 p(P|00ݍ@ T0S p㻟@ 0 @P0  S  0h͸ \oi8wt=&v<@-00Mt @p` `㒟VpPL   ?8 p$㇟0ЍVظ æiצ\6&A-BM`@( ` pP 0 P P PP  8 ! ll pz l RAIxlmU#0P 6dp 6S30S |2x0dP 6Rp 6SP@30S < x 0P 6@p 3Q? xI0P 62p 2Q8x8 a "p 0S0 w8 pu p t  p 0@\ PpD2Q <wBߍ10S w10S ww 0  `0000pwPU0``0` Rڬx1000 0:S RL P<w`(PpQ wV pWP ,;w.wwH0S Lqw -w~lwncw`0Q ]w w8i(iiǧ@(ѧڧ) i8iii 5 nt=&o%Ly?I0@-v5JO-MM`@ <0< l 7KgKP㡝7[(0'S` @0$00 `F@( 0R |P~$0S0'V$0$:0 :0: 0:$ 0:0 :0 :v(@!0! X n0 /C BRZ  0  00=C$0Cɟ"! 0P PE ^p PdyE00X90IppcppCppPpp Spp@BppA`$ 80PX0` -v!0X@"0,0,0S> u0( 0B'S(0؍Ѝ 0$0d(S   BS>C0CD(S Q:ȟ "!! CR  ##9C0C"!% 'S>Cǟ>C"" N=C0C Q 0*S ;S. RU 0C'S8d9l989d9d9d9d9d9d9d9d9d9 9d9d9d9d9d9d9d9d9d9d9d9d9d9d9d999$9,949<9D9L9T9\9SH332 4222<42S# Spt 0S R Sm &S|h 0R  |T|0 Lu0, 0 B@, W0S 0S p tup`W>(u 0R0 au`0S Xu0S 000 Mu00C!倥娀`pXP0  @ 9up` 3u0S W  04 8 <$S Wf0S  +u0S 0 uu ` 0dY1 pG4  `000L04HpY400 03c10S1և!u tp 00I t3 $( P  #P# ß P# tp|P3Ip#S0S lt0S#  PtS8t0S $t s 夢 `0V V"    0`tV4~t0S 0Xvtg <ot` 00dY1   0G p00Z10 `0&"R 1 !o 0B0I It1 $( !P  $P|! x Pt! T0tpLJ|  lhd`\XTPLHD@<P0i)mH rvDԋ({@( $kd5gWv<ɩҩܩPksx / 9PP93 Ap¨̨Ԩܨ  p@- M@P` Q4P aPp@@S Ѝpiu@- 8@)P(0( ( Ѝ耪,  ץ@- 8@)P(0( ( Ѝۧ,  ץ0@-MMP "[r@PۍЍ0@S P+ pP@SۍЍ0@q0S0S1iSꉪ0@-MX Pfp@@SЍ01$(k@iƪ@- P@)P@0@ @@m I\p$Ѝ,  Aץ@- P@)P@0@ @MO >p Ѝ"] , & ץ 0 /ԥ%/-@- M,00@(000 P  Ѝ@Ѝ/0@?o21  @@@@0Z-@-  4X0X ЍЍ/@-@Xwq냫 0S/@-(-@-  XXa ЍЍ/-@-  XX ЍЍ/@-\00S 0  0000 0pЍ(@-@?pH ppp0qۅp ˫p@-pMPڬ2P0 PS 0P@ 0 0 00 0Xsp HlP@@ ((@,P0P4P8PS+00!0310@- Mx 0 @P \h RLPP @ , 0@@P 020Ѝ0إ%R$(@-4P4 @q % qn6&ӮP@-d0 !X !T@0 60\ (0000/0 E Z Ph0@-d`  !TD0 60\ ,00 00/0 E Z P-P040#^4<\$0000/0 E Z PD0 40#\00Q 00/000 E Z PL- 0:# ^4 0Q$0000/0 E Z PL- 09# ^4 0Q$0000/0 E Z P 4 <# \,4Q00/000 E Z P@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$000 E ߯Z $0@- 00.nP ЍD%A-PM@p`WЍ P 3M@P p7@-0P@U , S Ѝ0GSA-@0nS0oS@p p9hP`YPPS0nS0oSUPPUPP'v<@-V0 |ptmY6&O-MM`<(0p@P@(G@-a mjN6&O-@M p("P0P唒0"` P0|"8Up/`2 00CS20%|000& 0|0`P0 +0000 0p00*0ZVjkpg んrPdPMP* UP? GP e@ PWWXWW\XWW4XWhXWWX 00 0 00 0< 0x`|P 00 0 eP?V 00 0< 0nty,kp [,0t0Z00x0V0;;0|0ЍZ00x0L-L-/&d -BMMI^@0 P@:00d  0XjpL0 0 0/  0ZUi뿚@ 7@-P @M0Lo SϜ 0 Β Ѝ0@-@D0P @@-@GF0P @ @- @L0S 00S0?  㢒Ѝ#p@-@PeP0 㜒0/Sp . p@.9Ng@- @l8i{6&O-`@ Pp(,夐렰0 0000 Sp0@DTq oPX0 ကP@Zq9 O4/&L-L-N @-M@A> 0@0D00 p0ip0S SH P 00,0 0h! ǵp@-@PڧP0 0/Sp- p@}-9Ng@- kh{6&O-`@ Pp(,夐R렰0 0000 gSp0@DTq oPX0 P@ϑ9 O4/&L-L-N @-M@A> 0@0D00 p0ipX0S SH QO 00,0 0㐑Fh, ǵp@-@POP0 ㆑0/Sp, p@,9Ng@-V $h6&O-`(,p崐崠崰0@P0 Rp00@DT oP0 tPTNe  gA+ONL- /&-MM0An @H 0P ,0@~hp "gٚFp@-@PݦP0 0/Sp, p@,9Ng@- jgS6&O-PM@ P0Ur`"lRp)20 R. +x   &  x `!p 0 *00)0`Vphpz 㼐uPfPMP9 9P$ GP g@PtcbbbbHccbcbbb0PC@(0L P@Aq吁H`( L0`dp=0KSh0  R <( Lh0 ((,d0 v( h0N/@  0ӁPP 00,P 0.0T0 P`PT0 Vf0$00 00000|00x00t0 0p00l00\ d0X@,>fRݍЍL'4(L p@-@PP0 %0/Sp( p@(9Ng R R @-/᪹@-@M0P`p 0c000 dPPЍ0P0 0 0d0 c0P s@-`000/@P lcP0 @SЍp 0`( "4`#/s@-`P@g00!  Pd00SPPP @J@H  0eЍp萍( ǹ(002P0/0@-@CMP( P41010 0000000 0P J< 8heH00Cߍ0Cߍ0@o꠆ wG-`0@8Ppp6 Ƞ,̠Č Ƞ,Ƞ D4$03 00n4408< h0e,b<0pE0< D(0|0040<0pp PH00ЍpHPD PG eꐍ(\qr& O-$M0 LE@0` @PpT V0<00$Ѝ 03/ Z0p@ ' 0P0:@ 0 `  p00P LH0@3/plPE 0 P 0T@Pp0  DP P @0 ` 0  d꠆/ C-MM`p/ P  P@1L#d8$#4d4# N@41@-D0 0@000 @pߍPHڀ@Td8$#Td%4(G-[ 0MP@@0P` :(0P`P&]  00| 0 pP  X&0L 00<0ppS0 W0S000S p |p`  hP 00P0S`!0!D0D00W 000 0  P0b"!4b4#P0P0Ѝ 000<0؍(L'A(-0-M 00H 0@P ,㼊ᅎ zg 2Ѝdq@-: bdZa늺6&O-PM$  0 @00@"b0"p0@@" Lp20a0CS g@P{{{{{{{|8|{{{h|{}00p00@p X! 0qxPKbx ~P S0S Q  - p &@zLz [!!D ~P 00S Q    .z @z'  ᣌp j+bap t 0[4S08pS @p @Ѝ?BL-L-/&8 >mrӻ@-MMCN@80 0@ 0(00 0ap 㵉 0 b"b!b(W=0P( lb,;0P , Tb0LbލЍ4b(b $4EcUs7@-P @C0Lo SϜ 0 g Ѝ0@-@^;0P @@-@<0P @ @- @{C0S 00S0?  ;Ѝ#p@-@PP0 50/Sp$ p@$9Ng 0`( "4`#/ p@-"440 @"440 P"440 "440}( $0 $( XXddhhllppttp p@-"440 P"440@ <96DD0@@*HH$L`LPPTTX~X\{ \`Np` pJ p@Ep@-`"Q@Upf@p@-@PpA-P@M4Q->C߷->?n}C@X=X\:\79>̷9>:>CǷ:>CF÷ 0? AC>ặC>mGᵷFᲷE~EnF᭷Gષ 0X J~pXW}m  $$((,S>,ᅷS>GၷF~HHLLPPTTXX\\O-P@`Pp !"441!"441  $$((,,00Q࡟\5 S L5s`PҀp0,$ $Q p W =vTrTpXnX\j\`g`dddhah`l]lpZptWtxTx0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P $!4" (2 !8!"2& ЍpN0S/!  O-,Mp0PTXP` $ ! $0Q/ @T 0 /bQ BQGAU! Q DDDDDDDDDT؍@ @ @ @gA \h0 U@T0 0DS d2Q "P T8 DR 0UQUDTP 0 @@@0 X R   0PM![0 x00S P ` >!,Ѝ08 0 0P㴅0 ꏼѼH("@-:@PU  xx^_pp0h`Sd@TpPP0SI\D0D,K_  D_@H(U6&4x  0`( "4`#/00S/@-(\H(p@-Pp`0@S     D00Sp "4400S "440p%T(s@-@00S 00S Ѝp@0001!Ѝp@ڹp0P0` ,X0b;V C 0$(^"[ЍpL(X(`(((R/s@-P00S"0@00S |000 Ѝp@衹 ?,4`L0+;V PC 0$]$[ЍpX(`(L(((+1C-P0oSMP#` 2R  0  ?<#΋ 0 `x 0``0報 C c00d0 `c Ca c0b0 0  0P!\pQx 0&<0Ss $$TGQT`P@U1l 00 ЍO a0St hhȀ XȐPU P,Aꬒ(T(U RiTTt0p@-`0S[\ @L00S000000B0E0p蜒(%PH,00/000/B10B1/101/ \6&O-eM  dϠ 0@Ì `0 1P50S  100 R(0S\PpЍ ` P5B` bL RW@QWR5ștPP/ R$ P  "D PD1  2D1" " P 1 21\0 8 P U Pp000 0$5S ? 00l1>0@D@ @00C03`0S30 0C0 0#0030 3#00020SQd  0@ `?50 ST0T00  B 0P SX0000Y0,d00? 0 0@ `5? 0댠 ,1#  0 ! ?0 00C000 \S T10S  2 dϠ 0@Ì `0 10! 20X[T40Af8 0 B0 080$0C $$  $ 400@40 08 R R` /  `1> ``& ꬒ(T(U R6&%O-MM☵`,, t51^OR0du@DSiaH51YwY ?E 0S/nE ?0?E4[P`؍ߍ 2@ŒD 0L 04;2 0d04 0l0   0SF0LSia441Y2Y0/`&22220_E0? 0 040hl 0@DU 0L /0d4;0 0 0@$ P` 4 <0#0p R0C000psPYx'x`P20S6v 2䢟 0 000`0n  `  Z ~X PZPQ <,K 2\0Q0@/,040<09(080 P? 0P@-  0@őD L 00 /4;0X~X 0 d0@0_ 0.1r 0傑PV fX`P} 0 /{\0X0`0d090?{(,0{ P { {F 0@Dő L0 0/4;$0 X9X 0lh d 0@Ì `01%L((A% %(T(TO--)MM,0=0?0(8$05XD0D`0S> 80pW:,0 0 0 VL(`(X(((!X4 P@P`PK P@ 4 ApX3 E4p@ \3T@  >SPp *e >P lC([0S0,5 Sx0<0(5002 0,%S0022Q04XY 0Q|XQpp" 0 04 0A PXC 040A 0X: 0 4QX1 00 Q*X( 00Q(X 004 QX1 p00W/0G,\3Sr1\sڒXXT1X0SDzX X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001LX p4囒P 0\0 a Q#((Ħ%Ȧ%<cl(x(Dop(P((!TU((%T|(̦%h(t((2! dS,QS18$Q<4R:x X @0\5 ?>C00p#!3x00084$0<0D04t p@pD000pXsL5P5| P4H   ?F8@`D ?? p?#`stF01o&"  A00&"n0  4%8$05<4RW 22 p8400 0 0<SoPx8N @P@0 ? @P0PP* ? @PP(5#R0:P@0$- 000[0 a`Ә%"`0 ?001>0[`0 c2#, SZ QZ3 ?001> !00   B^B0P`0/2"0$ 0  ?wV`1V`#T0`10F 0rI ? l 0B@TPἐW 嘀 00B1  B[1 ` Y"B !!0 R0C!I0B? B0 `3똀 0  B![!0`S1B 110S V5u @P`x1 0F<Ĕ84CP0S`84<Ą-0$5BPSQɑ,`RB@L0 0 000060S|0` ?4HL4P0@0 6@ᆨp;'!^ULp00R  QDC}L7\5?>C00!#4t x0Yx7(T0#2! a, A3 31  0 @P0 04 `  0H$4  $ ( B, @%LV.  R*h 0(E < <(b X H( \ P( ?.@Xd@+@B@A.@B,-8 He`b @40 `K? ,p8d A YZQ  $Z0 {X R A/  pW <$?.t{4Ąß  Rï80\@$D04 0H4( 0ĀpP2 R 5#< 5423tr0S+ἀ됺 ~z000d0S CQ c6Rc(`P 'z'z {'+SsU @ z0犸 08z'(Ȋ (+S|,aU 0  R0:1P000\xP2#00,Q@@00 bp00 R00&(0 0Sc@ R*U QP0 넠@t: 1J0jF 0q`K%00S>(^F(. (F6&ht@p6&r(TP(U W6 TX(L((%T(\(8 `( `00Sa  0 $#% &$0+ V.u|00S  C 0=S,0S 0S0$0! ,00C."$\ ^  00 0?d 2 B< b10 !,T$1H p SPP04SP0 0R0 S00C0 S 0,00P0B 0,0ST呼 p开8嘥ȿ+" < Q \%l0R@.  (0 0 @DU`@40 4A20 R40@ `0```0T04( s 0 ` pP3$0X`0< I9pQ80< 帐 P0x0 0 Sx0x0t B\0X1`01Q0C00h0`0lR#00B1 d0R*8K%dU0   (0 0CH0 (0( 0 R R` ` Y 0$5S  l01` p0000S3d0%ST0T00! !<%0SP5X0`0`P500Sd0 0S P   J0000080@ ho`Q ƍH0+H( 5P+H 㶍H000-ᴰR㰱 ,  BU 00Ao0000T0 10X0岑0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4040CS T0C0@ 0dw`h4  80QT:  $5SʬG $`$`(0wV0S ,4 T d,04  0,4 $? 00`  Vj0S   0帀0 Xx0#`x X\># P 0?d @ `0 < T9\%R `i0SP,xi\`/ `ƌ$  $ l0`S`  0$5S  l01` 0000S1d0<*ST0T00! !\*0SP5X  ``S 0d먐      0t00080@%0C40 0400T$*, Q`?0@$00$0l0h`0@ppT:S $S0ppS $S00S`@0P]뀐 H(W 00@68p`0x41pY70I@X!@=@000T: 5@$\ Q 0@08(0  (0d0O@N 0NC n 0p 10SP=0S0 000S.KQ08CM = R0ł."\5S 00 0 d 0/ @. `3,0 0$ $eQ0000S0S 0,00C0S0 d>0S xOQ0S Q>0S 0ᕋ P00:*,8]P>0SNc C>`?0S303040404 0#pCVW*L xV.PdoV.GVk0S ?0 PS?\5=S,W??^ E?[0 0S 04 K dLĒH 0@Ì `04 1,$0S0S 04 3 d ,04 0O 04O)ݍЍSngG-`RMXr@ wPP8 wP(` `iP P7  Op :0S  0ߍ<08 H(00,0 0000400!4 04$0D0(0P WP h OpJH Op < ]w0z  0 `        6Op 0`?`a8S8mPb   00*P*00~h ≱ 0* Mod@edAdozd@o|oooooA-CMMPPp`;8 kp@P  0PAPMU00 ## CލЍp@-@PᢌP0 v0/SpI p@E9NgR/9G-P `$ 0p!@V` 0@`` V`@&!D`( G-PC4 `p00ȠX㉑ ,Ƞ0 ,$ Ă Ƞt h,Ƞ 0 0! ## ?Ѝ  :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@O-4MX00\0p0`P`0 ,0f, 0S% P 0 umS;aSMSASB0C0b0C SSSU0@0T 0DS d9R$ 0 |"P T 8 0U$UQUDT P 0 sS @ @ @U00@@@ X 0t0  Pu0S00 000 000 P4Ѝ菼Ѽ"@-,@, :Oa^,L6& @-0 @    O-@0p |`GP0 00000ZI00SB_: W `B?F ᴐ(\(P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p(0P  C @-t co`/ s@-PL@` 008+V  @tЍp(( s@-PX00SL0@`ă5#000<*V @tЍp((( h10 PS/C-@PQM@MP`6`@f$a ޼1 P0p9 0 T:@6S0O@ UD6 DۍЍC+ 0P \ 010 S a8!#4a4# 0^ ;0PTᢼ 0+ۍЍ((((( G-DB`p .PP("(Dt 0F0( 40 㨻06# R 0 !.t0 60C 0 !t0006&0=06 0  B 00C0( 6V0:!$``Vp 0f0$&? ^0(0 6 C c0&0 $&?G0`L0SV&% 0: S D&0 d ЍG0< ((t(( ,Us0%A-Ta00S FT:p6.PP  0 0 A1S0Sy0 P @D A01 S s0S @2106&0O006   B ! ! 00C 00(- O-GMP@X@>K?P>U㰐Y  0@00D/60d& 6F @  H^ Td> R`$0r2 h XSQ 0@H0!} 0 R (cR 5-0$0 0ᓩ (00UC(0  , (0, P  @R 0 0 $0F 帼0 060 6Һ< 0 $0,娌D (@(200UX,0000@h P  D`0 0H\ d04LPJ.J 0T0;L05h(L0So h';PU Pc  ἬL 0R V0400$ & \`# @ \  110B0㗹F0D$Ag0PpepeC0CP!P`\` :00p,P`0"  s 0(0d0040\0080<<0(02,0 0C0(0C)@ p 000 SJYLj 000 pS D!*&A 7 @ J|) 0 ( "*J 6 !"0H& 00 9ݜPpD |IH&0SK9 R070Dq$0S 40S `PD@ 80S<000 Sg0C  0Zp, 0 001(0@`@ QHR'0 Xx0S7 0S00S00 0  C02#(0I7P p fIPPXP 0R SHS SQo`@pb Spm0 00 Y:Y:tV3006X  0+(01 0e0 J_T  060 6&OĦ(6Y:$0TSL0S d0 P V50SapW~@0S D5L R d0 P# 0PDT%_oRU+E_&0#YH6 C 0 ᓔ)6 4ٸ 0눔x 6`U0CT 00C0CSX: B5Y1 21[0!!!0 Sq# 0 ᓢ" ֏ 0 0d$&S: 060& 0vg0.IxGz 0W4#0003 AIpXk0SMf`F`VI l30SA 0IW HD3PUBL0S \0:`0l m  PP1z P#r373H6|0X0000G09630 ;Pp`HoB` Hp` zCX27HX0000Gf&1 #?1# 0RP  *d "x 0 |P0PPP!f v0*w`P!\ (*P 6 p!dS!PU:< U*!:0U:h,0 _,0 xp$L0S\^UB: 5((((/Y4%0%((8%QSN(x((@(X(z(4 6&ht@p6&W6 A4D VL%<%AT%S \(((0Q:BS! 0 B6 sPd  00 P S %%* 㑐  0p1Pl1  !7P 8 `U&@1`P`60U/0 x x;L0S `0 1 #'$/%17F\X0000|F&09020 |P((  /0 `p|2& 0x9Df0?o2U+u7&0#16` c2H嵶 H0 HDqFGߍW@G-`RMXr@ nPP8 UnP(` `$P P7  lFp 0S  'ߍ<08 H(00,0 0000400!4 04$0D0(0P WP h DFpJH >Fp < n05 0 `t      [ Ep 0`?`a8ScPb   00*P*009_ D 0* Mod@edAdozd@o|oooooA-CMMPPp`;8 bp@P  0PAP_DU00 ## CލЍ@-`pF  @P>00S0?0\$ 0S 0 zmS\F\GL \ ,ttt <tt<ttgL0 SDKT ЍE%KUJ%FZO%A_ 0  @-׺PP@PpP`P DF<<"0 PFU@C%\ h6&PA-p`P@׺P V 0 mG-`RMXr@ RmPP8 mP(` `P P7  Ep 0S  ;&ߍ<08 H(00,0 0000400!4 04$0D0(0P v WP h DpJH Dp < l0 0 `" O  } y u   Dp 0`?`a8SڡbPb   00*P*00]  0* Mod@edAdozd@o|oooooA-CMMPPp`;8 Sap@P  0PAP CU00 ## CލЍ@-0H@\   RS0@  0 Sl=&0 /\)Q@-$ Q:O-@-yMMh JŸ`010x00@00D00400\00L000 0<0$0H0(0X02000040080,03l0<080404h04d0F00G0`0H0040P0050?0,0 SR hMX0S ]PX@B\0L 0H0- S @0D 0 ?0i/YBp$ \0@ SL0@0+$ %BP $x$ 0@a cPP##3Bp$ CP T$\H0aS 1L\ : SRQt9  `@P@0j V@r@DOoB@b} _P pY00S  Pl  pP 3m`PUb@0D 0 t0@ 0$D0岰@0D QP  D0@ ⊷80S~0x S 10S10S00S11011|0 0180SL0 RS 00R0 R0S> /߷,0P00 @R  T_Z0Sj 1Sg 1Sd 0 @DG1C0S [  [ *0SR3#:\00<0S @!0S P@ T <0 0P U8 JPpD8[P@@0111d000@Z0`S`Sx0S4\0L 0H =0$0 Sp+ p`PhC0S)0p2 p1S?V?`#)$p& a 1S)p Q1SAe1S X$ZBp< k 2"OKK@0DKP?`|L0OK\0K@L0 0Z0T0Q0S<I[# [ [  ? [l0S |-80S l0Sd0h 000@0D0 0#h0S  d0S   T*,800S0 [0S0S"  0C0T {0#Su0S0`0S SX e,0S , 0C4,00`00l0S0|0 0S010S1h0S 1d0S$140S /40P(0&9"B9Y^0P(0 (@pp(A0P!* RbR ԰V000S(dR0(0S00[X`1 00PV`5U0000Ay0pY㤂 ,ᨵg'HmU pe 0 pSf:Yf$Z0pTUp` u ?J 0`SM: !XR&0S $1 S$40(00p000 [ 0R5 R4*P !RP5P"S4U $R$1SPP$Q$1 SR U |\SRQ SP" 00S<0 P3P%P5 0CP0쐝Y [0D  հ0P000p+!`GP1T0b# 02b!b&X 0S쀍 [) Y': [ᯰ00ŸS#,!T0 S:0㈀ 0[嚰00@ŸS#哰00S#? 00T0`000Y00 ! 3 qW5e:0+a! ` +!  G0   [dQ [XQRU10A+!2"WY0 0@b"0`t0+! 0p 0@G0A0S1!YV*0 @D Te5l=pt=&~R*3_/?b8 9Wl!̕- (/776&\)[gfff$ UtRRaArrAa [0 [00S 0, S00R , t 0 [0 [00 \U* 0!A ,10QR0XLu@101S0S0010 [0]S 03 !p515^@000 T0W@P0S Q@0,0S J@1\0E@A?0Y0  <@B?00C?00 !0D1@1L0S X*@Y!p$@t"@Pr bRQ@@$Q@ ?H0S yލЍS0315p50 [1 1S|0 ] #>H02w;`n!PP fH>#>C;Y0 T02#H0 [00H <080$40`0P0#40d0,0#40h0@0$0Q l $   Xt  0|0 4Q0X080 S 840S d8ڮ80 0l 0tN@x$0040S' [#$q4 0W0W03 W00S pZ@ D0pp0S p  =p T (  p ɲZ [$1L CS/o" R `0 0 0 000000P00d00,00h00\0001010100 [L0 @ 0 1$00(01,0>03I?03)001x 01100 0$L2?@1c4 04v 08#$0 #(#<l 0& 09>t 9>Q X0Q40S00|00o00 0 R  S4XT ㎲@'? $ S<pH TS l !R R S 0 S7071011H0T RZ* J|Q\0 [0+0  S  R   0S* 0H0< 0JR?o20S F(0 00 25 010 0P B24 0180S} 0`( "4`#/   k B* {S@--i A 8 /eAD00@- 44@4P\P 0B"" `)-@=B')@-ɲ >;6&G-@P ` 吱!>0P V0 0   PP G聟 pP`0*X 0e0S < d0 ᫱V `)L-Vos@-@lP 0  8X X0T=LЍp q P ` 8$ 0v=`)5p)@- 04#$$04IQ   = Ѝ5@-$MPp  ] @1 @00 !0 0=))=1 p=7`P\pAT=7D=TV@D:$Ѝ=J٢p@-0M,AP`   0 0 010R  2   $0Ѝp@T=R  #   $R 0S1#$$ 0("( 18#! 0Ѝp@+=0Ѝp`)8Yn  @-:pd눞)L@- L0@ R0* 0 #  耩)P `00CS`0p S00 P0S X0X /X;>6&p@-`ᑱ@8!RP#<10<10 .810CS81V <1S 0<1p0 hd`0jPp <10C<1(0 810S81`)p%p6&6&)0@-@-4MT <A`<d<hQ <`"R d2RK< H<d2SA |= hk0:P{PSP1A k> * +['Hk;[E{7 Q (+S PPP _< 0 @@zj{ k[@  k[+SE<4Ѝ00B:|k{{'*k[+S7<@@?-C6?Y@)`)p%,))dp@-Tj0d2Sþ9`)@0@-0S0@d2S>`2"R2p%`)(@-@ 081 ^"44”P -Q\4M2=p2 04P 08t<  t0  t$  0S  08xS`S*?S DS . y000Qy*0C P7K+ C 00CK+ A00CS00Qa0CS*)h++D,)),)))d-)))22)3))D33,3 8  ISPK 0@P( 0@09  90S|90 0K  K V D  #SPK 0 Y PK. )8K d   SPoK P 0K. 80  ۝|  R@PU T80S7  Ý$  RP= 8<08808408007,07(07$07 0707070707 0707070'707 ⓝ  RP K  PP 070Sx'0 0C!0R3x X70S0Sq K 4 @P PRKh <fPK bt0@Pp[ K> 0 pVt`hP@@0V"0T  HT\HX0Qx0pW h pR000QSL00D0QݥDD0@p0 ` X\ X0S 0V)PPP  PPa K 0P@0 K. +7K>x%x 0 6P `@@pP @ VG| l7 0S$0 0C!0R3 0S0S 0`0P `0P c= 0,C 0  R+ .t 6 \0  d0|d0`@(4 KR p 1  1 S 01 \Q \HHA/p@!bJ L0 S1P00P0P D0S( X3 R  h6  X   `H0 S   \0T0 S `,@0SG @DUYC  @  QQP0S|& x 0 .d  ?QPcݍЍ !4     ,QPPA0S, aP   QP   QPt   PPPh@d0SXT4000+ ⷖMV$W!O |" ****6&+o <t7 +F *%(7~ Lmva8d**~,Lc%E-g}͌*x*gfff1 T $ 85(9BGMa@0@-0iS03S !F=ZP2h**l0@-@d   L6 @01 0, '(*)*@-`0@Px0 B0PU1 S2P T0p0S @0R<<4, 0pZ5 Ѝ萲%*x*S p6&C-PD1`0B8! Y!tMR!p@  10S 65 tЍ000iS00S 00S  d `P 4W @ 0  P ( P000 p 0pf W@000ꐲ%*d*p6&h*x*%`0@- B@T0@T0@1 S2 0P   0S 萲%*O-tQ0S hhT @P 0S <@ [ R  R  R* T Y    ```_ @$ R 1  4 V 00030S3Ѝ  R  R ` & "  V Q `Y V 0 D X@00030S 4`50 3X0000  000Sl 0d3 0  0@0020S ` 0 Ya  i 00 0X@f0000Sp X     Rd @ 0 0 @T R(q0S / @T 0 @g 0 $ @ 0@Wl00S 0 P} 0l 0D#3L0 $3ꬩ*Dd*\p6&^6&(*Al1G-0S \\,XqX@` T0 :@18a P8qU @T+$PuP@`0S 0D !0R3 PȐ尠U 0S 0S   27P0S0S `0S  2@x*p6&y*d*(**0A-0S P @`pT V @\PT$@ 0S$p$00_`@x*p6&(*O-!1 0RR㤑S q儡@P 0P0: ЍS DP`P( 04] B2000o PP@:SR  0-2{ Q y~`P 0tl0 000$m000h*x**p6&**&;K6&b2O-0S  b000 Dg1䡟P.pP@ "0P0p0Z: P0 *@@ @ W0: R0*0 S( 10 R S U0:W00#03RQ00S &P 0000 S Phq \ X1000P@ Ѝx*p6&***DK6&C-MM Q@P 0S  0 k_000@T0S qĀ@p T0:ۍЍ`PP@p0 F lY >  .000PU2 x*p6&*0A-0S 5넀pP` U0(@TP`0  RF000S B@x*p6&*A-p`P@P 0_p0S` 00 0CR?o20S 0DoS 06&A-p@-/0@P^ 0Pp SRpL*@-84땤0S$ $00  0 0-VP*z6&A-P0@0`/0000 Sڤ/0>+b T0 P<cP0? 4 O00?L*D*%0@- @000@0Ѝs@-@P`P @TZXX F0?0 00?+"+R  + -Ѝp6&$0L<S/ @-PD*%$2O-@`CMV b@0DXCߍpTW B/ Ṣ0 S'44x'xpԕ j@t1P0S8Q 0SD{'{{g W:0000[9*0S 0 0S 0 000R*Q /0S  `X0 c#.$cc4"0,4 4Q0 P 00000S  ` \**p6&#=*x*D@-s,p @,TP,0@0螲% \3O-p0]MS DD@c@C < 804#P.00RS   #0E.qp"& ZRPP "U_/W  0").00RS[  0".tppd"lLZPL"L  PpdHBHHHr0SPY : SVH`P؀/0 ᶜ10L<aS$ 8 8  @ ( D `  P  \  T ؂ +b P< 㹔P P c0?0H @P -[P)PD W .L P [PAP|]ߍx*p6&e*P*h*%D*%!O * L*'@lKK*F6&%W@-$@0 00: S긭*G-@ q `0S+L+P 00S P0 S00P R HRڄ00S tI. Y `HP 0 Y00:$00S ( 0.*d*6&v!O O-AMM`P@g8pP 084 0 AލЍO/00 09/P7 0p!p , ד`Q D D @P <PD z@P@ -  - -PD b@D tȠ帰`TAލЍA. 04B   R ;0 0 -D E@D W`0 6 0 D W1 D*T 6&&A-MM 00 /R p@`hPP 0S P@ۍЍ0 D &M`D @P 0V WHP`!O D*p@-0@ @P  P@p@-@O*@t3O-tM0 S ttop00RS`3`  T3T#0!,LC4#S@<<tЍOV0 ?-(PL   -+-0p`00y*࢟ಟ@L<` |,L\0@  +WI < h`VV#W  @Pp L<0@'pl0xSiSPcP 0'0@$ 000 ?,L<0@ Z \N dXL $YtЍ0 0C0`10S 0S`%0` S\)X)h0SS  l48i40S d00X00\ `0F0P!ac 0<o,d)x*p6&Ch**%P*%j6&D*l*p* -J* ]~A-MMp`@PPx 0p)h!h!)@PX T3,L嫓%< 0*,ۍЍ aD D< e)PpU)) U`k (p0P , x+(0S (p T0TP 4 +ޟ8 [E6&D*l**+@-P@-H@4#S 0 > *0#S 05@)Ʝ%0A-@P` 0 P0:| 0pp ?R0@$aH00S$`=\+2}H*X*d*p6&%x*6&*|*f* &4M*<7p@-@0MS WPP P P ۍpV0S60S ?00P 60Si ] ""442hwhw004488<<HHLLwwwxx||ow9^EkwEhw:^EdwE""442""442T0ASꔈ<X< ` Pk PI lPdT0S40S xx姿00[XU R O!"441$40F""44"2"44"2"44"2"442(3(,0,T-TX*X\'\`$`+ 0# #100 0222#0 2 0 (0#(0/,0H0T0, X0/X0\ `0/`0d 0,d20i0005/(0, |2-02R0L " S" 0x30=00 2R # |00# #X0/80\ /`0d 0 %0L0<040h00S! #3 | t p1S 0SP! Da! AQ  ¾ 9-0CS    R0 R R 0N\ \0|Tt0- =09!m\*lT*x*p6&kd*"8 6&%i  #m8ZC-MB2P000R0 b 0M0 0S q쑟=聟0=P  RP 0AS^(\ =0ꄁp0W\hq P  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ0=ۍЍt0 h0P0`0\0S H,@긭**T*8**[*6&*O-AM30A(0 "S $U+p0(У͡0AC 5/0(0#R00 Q#00h2P00 (0S $1(#C5/0(0,0S3,00?0!P#0,0@ &P Aۍ<ЍP(0S +p0(У͡0AC5/0(0+p0#͡$0+ $  BRʠ0@SP (0S 1 P@0S& 0 $00S  B0S 8#R00SR 00S \0l 9P tlx3  P8P0S긩*T@*[*%+*d*\p6&w0 긭*@l@-@0SS긩*O-Mw0< 0 0 4   ؂@P0 80 0 @0 0H0@0LP0D`:PPP S  S  S;  S h0 `jp SK  S"  S<60S 00 Z(60S 6v0S -3P< 050S  9Ѝ50S P 0 L50S @@  00000%0p,Z0S40S  40S @ P 0 0 8%% V00 0 `40S T 0  30S  30S30S  ?VPS 0> V 0 0 8{%x%P30S` P [L 0 0#p00 020S  t20S620S PY 0 V 0 0 8.%+%20S 0 0 m"p00 0d 10S 403/ aa!TcV00 0@X10S00S 0 0 89600S  0 4\ 0 3/`V 4   0,` 긭*6&x* p6&t*l**%mnXn,*p*2E^W `@l`*0*Xop A-1(   0 !S@ 1 1R 4S8 !4|q04`|0`a@00S/ P0S  R+* RS-DP- !0 010000 QP 0PT0 $M #P ЍPB!0P;C0P|80S050 000 0 @ 00 0긩**T@** +@-Mxc0S llMhChS0S Y^P 0#00, R03 2r 0500K rP5"0C590C990C9000lP|n x0S \2d"`2Q09T09 <0S 420C90S 20tS|2"CC2P4Q 0R0%S P ʐ= Hs;#;S ;0``1 v0@%S ) <|0+C? R 0 0B 0S 喹\2P 00S )X_I 0STP=S 000Ѝx*p6&!*%* 6&*X*T**\*kT*Ih*H***T B|Wd*;Y**-@-  . ЍЍ/6&x07@-@0PS /P H0 < Ѝ0000S 0  Ѝ0@l*6&x*p6&|0p@-@PU 0P ێD 0<p000SP l*6&x*p6&p@-@T`P T0:pGP 0S 0@P꠩*p@-@PT0*p/P 0S 0@TP0@-@  10  xh+0 dP%0 P80 < 0@ ( *  *p@-P@P @0 4 0D !0R3 Qp謩*)6&A-Pp` Cề00CS0F@ T 00CS0F P yTnTyDo0 @00  0 0 S6&*@-@- T -L00S @P@0PЍ@Ѝ/6&|*E@R7@-P@00S#P ܍0  Ѝ0R00SPǍtt0 dX00SD D0P<$00S $ l*X6&x*Jp6&S@- @  P   P  P  l$P l Lx\0QX X ,p Hl@0R6&   , @ <aY i | 0@-@MPPPP<  P$0$ $-Ѝ0P   *0@- M@ \0 00C iY~6 ۍ p@-@0S g't00SPdUP 0@00 <p@04000Sp p@ l* 6&x* p6&A-/`~@P@Dp/Ѝ/SpPP 40 003P0000S@-@0S  0S 0 000h00S@ FPL <@04000S @  l* 6&x*1 p6&@-@0S 0 000d00S@ Pp 8@00s,00S @jA l* 6&x*X p6&@-@0S 0 000md00S@ _PB 8@00E,00S @<h l* 6&x* p6&C-0M.S4P@A`p0/SS M0 0U ! =  7        p  xX  d >00@ @(>Ѝp* W  v<      @- > A-`Axp@P` P P=00 S00ЍU00* @ i p@-BM @P`0E CR V i냋P☪0FS`0  BލpAS S}P0P S00@$N=|w*~  A-P@`9}<0 #p1}W =A* @-Mq2 BP= ̊ 0SP  1Pt=0R2PP p@|PP 001G0S8 0 00T10P0 Hap3W 010Q05 S:; S0,P!0P0  0P 0 P 0 Ѝ  _S-S xp00 0P0;C*G,  t=& *X* 0@-CM@P0,  0   >Cߍ0 *@- @ R200* @-$M0h ` yX  @PHpP$ЍPU D_0P< * p@- M0P P@ U >|4`  ( $ Ѝp *F -\M0 P:  \Ѝ RQ -CM0( ( Cߍ/   0`( "4`#/p@-`P70 R  @  0!S` X[< ˆ!>T0 d0 Dop*  p@-@PU U  0<Bk $;p@f}K    p6& P 7P P / //6 C ) -M M? }0ۍ Ѝp6&4`00CS`0X UX0 X /6&O-pQDMDЍO$}@x`pP !W200 u00020PS0C000@@ Rp@T3 W+X( U U P     f0 .Q     V` .0  p8M p Wp6&Z  *. 5*3<0S/@-@PMQ PЍ@ p31Q``xXu00CS갺p8hhh"T1PЍ@L H!0S SL   8d0AS& 0@(XHH) 0S0PЍ@脡$     0ⲇ1hS fS5004003001 200j0CS PЍ@=0(0<0$0;0 0:0090080070060 05004003001 2001jS$ $Q Q ( xVPЍ*g    W        O,O  O-@RP WL0S Gp4Gp W8*l% p@-P(@P Pp@ĺ%0S $  R RQ0 @- 8*@- (0 0$000 'ЍP P P.$@-(M0D #\S@3@#:@ (Ѝ  D7@-P|  x@P .@wPP @⛀PQ ,>r Ѝ08*8*0@-@QPM 41a! 4aDaS@$0d@Oo@@1e% 4eeT# ! "Q  R  P Q T%< ʨ @=,rЍ0%(T h \,%T @ 0!P" $ @ U8*ROL t0@-Q `.@!@@QR  08* 8*0s@-@ `R  n,P.vP ,q0S ,q|Ѝpp0 !PU U H 04Ѝp@!Ѝp@x%8*8*[@-@T T 4 0( ЍЍ@,Ѝ@c8*"!Q p@-P@ T p@<   p@0  p@5!O-TM0@0"00 p`0 @@@$(@oP PTЍ3PP60 @@oPtp@T:TЍOo0 EW y R@x   ;y0P `yK ,\100 0 S0C000  Q,4P 0` l0 0`f L` `VX`00CS`0X 0@X0 X m|x%6&@-00B Ѝ@-0  : ЍO-4 P@pa TAD -Q P P PPP@D`FRPP00SP Ѝ@-0@ 00 Ѝ@?@-q  6&@-Q@-AMQ M`@0Vp0d*aXQX!0TeL0P 0H40 FAލ ЍP00 ! !01 b?t0 A Y!R 0G?u@P҂8 8ɂ<T0 <H<@D@`0H0\ 2@ DDV(* W*ZD*w@-D*0@-6S Q  (*@-J ㌂㉂ㆂxヂpdm/ @P\" T@  @  4t,  @ 8*ſD*@-骂  6&@-0h@  0@ 0\0CS @Ct=&00S/p@-@8PU``p840#U:X 0rX0X00P4080 0X0p`P -7@-@0 P0]  0PR*0 B Ѝ0@Ѝ/O-dMPP @ T0D 0 S  dЍ`p | J ]  ^`: !0 0 0  70  ` .0 V0BP ۀJt=&RMC-@㸀帐`Pp@"!0# U 0 Ⳛpp pX4 ⩚-P@T0S0")P    Ѝ_h fWk-,ML0$0H00D00@0 0<0<  $$0  6&p-7@-颁`P`@ T@  R 0@   !000 Ѝ0@Ѝ/ሼ%*p@-PP@ 0S 0CS 23 0 0p>p@l h 0 00Sp  0 0p|) Up** A- (`p 0 lpЍ P 3.@P 0 PPlpЍAtt01Sh0h   0XXpX2` 0 0S D ` F P `A*%/ W_ A-@Q(p1S1S` W 1SQU(W1S WЍWx1x R QU ЍA <1ЍArW(= QU0S) S S U   %  U   WЍA    U  P  DD  ЍA *%/ p6&̕- qVlys4 0Q 000/ *%|A-JMxAM1Sh{ =p&r`0 `P# c40 0`kp0S JލЍ;X P0A7J. H00A1$L  $Hp`00P0 pPkp6 Li0S8b1!0 w * G-ptA `1S1SP V1S \$V1S V1G qV 0 I \  GV< \\0  嘠EPe0SVGx' 1S  ! Q 1S   0 G *p6&%/ JyBA-a M0\ SQR$SQ S0A oS 0 ? 1S AuSp1 RU\@E@PVT @" A  `*~p6&%/ J0@-P$M@0000 PPP0 ᯿0 p᩿hP 0S 0S0 0S  IP5&&t*@-M @ PDTۍ00 R  )P5t*H-p3M℃M`PPWZ@PlP @lP@ kP04lPV 7 P00S , P   PPi P thlP ,c[ w, PU,#nP0S gV! J1! 0"J P RB PQ p 0 pUxݾtJ|!|1h @ R$BP< p <T4S J P ἾpR>Ph 0R :CoP᫲ k > kP00 S5VPp0p tph0p Tt*'" 5'%'7tP/'@'Jd t'P'` a''(n''6&'O-MMp`;.pp P@@ p p p0Wıp0Z:0S ލЍ0 0W@P` @PLqLL?HxkP(1 ZpRV㟉 1Z SP 2pZ.pZP &pZ.20Sa00 0Z,0V9 Z-P pZ.X@)0T:Z^P oZ. |d/ edA=L(t*8 ('@-0` 0 0[PP 0 P@P[P Ѝp@%4(PP DЍpP 6 O-@-tM< 840ZPP呈tЍB0P(0 ( GpP"U  ᆽT T T;xTP0t4$0aT6P0X4XT$01P0H4HT$00SZPT(4T$0P04 0S0R0S00 0 0 (0@` 0 0@TF*303 03030#T0 Pً(0@`P@,@pW6*40S 0dS0ktDᅄ x  0`V pt  ;XN pl X `(um0P02R$0a 0BnS01 0<0S 08 S@ ?@0?D000S, 0竸S相0P ?hT0  4j JP 0L h?L 0Hh {H 00{'{O,0 0,0@0P00D0@ Bn| 001 0X0 p`?d 4 $;` p J?  4!; h$ p X0  0T0 {0h `0{'{Pʟ 0jh 0Pdh$0 pTY@q)))\)j)c)))cM))=*)**&*O*Wf**0SP0勤d4 00kS% Dp $0Xpg p $;`_ p} 0@U 04$;hS pq h0` XPɏ 0h 0ph$000@U  0`g$00$ 0P,0S0fd0kSㅤ7 q 0Xp p2 4``$; p( 0U 04h$;  p  $ A$X00 T0@ A { {'{> $PpǏ A~$0PU  A {0 {'{g 0g 0 gT0 Y@W***@-m +6&A-`@4pS  P;T0DPEE$UX hP00hP 0-< 0dP (3MDPE@D*e 5p@-P@Q0 m0 pohP @0S \`$Pp HZD 00< 0p R$N$(%&+n+P+[+ +++f+@-3800S ,0,0 p  &+&+X*O-MX M0S1 HpW-Q88Q8`@`(0 `0+ =P 0  0ۍ Ѝ0 000nS ?S aS ppS qS|0 | 0h 00L0@0 D&+(&++&+6&+ $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0兕00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊt=&p=&,+=+,+,+&+,PA-@@P@T +.@ P`p0SlAh0 @ P ,0< 8(0@A(%6 &+/ _P+ +,A-@PpP0@S`00|0 Rl % R 0L 0S @!P@`T !+X&+*+(%,x+[+f+P@--0 CP+ -P@--0 7P+` P@--0 +P+-P@- - 0 0 P+&++-P@- - 0 0 P+&++7-P@- - 0 0 qP+&++Z-Pp@-0AM 000 0@@Se-T1 PS" 0S00!CC;P 0S0{>PP 0T00aS`0 00S`0`0 C#;PaS` 0` 0R`0 0@0S0@T@ @0Q0 00S0p'-AލpP+--d+---X+T+G-1MMP,<4 1ݍЍP0$C:P 4@@0 YPZ30S Scs 5@PQ 03 cs@0S0S PU~\30S5 0P/ P30083  0(3S 3Q 0Q300?o2&Q20S 2 0[P0002@0 0R R00 R ?P 02D"000 H2 2Q T100?o2& Qy10Su 1@P0001@h, g0  QP0S0T*,PU Q 0S 0S0 0P+ 0! 00 0}00Q Q000?o2`&Q|00S h0 0P000<0PP+-- 0 0 0 0 [x+. 0 0 0 0 Px+.C-KM MP!+2 Kލ ЍP0`"C9P L2@@D2000,cP 2 0S@ 2 . gP0 aQq0S 0S 00 3@P .d1@0S t5PL1d 0P <1@-PAMM b*0 !@hPP0 K` pF S p0 0pppp0+7PAލЍ0S 0 `TP+&+?..x+. 0P/LyrP@-*0$ 00  0P+&+Z.c.n.Pp@-@P U?o20#pP `|P xwP )p0U0P0 <0D U,0 00RrLy&+~.0 @- 0.,&+P+P@-)(0 00S/0ڐP+X&+&+.0 @- 0.*+P+Pp@-1 R   1( @0PS 0 尐0S P )0 0p`Pp@P`0 t PP c5P80 @\0l+&+Ly.x&+ /86\&+P+r.0 @-E 0 /X&+P+0 @-; 0-/*+P+@-(@(0 0 00S0  \&+C/P+l+0 @- 0P/D&+P+P00P0SA- )0 !0ЍPAaq0S000+0S 0S1$000PP|P00tP ,R88`0H 0H<\04 P+`&+*+&+h/rLy*<&+a//0 @- 0/@&+P+0 @- 0/T&+P+P00P0Sp@- (0!0pP@/`P"P 00  00S00 P|0x0 0l p40P Tk400?o2$ S0 P+&+r*+*+0Ly/P00P0S@- S(0 ЍP 46P 0<Pd00}S`00S T0TV0H*P80 0 00( 0P+0W0X&+&+,0V0p+H+D+p@-0PP0000<9@Ppp hp@"P p@(2@ 0S80 000P+*+^0H+&+o00P00P0S@- 'P0 ЍP8 5P 0 P0 P+-0p+@-M P'H1 ЍP0! 5P 1@@k+P0P`p 0@PX+0@0 S0 0S SP |Pl0  Q 0S L0@=P000$0@P+.P0@8P00 ( !5PP+000p+0G-@`pFoᨂ@ _P 10S 1ЍG6Y('1 ЍYqP YP4Y! YUQR %8@P hPPPAD1 ЍG4^,1,qPPpP36U@000 0|#T#6U@ pV(PPP 0RPU`5|0 @0_P000X0 R#@0 K#m8T+&+0P+0110r12A- MP&2 ЍPO0S!j4P 0 1Cq^P 00|S 7P /P 0t]^l1@h@* PP!8Q@a@q@0S 00CS0S )0 0 S S 4P0^0 T0000^! "Q|00S p0 00P00D0@P+-1012X&+&+2=2p+P00P0S@- $0 ЍP h2P 0hpPL00}SH00S <0<劋00^P 0 P+2p2X&+&+E2o2p+A-MP`+ Mp@pET` AP+ MW+ M@0 ۍ6 5p+@-P($@0 ЍP(  2P  P+w2W@-P $@0 ЍP( 1P  P+22@-P#t0 ЍP 0SP 1P 0S0, 1PP+-2Hp@-PH@P#<0 p0P0 PpX&+P+22p@-0@L@SP#<0 p0P0 PpX&+P+22p@-PH@P#<0 p0P0 PpX&+P+22QoP@- x#(0 00Sh@+P+$&+2QoP@- a#H0 <@0S 0S ?P+$&+@-70P@-000P0S :#P0 ЍP@ 4v @P@$%Q ^P+21p@- M P#1 ЍpP! 0P 0#p`1`%0S@1D0 0S 1( eP&P0 0S 0@T 0&`Q@P Q d@ F0@ pL0 @ 0@3/H0T 00S00mp&P+2&+3303*) $&+I3@+!h+0 @- 0Y3\+P+0 @- 0f3*+P+PA-PPPPU㈀ "00Ppp@h0hP嚉00P0` 00LT,0PA LP+X+&+3=+,+P7@-A P000r00 Ѝ0PI"0P%0SʰP 0 00P00S@ 0 S  @P@00\+K0 S +<K4 0PP+T+&+3&+&+,+,+3P@- !0S000 005 0P !0 0@xP 0 0 00l00lePL0H0D0LYP 00 00 L&+P&+&+LyP+r3" 000 0@-S$000 0 X&+&+3P+&+000 0@-S$000 0 X&+&+3P+&+p@-@Pp@0 @- 03d+P+0 @-z 04`+P+PG-R@Pp Pt!ЍP`P? P< P`TP5 O-PT. I-@PP %%`. U(1$1@W 10SV U00@ $ $``PK0 0 S   V Up0l0@W T00S H0H 0DD S 8  4& .C8|&+&+X&+&+&+r&+Ly4K4 @-j0P+P@- |0 pP \00}ST00S H0H@P40 , 00$ 0P+4X&+&+44p+H+D+P00P0Ss@- 0 Ѝp0` 0S P@P :0Q R   L 0Ѝp@詇$Ѝp@{P+T+&+-x+444p@-P0@Pu $0 p00gPpX&+P+%5A-Pb 0$"0Ѝr0S 2 wP80S10S 1ia0@ ` I0崁S Cc!!b"  A   c# P0U0CtQ00CS0< P?00CS0@ P7,! .PS0p00 P0 b" R  c&0P UR PE 00P0 0 Sp(0L0 0 SP+++&+*5D&+d5?+?+/+6&Y555P00P00@-SM  0 0Ѝ0Pl  -P 0s)qpP@ 0 $0$U@00P+-&+5P00P00@-SM 0 0Ѝ0P k-P 0)qp L0@0P*4 0a0S 0000P+-&+5P@-Z$0 PLIP+56@- (0@kP0 @6꘹&+ 6P00P0SA-쀟 /00ЍP -P 0L0`P ?!PPP 0RPM@M@@E. pH H~H zH00P+-126 P00P0O-SM  0 ЍP  ,P @P@ 0R@Mp`.|0 `@P0pH0 Р00000@@0 YP+-12l+x+X&+-.Pp@- 0 0p`@PP P P@{*p0 ` S Pr@@ @00 0(e0P+;6[ B6&+J6*+*+f6A-p`P} @Pd0 `AMP n00-4 RU0 A8&+6X&+6A- PP   R ЍA0P   R  @0S00Ѝ@`pP+%&+W6A-0p`P0 A P& Pp@P @AP 00 00P+&+66p@-PT@PH0 p<00S00p@(0 0PpX&+P+T+&+67p@-0@p@SP`0 pT00SH0p@@܄0P0,PpX&+P+T+&+ 777<7p@- @x@RPh0 p\ RP0p@H嵄 P0 ,Pp X&+P+T+&+D7q7y7O-MMPQ t3 ٍЍP0# CS+P 3S`@pX 3 |O 5PP@P)F0t'` P00S 0P @B0S000p@I2H2@0SP$S \S00P" 0   0 #" P00B   BR 0 D )bF0 K@0SPiR0PS 0 D)bF0K@P1h1 0S x10SL1h`10S ,000CS0. N  dF0 03/00S 0S 000CS0 S0  )tCF00000i0 X 0`S8 P+Y5++?+&+8@+t=&&+33$&+I3X&+&+,&+@-@P 00P 00Py00p0- lM  X00S YH d0* P000p 0&+ &+8&+*-lMT00S XD d0  P,00p  &+9&+*A-@JP `p0 0C0SQ3  cKPP 0 B RQP 4 0 0C0SP3 p@-P`@:}JP +- 0S1PS !|!-pp@-+`i)P %`JP008  -S!0R 9=L)9p@-@P 00PU kJ ?WPp00p@-@0`PP<p90 .10Sp 0h R00, Ѝ0 0S0C B RQ"  *+49P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  Bt=&G-`P(P @ JP  |JPU0 00I P0 10S / IPe U*P@IP 0pS42  PpF*:PIP p>*P :IPQ p000 SPz0S 00S1 @RđU|0 yh  JP0 0 U *** 0 011 Z0Ѝ @p) PBD 0S000)0S 0PS S St0 0S 0`S@)H0pW ),pM9|9U9*+9998&+"O 4&+W - BR0 R  P R O-!M M@0 P<@8@4@@0D@@@IPm4`0 p 0S 0S 40S 0S LԤ@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /$VpTKX`V C5PUp@ @l0S ; V@P dfP XaP H\P8劤0 ᅤ000@0)@P4_HP 4@P@ )44:THP 00)<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU CPPP @ @ PpW CpPp3 Q  `3 %V+ C=0 080 S( , (#(0 00 0$)"00 0R S"  c`pPR  0(0P Z , ]0%T00S9 llX% 0S1  + B=0 0 0(00$@0S0S20}S$ @/GP00Y@VN 0SK U +HB$+HKB+HGBH` D+uB=0P 00$Q$`(0 A `00+SaB=0  0`0@@DcT@@0P/TP0,00(S  R[@p|9<9!O @&+9999:*+.:$&+H&+95:~ p+P+6&\:.l&+D&+.08h&+O-iM M8hLdlOpt͍40,xHD@|0 0PH0.600K/p% ,A'@0'4QD'8aO?ⰐV=La少H'TU01p 0S `PP ʢd0sh0sl0sp0s0S t0s tU 0S V|V?0S @'?0S0 /TP1'.'`?0S 00SV4 ^ 0 0 .=0S ~P' Vi<, )0S  ~Or)P$.>M0 0 b)00 QLQT /=0S-=p R* 8p p$p0p-0 RxOP;0 00|S -Dh0S;0x IdM P< <= 埢`DX[,@H;P0S000  V$ \:+ 0S 00S O0Py 0Sv {&ܪpE PPP 0S :t;a;>:>U>o>vZ %>[>h%t=&>P@>>>>> ->+?3?V?j?p?@???1?@2@x+X&+o@+}@A $w @a @*+@@AAA?Al+|&+@B*LALnA\&+x&+0&+Ap&+h&+PA P[ 0*S0 ⋞Q0P0-SL 0Q $0C 00 S$0 0=0 0/R8 *R0 g0Qp80+000S&!0 0o5P 0, sL0QOLs_P 010SsHXP "PxzP uP @mP8T~V ᗿUnZb Z000TP OP P ~ "<BPY Y V` lT fdU#0K/IR032 U 0S|#0 0up#2S ޝT$V > $4Y0SK?0 0T| V '$3 }SK=|<4 夝T0SJ40C $ 00 00Q$00S00{s<0Q 0 00& t50S0|05y80sw58p00 RQ 70S50>XpT6 Rd(6(&((M6R P L6(F! 686`l0Əs l/0l0<@T? V  )%PJJO0 0 Ż 2 R@ =O0"0C?o2? 6O ""0A08ͺ-000 R ;R @6JP t000 R RT 0S>0S(0?'"( ,0".0S ?0.T0.͡@!͡!..R0n"0R0.͡ 0$PP#PP0S0Sx80S#PP qB(H000.R0@D0$ .0 pwx'xT PPT p\ XNX\ P #P U d T R|90S p90St9pyP $B0S @DT90S YpF1!0S   PZ0S= S E#4: 4:` T00R0SC rPqJ  )$P  [IP Ub d:0Sd: P _** ϠP 0; R# A 8;R.sr ZOR.Q!03/Pp;@ ; R0;KUdh lp#0S,0< 0R.K }><0S 000S 000S 000S 00|iލ Ѝ0S 03/0S ټ00s@- P@@P  @P0P 2Ѝp%`P  ?P 0 FUpP Ѝp@@ 0S S0S $ ?0PPM999|9A7@-M0h 00P P10S 0S00 0 Ѝ  qQa @T0 S 00S 0s 0 :>P 0 S000Bp@T h#HP 0|S 900 0S00 0000*+$&+$ **+h&+@-$M`p P90000000L@>0P/S:S y@PxQ@VP $ЍU>P @9 G9 v90/0KPP":KpPp@P /000 09@P000`0@@DcT@@00@0CcS1S@B8P+!O C89PP00/@-jL,0 @ ' 000_L@0&+*@-YLx0 @ d00S X0X0 p <0000S ;L@0&+ &+&+X*@-2L@`00S T0T0 p 8 10 10S L@ &+&+X*l0 @- X00S L0L0 p 00 1010000&+ &+&+X*Jtp uTЍ ?$0000  PPJ0S J0#S@DT|0S ph@"\F>$0 V `|#L"0 0 "@Bp&+&+O-BMMV@@ Aulp?0a>0 @@0P86 p`P,6P<N6  BR L5 P(50S5V % 0U =0WU S00G00S(+ #7 0S+ 0 S( Z000[9  BR $5PP00CS0 0 E= @P00CS0 뤴00 0 {P8$ ap0,TS (400  00BލЍ4@@30S VW@@c3!l=3 0p330S' U U# cT$30 CRKH3000+ [)[00E @0A>V0 `W4$2 22 =U[2000 t"00K 1#T0V CR@U-[ 0S02   00 020 CRUT<10S@d@60 @S405  [ [P [ 10SʶU50F?o20S d10SX1p10S} U T U00T0SyT} dT([@ 0S10S 3/1V0    0ZR\@\ 0YS P 9/ 10 XS P 8/0F*Ъ l P+*+++X&+*+&+++++թ*+l jBh+t=&P+?&+-A-` @T 峖0 ЍAЍ/p00$  PxsU<l0 h Co0S@ LP 5/++BP+*Ъ L*+2O-FMs M`@  @]G YG 0UG0$0`3$ 0(00,@(U0P SH:0 P3 Fލ ЍVT0 @,Q(552@@Ȳ@aGT  22  GT 0 PD0P|2d IP `"`d5T 50S 00S ,, 0d K PP dԳ@0S00?o 2hP. $G06T6D01@ @>p l ᬳ41  D0(66S0d000 d0gAaa0PS 崕P bP ^00S t0 |0'P@ 0 @00h,@0?+&+BP+P+X&+Q=9&+ ==+B++++B CO-JM WMsn0p0FXv600S00p 9 P'X6   60 9PXJލЍD60 0000 97S 60Sa 6 qd0050S# 䵟0S5 Q S 5R "P 0S 500CS\5|gq00l;0S P97S, 5D 58%8(0S 500CSX0$000(00000 PN 40000S40܀C XSX @4000C 0h00d0$ 0`0 P@ CP 38w!>\ 0h0d<` ((0#$0#c# $c4"$( <7$("", &R h3U0 R0S R3""4408'0P 2X0097S0000 0 0S  |0 p8'P820 00$0 0  E pP 087zP0 97R` S㸁 0S [10S/ 0S+0,< 00 00,1 GP8!81 R  x 0 ) 1Z&P 0S 0097S;70:70?70>7='<0S P0s00UX0 0Su [X  T*L&+d&+*++C*+P&+&+xC&+$&+&+*+X&+GCP+LCsCC++5KD+VDCCC+D+dDDDDD E 2@-`pBWLM LЍ@" pPk  pe 00011 0S<0 |q?!((00 Q 00SZ=9Q ='/@#b?!"/p8|E0S xE0#S 0(60 8wpp hE0S dE0#S d pVp 90S0 000 0jLЍP4 F00L&+d&+*+MbbE*EE"EA-0H`D0 82V p R R B`R RB`b2 Q  ,100EoE?AA?R1 $!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 P@`4`$\4Q00P4@T D40S@ 440S@@$40SPp40S3mf3 3m$Ѝ030SCP LPDhE `3 0 HvP@-}&/0003 & dP@#R000 00 0HGP  t?P h@P  H 2@2>,20P S R0S S @T% 1Ao0S3 1o10S 1 VP5>4R P w3C#<0s <30SP 30S 20S2P30SBr, 00CS0~,p`X VmUP I0CS,0#p,000q002P001!P 喬40S 40,3/0,0@0g0@:1 R0>P@0 SR1#dU40 ? 0!$$P000@ U$,00@ T000@ 0 @0 0 0 070 0 0 z, 0`$\0 ##8T< P,0S 40,3/0x&+p+p&++\&+X&+&+&+jFF+++*+ 6&x+--/<P+d&+41\IA0FVF.` p+5*+Fx +F+l+&+FF@-EM h,$ `@_X, 00L,(0,0D@PD04<@@P@$<$00< 004;o<<0S?;0SW 0004 8 + R<00S0 @0PKPN,1S4$ ;P $00|S $0P$/"?@?0SR ?0 SN $ z); (1RS ,1S $00-S0S : :$ <0S $ Eߍ0S|: 40st80su\JP0000So,0Ss9 9 9T$ 9R P90S ?0 S $P$00$0T $/00j?0 S$P$T H90S<<9Q0SPPP=<0S!0S' Q+80S N(P  H8(|80sS|;8  t/Pq00S  L$Pf@S,,0SP 7 7 R0S]P,1SC$ :P!7(0P7,! L7 (0xp(0Zp 0: S '00'0l7 R,`7`'``|<$00|S @8$((0S$_|6,! x6 600$ ((0S6$6R P խ6F60SP 50S 50S5P60S~ 0CS0<0S 5  (p(I6Q$,0%p,0(0q(05P001!PL]>0 SE4800S 00(3/0(0,,D0S4 S<Q  p40S 0 4R\ qp} Xb%$&X0p0pq,4P@$P  0 e尩P$l媩<0S t0 0 @( 0@wP` T0 00( 0jPwdsl( 00CS0(pk P @`( 0@#dU10 ? 0!$0 S0  , 000CS0 ,@ T @0S  @(>!, 0@(00@ U>,00@ =0 SG1(00@8 ~( T!000t, 00CS0,@p@ TD00P |  `f@</00<pP 0l@  f@-n7@Oj7@p@-Bd00` pd00CS01"p ,P P00 @R0S"P8Qd`d00CS0+ p "P \Pd00CS0p000S 8A0QPA p0 0 `Vp0 Pc`d00CS0p 0@S P,P \Pd00CS0p `V0 0 1Pp@+t%eN+A-@lp`nP@ .(PP d@P PE ;)P@OoB@+O-(UmM0S p EPd 60S Bmߍ 0.1dPP0͵H(4P'0P0S SUpG Ph4P PP P0CS    p- P P P0 PsdLj1P P b1P d0p P 0? h ddp P 0S d0p P0? p P 0S{0S df0 P P d00CS0p\2\,` P Q4280 0 dAQ 00 p1@S P0S!   Cb"c!   c# 0\S81Pd00CS0pp0 dL\0`0 p P`, ^0!S^0C0 d=PXX &++~N?+WP+LNNN&+O*59Ot=&/+?+OiO&+++0@- @0SP  'P 0  00@|0  pͥPX0 PĥP40  0ụP0  t=&O77T+O_O - BR0 R  P R 1A-0aS0P0P3U &P 00.S Ppd1ldP S'X1@P L0 K'P1T4!4!00,1 $$ !U 0 ! A0q000 00000P0 0 0pS0000PTl0l0  @U x4 P$0`^*+X&+%5O,+++&+OO&+)H+L++ - +,T+&+7 OOp@-@P | 00t 00l lP0h @Q0T0 L0P@D0@ 80@0S, 0p++$&+L+H+@+*+d&+&+&+&+++P0 @- <00S 0000 p 0&+ &+&+X*+A-@(4Qp0S `0S p 700`P-00000S t`0S p r0000<0uT $ 43p$&+++d&+h+APO-P"2 AM MR0xB p" R S4 P D04 S` 4S4P  $Aލ Ѝ4Sg1+n ;004P/S +/ ++ fP5ꐡ圼pU0儑p 00g000000000S L1oJ<12$1 R100CcSppW100S 0o- 000000x⢽4SU00$DPPTy $P00*+X&+T+P+&+PQ,+Q++QPQcQ{Q@-0(@( 2өP(+QQA-`P㲢`p㮢T :@P @ 4@P, .@㚢QQR@-@PH+0 A- 0@0PS0p`0밀P" #P 0S 0"S0 R S  p`"R"^ 0 00D+*+X&+P+rH+++0@-M M P  ^@,Pۍ Ѝ0PlK4/S# @ P;0@TP/PT RO-@pP`W 1@@Pp3:,pF ,谟`0X1 0O#`T@10 10S 0 SY B0[ Q0.#0S*00 0-0 Ѝ+&+@-=1P0P0 @p pP0 0SP0 0*1@Ѝ&+ht@+P  R @-m Rx000 0R/`0000/0S < S0C00S/ S/0C&+|&+@R&+&+0@-0 00% k0S# R 0S0000S b0C("( R S 0     @    ,  8 Ѝ t=&p=&@-`$A0S0 0 0 0!0Ѻp 0S:S50P0S0 0 00 0Ṻp0S:S5000l d0TᢺpT000 $0$ᖺp(Ѝp*+jR*+RRRC-@㌐pA\`\P ^T1:00"\ \ L 9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR0%R0PMU20S2 2"0S0 CG0Q .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10N[0N B B0 ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0S P^*0SPZ*@PL0G RX QP 0TJ*0/SE*0< RS=*09 S  7*+0S2*> @ S,*0 0 0GS$0P(0&$&+P+@+WD+H+/A-p`P @}P0  T  `00T   !0@ R   `FVp`00CS0 X PpTD000`000 T00RR6&SC-Pp` 0崐@T%Y  00)a@x0@P`0 \hL0L 0 P 0 Ѝ@+?&+S7S6&=SGS&+&+G-M@ `4P 00T 83 `P0P #Tj  f30S+  `Q `V` Ჸp.0E. @00002/P El"l?}.E@Xލ pp`,0T $ cp Tq010@S  ⌸ 0$ 0/ 0$ MpOE.0$S*F>C0S  qX4 `$Q(00SZ=9Q =(/@#b?!"/0 0p4.0S .0#S Z.0AS  T0 0000 0%p 0S -0- 0 pwP0T P-<009*+XSҥkSS*+MbQ= p@-@Pp@꿶p@-@PP`(P <(Pp0SpWp}HB S@-@ቚP S@-VxPT@-@oxp ATP@-PbTT@-0lMPQ@00 00 T  40S P 00 P 0 0 0 PACcpW' 30S .@+@@ `P  P g`@PJ P z0S 8 0000P P02 "2 PP ?00 @T  + P 00 0@T  +P !lЍP 0S :@P@E  +  P@ +T T0S @P@& o+0S @P@ a+Tw 11@T 0 0P`pV'PP)L000p 00 0PhQ XP@*+L7*+&+`&+w1TT6&GSP+T1111@+&+$&+++?+K=@+&+&+H+D+7@-Pa1 Ѝ0Q0S 1 1JPʄ! 70 CRhA R S0T!L1P 0S4n,!S hP 0S 10S 0 0@ @0@0 @0 @0 @0 @0 00S 0 UP+$&+P+T&+`&+<&+*+U4&+X&+"U` ++IU+++SU++ ++njx+t+H&+00S#@-0M@, l*0 eP0S8qy@0Ѝ0@@&+--A-2*<00(0`F@|*+Mb&+M0@-S`p@  P;0* 000(0/(0S,,0S)  P 0PPEUPG )00 00 0 Ѝ0 00 0P (0S,0S 0S`Z0 0PUPP"P !0 S@-p`P @P,0S T000(0 ЍT000@ R   `FV 0P 0 ST(000(0T00RRZU/@-),\+<0!R/P(0<18C8S/˴10/\+%U3@-CM000030S3@TCߍC((lP ((HB<#1S4!(R< 03/3CPQ2?$`P0R0A@SB-R@@P; Rbp vP7@00S 00,S 00S0 `10 3/P00000S0S 11 03/0S10005}p0 0P 0 SKn000 #PTq0 0P0 S/$R0000S 00,S 00 S00S 0 xp 103/P  (000ft0 h 000`+<+d+6 \+UB%T+%UX++&UU!S^+ 0'+@-' 0 : +@-/ 0+d+P `00CS`0p S00 P0S X0X /Xݴ6&C-@Pp  l18C8S t`  0S  0k`V $ Ѝ+%+Ud+@-@'' p( P@ ۻP @'|'Ѝw't'X0/LA' P00R,$R VV%6&LV"V0s@- @匰1`8C8S P0S  |L x@0 ⑰0nS Ѝp+%Q+X+-V@-PM\P t P H00S@0\A PЍ @YPԲ6@?V+%EVV@0@-@hT ῲ!@E h+YV^VD0@-|AT 0S 6 0 h %+@07@-PLA/~&00 0P Ѝ0% @-@0S S S 0\ \ \R@ R0 RG-@P ? 뤀   ?  p ? t@` QQT@D0 DЍG? s0A@T*Q!s00%gV5VG-AMMP`PB|R p2 h2h 㗯\2\ 㰯 0 0 0 0 夯 0R  0 S"t;9&@D`IPpᨡ0S1  ク10S0 0SR'@@T  OT H7?D1< ȠLȠ\  P0 [!51 6%jAލЍP0S S  S0 0< ȠLȠ\ ឱp 0圠0CZ  Z <>0 @+++++p++d+: tV%V++pV0@-EM,P P @P>Eߍ0 ,PP    %x0 <  %ڹTP9 >VVVV: %V3O-PM ㈓@p|埮`t`^%h#X3X 㮮UPE!e4S`00CS0'x p00R0 SjP!18C8S: `&eP22l18C8S  {깏0 0P`1 P8C8S 0 ` 0 = P\S,18C8S 0 ` 0 S 18C8S <18C8S ᪰l18C8S 00p1 1 RJX1P+  V ,118C8S WpG(ՐP`$<18C8S0  ЍS R   RNP0 UA0QLLD=++: ++p+%+pV++++VVWp@-BMd,@P4P1 H壭d$a$,! 1  㲭 PP{=`1;P551d dnPPTۍЍ0@ʭD 5 c4  ۍЍ0q+Wd+WWWWp@-llP =@PpTTsPp@8@壭@P`ۍp@mT l!5(B(R< <  4 +ۍpq+Xd+ XW%$X,XIX@-,L6&YO-P4M$ 5`u`~=@P`0 `4$$p0Z$ dQ Y  Q$0 P$0404J!G!tD!hA! 0X$X垬P0PH} p@z <㕗U, U$$t @DOo0B$10<13 B0lS010S 0P  RK wtS)`S FSI (9S /S 00C 6&`a0CSX $W X $W X (Y $W X $W $W $W 8X $W W X X $W $W |X Y hES 0ScTPS2PNPy IPc DPPO 2 PqBd2l@ PV T  PR $@P/ ,2!00(1 1 0 0!0S1/ P @9,00!0 ሡ0 0,P p巴41 U PUP 00  0@@@P0 T0@0?o2@P0SVP%4ЍX+l+++%]/&+(] <++ +b M]+R]a]p6&eq %+k]6&YL-\Q\Ss\\> \\] @- +@-@M h  \0P0 H00@10S  10S0S@ЍP  00S<0@P܋0 00SA0S 700[P0P@0 S0900 ㏪LZ ++ ++5 t A-U0S7P@@PN|%0P /Q4 ` ؁`PPeDpMHu0S+ <5 45 @,5 (5 5 R- 5+ 400000@T ,P004@Ѝ0400/S@P v v vlhvm㯨Xrm 0SNQd0S p=0c sp;0c0S000S :  0P0R0 P T3Q |30St  l: $\3P0S 2Q P eo2: @~P2  : vP2 l!: nP2  : fP2  : ^Px2 !: VtPX2 ,!: NXP82  P1 !: 6P1 !: .P1 !: &P1 !: P1  : P\1  "1 R|! x1 Rp! l1Q `&\1Q P L1Q @<1Q 0,A,  p00A p00@ p 00+]]]%%l+X+D++<++@+]^]]T7^4^+O^+ hz% Ch^&uu [   +(+%4+%8+0+$+k^,+, +n^V+.+@-E(P( @k g_6&}^^ @-0S èΨ+tT@-00CS0 p0 00S006&+@-@PP6 ϱ+ + +0@-M0Q@00 0 [ ┱P 0 @P00CS0p0  |h00S0@oЍ00 0 P 0S*000+tc 56&0Aq P/P//00@-^@\P R NQ | 0\ P0\R@ @ 0$R ^ ?+^PP<0  dÅe"ÅP^ @?d" ef"/++A-|˨x@xPx`xp 0TS 0T `0h2SlḨ T 0T 0* ᮨ @^%%^^+0@-4M@Ply✇⬇ 0<, p"lR < 0 2  8-C8 S  0"!8( 0B(0R><r> 04Ѝ0+%@-`0S@ ߥP 0S 0000q20\@囈+^F 07@-l000Ph@ R R l  R  P4203/ Ѝ0Q P%+%5p@-` A Q1S 0SP AP00p000P P0 P0 xP hh ᝨ\0L@L  "  \ p%+e q ^6&t%!+00@-18C8S 0P m%(+,0@- $@.0@ F+p++p@-BM` <P@0 S`0018C8ST01y0 [0Pn00x0 BߍpB/ BR 000P y0001+%(++ 0?o2 0/%@-AM R  b000000@00  ߤPڶ0 q ҤP 0SS WS BSr0 +⿤P  5Ts0S ( 10S0 p@W 〤18C8S ؀0S R      |P W 0@^S00CS00  S00 P0S!+dj +p++%(+p@-PH@P@p{P P tP @% 0/@-Ĥo/A-@PP" p00CS"\o o o o o o o o `V EPP\XP0 P00TA3 0S P0000 !0S0R 00 __A-PA00C!SaXp ` 0000CSPHq p q q q q q q `00CS`0p S X0 X 0 "S  0S`00CS`0p SX0 X ! X!d0 0P0 P 000 d0"S00HAY340 0P0 ,+6&5_@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 _G-@|aP2 pqp =`P` PP2 00PF 0P L9 V @P @0S@0S200@'PP? P PPP P 0!SPG& _u ,+%A-M@PP\1  Ҥ @P `p崀  gPIu00u0ۍ0 P 0@ 0000S    P00 Z%`+`p@-`@.PP 0 8Hp(PB@pu s@-@P` P  R  @T|äЍp(R( dQ0P P @O P ,K P +f@`xt yt a0+0@-M@@0(@,0 0 ά@P Ѝ00,x0 PPP P0S 00@SPw 0+%+@-d(,ⱬ$a0+@- @t nlP   庡0P3P x;t9h P\ 㧡ق CաЍ+xt yt AaGaJaaaf@a0@-4MP4PX 1<18C8S  A6  0 9 0p媂P oDR<P8 g0E, Rq  \ X;P! 71PP ヂ0(0S$4Ѝ0=Rȣ00ESz z z z z z t弣h庣`\XT H嬣L%a+p6&aaa0+!aO Y!aaaa0@-  @3+-@-0 R   ЍЍ/\+-@-%-@-af0 R   ЍЍ/\+A-ARp`P@1T РpPH`@DO-dM@Pʄ0P0Ä0P0 0 8p800,@(P40@0`@P p0p,0SX ,0S5TX L @@[ X  ( 0 0 ( (cpkP T+,0o0,00娂00T񟗾@~ ~ $ P p     , 8 H l ( ( Q 0S0$S墆堆0S  dЍE3 P ( 0C,0M@@ ( QQ , 0C@( ,0u( Qh 0C@( ,0j( 0C`@( ,0bV@_ ( `F  ( 0C`@( ,0R( 0C@d( ,0JV@F @C ( Q @0C( ,0; @8 ( Q @` @0V @,T"80(2P6 <(/30S!꬀   ( ( 8 R0 X (b0R040880P(9[8 8 (b0R  $0 1M  $0 P Hx8 Pß0000S(U9@SX (  P0C S,0( X@S( Pl0C,00 S( Lb(bbCb`b\+zbbbbbbbcc>cVcfcccO-lM($ ,P)PU`` 8@ p0 B 0<02 @02 @0` 00J@P h ZX@` L`@0S( P ?=@$0 lЍH?@` ,00 S @.  C< 860ЍC}0% dP p  0 0!00 0  0S0S`-#P``1vL 0S 0` P V P z{ RK^R\pPS ^Px!1Z[ d 0)?&[Ȝp`4 0S!P !000v⺞ P: v?b  0S -v⧜pPvu(P-Kᬜ 0S᧜p<b\+%ddendd(bd ee1eGelee/ e6&0 R R /0@-@P0R0 APCU 0APLU aC\ACP 0^0\0R0 00@- @P@@ R!P X/IP00S D00S 80 &/"I#PM[7p+!,+%@-J@-Pp@-P@d~p 000/+p@-P@0-S@@p IP0Tpp0p@-@0@MS`P0 @   P@ЍpPU P$ 00P%+f,9 @-@P @100S@ +p@-@PPp00Spp@m+A-p `P@P000 P P0 0f W@-@P P0P00S@+@-`qdMPU> 0S; ZP2 @@?T/  a`00 @ C @  I00 *S 0 000?0`?ZP10#H H>P  dЍgd 0@-$M8P0S 0@@$Ѝ0%0 0/+0 R+A-@0QS`0@S` 0 -R  UR +R  >Q @n?y0:S f?q0cS .S bS S@ @0,S@pS wS0 SP,  KP 30xPz@Pv@Pr@P0 0  SxPPPP  PPPP lP ^Wi++ +,+hi+h6imixi`%X+ii\+BiIiRit=&Wi]icihi 0/+ @- 01SP R t0 T!WP R HHur@08 0 @"P 0+i`+3/ i 0S 0S 0S 0S P////// 0S# @-@PPPR0 `0aR R S R0/0 R /!0 R0S //@- @P 4 0#-?00&3?=0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0P@\@P0 PP@@+A-P` @Pt pP `P @P  @A( @#tT Cnn%n-n:n$np@-Pl@P XPpHPpp@U p@PpHnD O-MM`p 0@P  P0: SXҐsX  }RP $ ☫@P> ލЍ R R R00 P@ P PP @ PP 0"SU T 0S0C0ʡ 6/ ?RP 0mS PUnp%xnin\%qnP P / 9+s@-@P`# " 00 B0ЍpA-@<`Pp R 0S 0p@~n@-P`( p@0` G Ѝ+@-`@ (8R808Ѝ< 0 CS  8 0C 8++p@-`Q@PRpP0S  $0Sp p@0S S D0V@ ` 0V, ͏U  p@Ə\%5inqn~n(0 ((((8 0 ( /+\%0 ( (( 0 ( /+\%C-@z`p0S Ѝ @oP0S 0S 0 ( ((089P 0 PP 0++7@-P@@@@@00S Ѝ0 7P+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08n9 80 8 00S08`9+0+@-0AM0 08S0Ѝ0S 0SP8 (0S8p0`00 0C?VRh B(08 80C 8 0 CS ڤ 0`+0+@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00+0+s@-@8 R  0R0` (0 RP08 80 8880S Ѝp0CR80S  00Sʵ808+0+p@-p@XU N8PE``VH0 (  p8Soppp+\%(080S @-/+p@-D@0S PX*8 P 0( pp+\%p@-`xP@l0 R(0p0CR0R:(0 ( ip00+\%7@-@@P@P  AP Ѝ00P$ /+0S/0G-P0`Sp@U @0pP0 @@@ X P00pp @ P00!,P R/-@-4@$P(0,0P $8  +\%7O-P0GS` 8(hS?Pp $8SDG(R008(h8! 0S0S ] Ѝ0S08R00(hjP08 0h88S 08 ЍO`0F?o2P0S `&0 S PpP0@S D h  x t t t eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)$h0V48H"3P( 圓R( B( (( WPV  xPPl;DkH80S 48PS8P o088E80X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 00PJ``` P Q`*ZXP@$ 0P+++\%+n!O pC-0 M !0@P 0 0 B R   0.S 3 `! P`4HP X7 Ѝp0 P`000C/0 !GP00+n0(8R/+0$P00 /+00S/  |+l O-MⰑpW]$ 00! 0U R`PQ P~jX@0QSQ0Z00I@P9 p P 0: Sp a P)d0 R'0 X&  @X K  0G0  x*knnЍP00p|+\%@!,nUn5p xn800S ,00S 00Co//+++p@-|PPF@T p@``mT0S S VS 7Sg@ @+p@-@0S00S 00SI8P 0p@qp  00S Rppp0P@ ^P0PL0@p<< SP@ ]%l",+++",+@-4=@>4G-@ ePT0嘀0  0`0p 00ST V0 000S T28 ++40,A-pP1 @0000`  (P0;0 A' 2 A0  PP    P $5X A*+np@-|@Pp$R0%S!S0C Sp S} , 0C SnL  7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP l0S0pnp0 p@Z0 00Sp p@B0!S $P l$t00Sp$dP`p@&L00Sp7D00`Vp(\' p@4p++|+nWnnp@-P(0`@p@L+A-`P0@@@p0P/00,0S W HT T 00A* ~+@a n+9 p@-MA0 70000\0  b0  ]0  X0 S0  N0  I`P0S1 0 Ї;PU0 D<<080 Ѝp+nnnnoooo!O 9+@- 0@%0PiP/+< S /@- 00@4 Ѝ%"o@-@r0 @ +|0p@-@M@T 0S P0`P V@Ѝp`F0PS +@-@D( 000@S 0+@-@@P@-@G-04B-0,2凋0$r0?0@Me`00S0S  A10S x0S 0S45L0P P (2oP`0S P 1_P 0SV80S! p62O80SeV|Z0SP0S[ /S TS S S U U"*8=P d2Z 0S B:1! "1+++40,t+l",+2oT$+Poho!,%%+~o>T<",!, ",5!, +wfx",!,%oo|+oo% +opp%p*oW8p8",DpTp+7S< iS0S P0 P P P 00K`P iV 0FcS񟗘p $ D 4 D D $ 0   p $ X P t t l ` 4 T @ x  t $ P 4 X d 00E.U S``ydP ePeP= Q0S`Ec 0SP0@_U0b ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  {@0#0P MP 0 a0CS00 0`/P  ` 00P 0Sa0@S @P000S =V!P 2,00 @0S 0|$ {-P 0S.P ,Ta0ES000,P ,0 /UPnUU0ESf0 p *U( @U6 !U[ Pq 0S US'T60S# PP pf0SLW960S 60S0 97R0<  K60S07S ;07S 00,'#ل|C/K10@S @0007S9 :<#0CScP A=P 0 j0S e`q0 S (0!R0*?0I$80S { n0 S h(0!R0*?0/ !R00 !ı#80S!R0Q !R0 0!ı 9 09 !R00 !ı\90S!R0)!R0 0!ı !R0*?090S 90S `0 S 08:0S y0 S 0  "n H8L!LjR00 !00<0S0 !0<00 eSd0C0<0S 0d !0<0~<1yP0rP0~i0S 0!ıT; [5 /U;0S0SPl <@ $<D ,<H  P 2;!W?P@!R0 0!ıPH &,P P !R0>>0i?Pd!R0 0!ıP& !R0>>0Q!R0 0!ı?`P,E kP ?qp X? !R0 0!ı?`P+!R0 0!ıP h?`PI P 0`0,`IP>)P 00,00 &20S?"V 40 PP U U ?V"R0 <>P|P U U +"B0 PlP U U J"10S %PXPs U U.P!0Pl`!` %(P0` !R0L1 0S<10գ?0/0 $!0 S00C00 C!R00 0S00գ?0/0 000 00iS #h0 :P00S08029|+% -aplpyppp",0+++6 h",00S/+p@-@/!PbpO-S`MPp`}`@ pP Z:T8 00"1 0T S@D0X0@D@Ѝ0  0c80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 60P R* 0;0P   80 eP f [0J0C+0   /G-pȀWY+p S@0, @PPP ZPPE0S`0S P B 0 0R R@0`pp@-`R P@ c0P @@@ 0ppM-@Mp @900PC  RT0Ѝ `? `m>P ?0? `P>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#8 0 !,++A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ#0 DPzdP fPP Q gR 0S 0R   R E0 i!,++@- @ @4+ @-P@,4+p @-P@{,8+pG-(2pW pЍ}PP) P0`}pb@P 0pqpc }}? SZ c0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Ul 5 P @U(X0jP+|+<+pp@-`l@PP<J,<0SV@` `<D IP+p4+p 0 4+ 0 4+7@-`P@ PP 0S  P Ѝ04+Po/@- + Ѝ5A-`QpP P P@P%U0P 0 P l @bT @P 6/PbqCn,q@-~x 0pl ll0P \ \D0P P<0P@04 4 %%4q FqVq gqtqqqqqP1C-M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@+++G-@M`0PSS003 @ R S0\R% :R R D Z Pp P0H3/0S@@ R0Ѝ P/@-*p S( x* bЍ00S @  h g*\0PT T O( 84qp q5!,qqqG-@P` pppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(V0p  S XP0F@ @%%p@-@QP 20S R SppQ0 QA QR P/@ PRP/p@-`9 PPp@p>p@, 0@-M + x@sr  ) PP  000Ѝ0++400S/@-$@P P@!,+@-@P  +P/ @-p@''0@-M@'zPz00S@)PaP DP OP AP )dP oPi]|0t00SЍ0 zPP0 00jqpz00@+)+rZr%rO-M$0S 0S B0S@ R u P 4X ЍL >@j Pp 00n pPPP`XaP H\P  PPpPO0S P``30STPQCPN ((@(!P3`000P0`0 t(P0`0 4P T ( 5` 0byPk& 20SP `JP   @( YP yY |2 hd2 p 'L2p@20WF0b,2P 0S P (zP11P =)&0S )/1 \ P HP h1 P_L10S Q_ 010 (0 qp 000Sp 0 8P 6 R0  [ R 0> 0P: l X ++wfr@",r+5r++#,!,++++%!,40,|%sP0@-@+00@-+P '@+!sA-`pP`VVPU@JTWlP040, 0 +@-yP@0 @ + 0 + 0  +p@-P@@P Pp@7pp@-@`P*PpVU p@T Pp PpA-@Qp`P g^^U1G-@䠟@P`  @PUЍp pP^7BP ^8p0SkЍG+@-W00S@ @y+0 R/%R %R0 sR0/@-(@0SP00+ksysG-`dd@p00CS0 ͧp PP 000 P U 0D IS  5Z^p@P@- 0PsA-@0 0Rp@`0S00 R0S@00`P0S U  ᡕP@00%%O-M@D`(px!PQ Zf`@pW*p%pP` P` X . P UpV`OPC`0` 00L0@0`VyЍ8P Y@00%%s@-@+pFPPP Ѝ@萈@@@ L0L 0P0`!yZ] y@T] ЍJd A-PPЍ0S `p@@@\PP D00@ 0`xW vP&]v!O @-@ @CnA-p@`P@0S 耟P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0X@++C-EMPPEߍ@ 0@`qp `,tvPڬ嬐P ` P:T0S E|P @  M0SpI`P  P@+D",A-kX10S@GkD1 RpP? ,%@ 1P````P 0p0000 00Ā`xS\P@pW ZpC\W PS0S7\Ѝ Y.\@|+ss%%ss@0A-0S@`@0P Pw@p`P\@\\|+s@-@<P 0P owfr@-M@P ƴPۍ@ ۍ1O-0S# 10SPpuP 0 `|R@0 -R` lP JP H$@ ЍSP P PPC 0[w [ ` [V @T P uX%X@uP ᖇT@@P@T 0l000@l`<P#@|0S`[",|+osr0A-`V8@PNpP0 PЍA#mPj`@@@@0 `v([&[@![T ЍA2Ѝ|+tt-M 3vP  @oЍ0@-P@M0SP @WrW vP0!@Ѝ0@T@0: S *@V@",%%@-M@vP͡00 0fЍ0@-Mj0P@u uPh0  R\P0  R\ tu p0St00Ѝ0+++/ᘯ@-@BP P0@/R@-@ &(0@0TC$@!,@- 40 R\00S@@+",h00S /pp@-qp $qpP@ QPpp+@-P$P3#0 R/  +O-$Mq0S|10S%9@dP`\100CS0S#P`vu @ @P`0S00S$Ѝ|P`@n 0 堠0圐00 R 00  00 0 0 000000  000000P`E !,!,0++\++O-M#Pj  "qp 00S #P ЍOl0 `F0`v40 ЍOiW +X",%++D!,",!,!,d++",%Lt!,H00S <0P/000S $0@///+\",",+'G-pP(,`@wP"V $10S1`V``ut 00S000T T00 0+`~+00Y J*0Xs@P W ЍGd"VX V 1+!,!,d+",O-M`NP P @/P! ЍO "qp@PV00SЍO0Ae"P00 0@bЍk"pP@PX!p 0^!qp0 @P++40,A-p`!qpP@VЍA!  0@6Ѝp@-8P@0SPp`qp @+0P  P/%0P  P/%@-P@p@-@PptP 0S T0 0S @ 00C0WWp@W  B 0+%+0/+A-`P$@pT'W80@20 "0UP00040000( @0@000S 000 EPP U:VWRW@   0%+P/P // / /00//000////0/0/p@-@4PPP W4Pp4/O-M@ ؃d  0PsPPP0000 0 m)@P*Ѝ000 0 0a)@PT <P0000 0 O)UP@=U@T> ЍO *O-4M(0PX0@ ,0ut @P4Ѝ40SX400 ?Q)(@PPTdp00$0Dp P:J  ` V0/ C:p` P P@ȳȃ00P0v V `V@P,0S4 x3X4 @ P6P)X30pW0  0 `P20S Y Y` P P `V@Y*-P `@T_@ P0S x20S  P0 (0 S =  >&PI 20S @0   1 0R00S8 P Pd p 4ЍO V000 P0m 0PA R TA 0 Pp``y81`@P !X$0l$0@P_ V Vd@Pr P P Pl PX@Put$0O$0@P_{, 0S V V0$0$0S <@P I`0 !,d++40,0",+", ",d",l",7@-P@zP ,0 R  000 Ѝ0+O-`V =R+` =R-`8 s Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =*PV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` ` P` e0S} 0Ps {Lq%+%6&_usuxu~u9uuWuujuu v$0 RP  /+0 14/+$ 0Q/P/%@-04 ,    00+x++t+G-P匐剀vN@rNPT`ppP OT O  h ! c O O @`匀+A-@4pP0`S 0P0aP +@-@$ 0 @z+P 0 R   /!,p00S/p@-m\@PPPpP 0S8@pPp  D",+gx@-@P00Ph0 0  ;0@-(<+(8)(4'(0%(00x+)yyt+++++P/0/+p@-0@00P0 0R 0.PPPPPPPPPQQPQ(H(D'@'<'Pp P0 Q00+t+++++C-PᔁM0@Sp`Ip`ll!0 0!0S~0@ 0  N@ aP00CS7  `PU7 0 Ѝ P 0-!0S @P 0R 00rq U h Q L S  {PwPP",",!,!,+!,%%,0P$0 00S000/",!,P",!,p@-L@P`0S0000p01S 0t'P+Pp@-`0 p@X10S P@@p(1@0PSP5P/o`0P@@S  1CP0 1C%@+P 0S$000|  0p  0d  0@@PI 1CRP +++|++p+O-MdtC00wvP1Sy\0P1 0S T 0 S1C10q&QF 0 0000PP20SI 1SF P2!0sr R0l2ap01UPL20SDXO 1R.sr0nS`J j`0F[J 1RKЍ1S \ 0C# R Y1S1S  ` 0kP  00KU1 0[0 `0S5& U J& 0R 0èQ0pP 0C001萄 S rI  0+!,+D",0+t+!,A-pP`p00S HP `P 80@0@D@ 00@TЍD",+0+p@-P@2 02PpA-`HPp@GE$1S 0P $@@+7@-Y 0 0R  x00S U d00SX00S D00SX   +0+",!,!,\+`+D",<-0 R!  ^ !0+04/+0 R 00S P@0~0/0P 0/\!4 0 / B  0/+$",0 /+qp/G-p` @PpP 儐u U 0 0 W 00V@00CS7P P 0P@P+40,PG-P0P`PpЀ@ 0@Dx P nV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB+40,G-p@0@`P@0W  S #R0C00C0Ѝ -,P  j qH 0 CpGA-0T@Pq1k`EP q 0P 10+G-1dp`0 @PPP0 rS00TD`0PT@0+++p@-@PPp P0S04Dp P%@-0P %80P/ R/0 0S 0 / ,00 0S/$0$ R T ,P",8y+A-X@ 0S0dS 0(0,`Pp` pU`r0 ,PyX0QH0H 0.4 00/ 0 0`, ,`,A-@PU  ^"04Pp4 04 R0PU R4`40 0 P ^PQ p0࠱`  0 ,O-1P0sUPP@PP0⸡p`@` V R0 SRA 0 V 0  W0PR 0*9PA `Y0 0 y W`@TP0 00 0` qp +@PPAp ` W0 0O0 0`qp @TPP", ,40,P0G-cpPU !R00 RS@ U W0S P*P @P P`@V0 0 0 000 r  0@P`P`d@W 00 000 r  0@P`V@ ,40,G-`@뀐P@p0Vs 0SP@`-P@tu TUP+G-V@P吀ጐp0`P80 @p 00  0`P 080qpt ,40,800S/,00/PP//!,!,00CS0 S0 Sc0 /O-P0-SP d   8 l `p_P`@P0S,@ 0R S%|@T TCE___AX   l 0 ЍO`P T@Q@ D@4 0 AYaE Xiy+Jd G-@ $P`P,$ppP `~ | z J! R @yz  0Z Pp@ ;p Tt p@]q *f80  pzy3 X+C-`Gqp pqp@@PP.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P  W `,!, ,y.Pp@-9 $P" 'P= P !srp? p^P 0 &- P& D06 p+Pxd0`]d0 T0f&@PAP,@m006py+`,t+!,G-@tPp`4T#0 5T Ta0'000P0p0 }D@6T` P'0`,@-o0@-MPh@P   srЍ08!P UD00 0 &+`,@-HP!sr@ 0!0 &`,@-  sr @@@6P0&6 %D0606Ѝ`,+G-6@PP`j>T6k.sq 00P6 D06PU p)`CP0ЁPP  G.P `,+8",@-P ,0 0R B +yl0l 0@- ^ @^TSa04S '005S #+`,,00@- @P QA6R 00`,G-[X@pP Pv`PC`Cp6W @`,00S/G- M`V`@唠唐pqpp6W @ Ѝ 0  PU!P CP P 0 2`!,5`,y0@-00mS Ѝ 00 Q >@P 0 S#  PP0P`0 S  Q0 R pV`PPp Cp00+17@-PU0P( P@ P0 Ѝ000S9@PP B^PB Ѝ0@H00S@ Ѝ0@? 0,0 09 |+y+z%z5zAz0 +<07@- R ,0,@P?@ 0 Ѝ0`%+@B8",@-P M# @0.S ^00S Ѝ 00S0 0 00S000 p 6^P0@  0R 000@0,0Oz`%Qzgz8",{zzz<07@- R ,0,@P?@0 Ѝ0\%0+@B",@-P M# @0.S 00S Ѝ 0S0 0 00S000z p ]P0@  0R 000@0,0-\%zz",zz{@-@PP  @M Ѝ8{@-@PZP  @> ЍU{0Sp@- Sp00S p@t, kl0p`P p@qpP@ 0 p@u|+y{D!,8",P07@- S SBl0 Ѝ0ܾXPX0@PP A@z Ѝ0@A00 0 %%{P/L0@-@0S 00(0 $ @!,+!,!O P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P6A Ѝ04@P,0, 0 10 %%/,%|",50/0H",P/VP @P/5@-@| pl@0TxSPLHD@<8@b%{;{{{&|J|~|||%}@-V0dSK@S!1 CRJT" R&0CO  R  @P3 @.A C#Rꌗ $ ԗ < T l k C \0 0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~!,}T}q}O-`-HMN@00PP*0 S 000C S ?  000C/  0?pEpU:Y U :TЍ D0!R1@0P S 0,ST40, @0D@D1!0C 0 +%%C-PM MP 0-@ݍ ЍC` @;0Sڐp吀吐n P=0Ud`;_P0P w=D @ݍ Ѝ <%} +qVv<}%}5P@-  0S 0 0ЍP  R lЍX 0L H 0<040800 0000000%%}}P@-M 0   0t0 @l3d P 0S>000D ;0Ѝ,0P 걩",!,~P @P/ 0 /~+P/00S!,0/@-@0S!,0/@-,@0S0 0q00Ѝ!,/~0/@-,@0S0 0_00Ѝ!,\~0/400S/(00S/@-(qp@!,+P@- 00@ ^S00S00 Ѝ0N /X%~p@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0S\ 0Ѝp40@00 00( OZ @!,!,~~E~P@-P A7 ЍRS+DSSS 0e C R( 0 ğ ğ ğ ğ 8 ğ ğ @ ğ ğ ğ H E C CS -S 1 CR 0CrS dSWS ^S0S^0wS     0  E000 0 FK N R WR Q S-00 0  ~!,800S ,00S 0P//4",!,!,$0P/0 0 0C/<",+!,@-PU  C@ Ѝp`@~stpPQ 00S0\Q0S 0S@V 9P 00$Q00"",@-0 S 0,, *dY Ѝ * \YH!,=B@-@ Y;r!,>P/0S/P 0  //9oP@- /z 0LP/H!, 0@-L   ЍH!,"@-`MP@៺0-S0p00Cp S T 00ЍU X P PTU $PT00W`MiO-P$M cLP 00S S03/0L0$ЍeL0 @``Pp 0 R @@-PD &$PP 0@093@!+P0P0U0 P @0+S3P <⃺<9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P aK[  00 p @ =RP   R R tq000SPP000p00CS P h  h h h ħ 0U ?o200@S 3/TWU 0 [ 0S00S0000SL@40 S 0 _P&00S H!,!,+@-@PM @PU@`p0@ mPPU   c,A R  | 000CScl  RzV)00SS# P}U  U Ud0?o2R0P 2/0 RP0 VX 0 |Ѝ 0?o2RP0U U U7W0 0S00S00W 0 0S00S000ES` RU U U , 0 S0R0  b R U2/U}00SS 00S000 S000:S U000 0 ~#?Z+s@-P`@း000C S0 ` 0 B ^ ST00T00VЍp( `}S 00M 000S/P/p",!,@-XP@PL0  0S0S  0  03/$@ŀ%!, 80S/S/ 0CS/$%O-@LQMp0S [= 0S 00 Ѝ`V/$P  0P! AAQ-P $ SQ@ S0 C0 p@@OoB0 R ` 0 0S 0Wpp% @- PUP0d%/-4M@20S4OP 2      S2 0S 104Ѝ! 0R0< $0"1 S 10S 10S1 `11S(  S2 T!2 R (10P!0000 d R  RS 0000S P 10S 1e\ 1P 0S~ 0#Sz ,0 0S P 0 !",",D0,40,X, ",d%+X%!,@-ƌ",@- 76 Ѝ@-P5;`c@`@@S 0`pjU Ѝw@-@(;P e7#,G-` @$pP 0(S%0   P@@@0^3#@- d 0 Ѝ,7@-2"P@?@ Ѝ0@B@-<0?B3c/ ( 0 0 SЍMb@B404@-@@T RP0  h%#,+@-@0@h%0$R/ $吼#,p@-@8P 00R:0 @0 $ph%',#,p0s@-@@d`D \0 Ѝp偼0U4@PP 40,#,+@-@@PC- `?@P!M0`p0PƟ0 0h 0 eT-00EPN4ЍA-PX 0`p@ @ 0p0 P dU-  D@C4ЍO-0M` p! 00@C QaCQW@CACQ7@CT?0! ` ?0 !@PPX [ЍO-PMpP 00@C QaCQW@CACQ7@CT ?0? p ?0 ?@``P[ UЍO-PMpP 00@C QaCQW@CACQ7@CT? 00 p?0 0 @`I`P[ UЍA-0MP@PЍ%P p@0pnP# cP% dP  %PsP xP   ኺ@`0P`D@0 0 M`0P 0A-P@`pߺ<Һ` 0 $#,@- R$00S20 P00S@o p@-@ 4P0 4哹P~p@ [00SC륺hd0`m`P뙺H0@늹80@0@S(0 p@ #,",p+p%t+0++0@- 0 ЍW!7@-@PP Ѝ0@(0  0~ Ѝ0X%@:p@-@P;P %@2P D800S00 QT㕴p 0++@-P1@0pS Q*㮴0 0 R 0?o2 `B@P 6W ^@Q ㏴000 PT @P ͈6` Ѝ6T",/,+X@-@P 600o/O-|MpP `@; a1 Y0 00  \0ACX 00^YP P0@ 00  `0 W" !Q0S|Ѝ@0/0S00 0 0Q P0 l0S0 0AŒ\Q0X0HR?!1P^ A A T",/hp p p@0@(0@ 00/0@+',@0p@-P`40V0 F@ ӂ!ѭ1P@p+',T0p@-PH0 A@!Q0a0Ӄ1B0` ෭`Pp+',0 0/!q+',`0 0 P0H0@-0^@P C0/',+<001P/0 R2:/', 0A+0Q@-@q|0A `0L1!0sr 1!0sr  Q ',+@-`P 0R@T 0  x500@~rq 02C Ѝp+', 0P0PP@/+0 :Q Q .Q 0?Q  \QQR/ R//A-`@p0P; R0C @1@C" 00000',9p@-@DP0Ts 00CSp@[@qpp+@- 0 @ Ѝ@- 9 Ѝp@-@0PPS b0C0S| 23 0jS BS bS 00mS tS@p 0lD8",p@-dw`P`00ST;@@nkN g,PVc`p!',!,4!%C-$MV0`S@p`$Ѝ:S/ %S .S 0 pX@0S0S x?S \S0S 00@ 0X 00|xX@KXBX DXV @LH,X H H H , H H H H H H H H H H H H H H H H  4 H \ d d H H H H H  H H X H H H H ` PP50S4P40S 40S Yqpz P Pi P`4 iqp @Pav 8P0V{0 Pv3XI 00BH@6X? 8    P d ,  Q0R 0 oqp 0 t2P0h2h"0 \ P B B?g긷qpG0 PP01P 10111 1vG3 P  T10  0R0:P0P Pj 0P \ 0 U 0R0:0P HmSA Pc ^ PHH_ 0P',W',++P",+!,++ 01%H0@-@@00SOoBl(0(01 0 |",!,',%+0% 0@-P P0P0^  @$R \0 P$@R@0^ @R \ 0 @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P \200@p@-P@T `0S`0 0 p`0@0000`S @@@A-PQ@` 1 P 1 PP7`ЍPʹp0W"0 S 0 @o0 0PP 200᭴㢯. ⥼c2P 01PT",/,A-p`@V0  ` \ Q(P  RPQ(SQ $0RQ? " $ \ (P Q S ^ U 0S P$RQ $2 0SP` 0 00`Q0S P \U 0SP `0 0S0Q  R \  P  RQP0  0 U A U0QPA00  @-boP//,C-M@@8`0C`F!p/ऀP< A YЍ0 I/o"P R  ? 0 Q   Y0 ? @/,O-$MP`T0pP@0L00SG RD L  R Q R*H)  H00@00000 0 YH  )-  0S0S @ 000 000L000`0C P$Ѝ@/,0    //,0A-@0S 6PT(`V0(0l00Sdp@ '(`/qp ͲN@00CS(w+/,++$1O-`wvB 1!0РS ЍO00S PА@00CS& ЍOM 0qp   0Z qV Q {랲P@ Ѝ%+%++p@-P@T <0@@@ @p `//@/,/,p@-PH@U p@\Qp@F(0?o2(0/,n 0,p@-P@c p0$ 0P !U@p 0,O-M,070( @40pap70<0h78D @9L70S 870/S 0Ï0@{t , (0P0s007S(00(00 0,00$0 `00060(0, rs   T000S 0S$Ѝ(0S,0 00000H 0C000L0 " 400 000zy+  0Sqpyqp0S`I00 00S0 @ y50S PIUPe U 0V 1P40S 4L H^04P4U 'V4PR0 QR S P PS P400S0R0S44L0SP`rPHL0 #PPUP: 0 0`0hP0p`PL0 P* G 000 00 L0`$ L0`     h ` D0D0P$ T 0P@TX\P|. z. P ` @ 80<T0s00040T0PU$00CS$0P20S g000 00 L0`e408 CGPPI h0S8 Z5  `J!` 0C pQ0_00 p`0S0' 0 aP0o 00 N0S0<1YPPYPUp1. .0S0$0`P0S 0S < @B X0C  BS pa obZ0Yp0Pp00++8",!,!,40,P",!,/,!,!,x",D", 0,!,++p@-P@U < 0P !U0p P$@ 0,p@-P@= T 0P 0 Up PS @P@ 0,p@-@`PV0010S0 sr ^U00 s00 ' 0P p 0P tu !R0(P Vp00@00S 0Sp(0(0Sp p",%%/,!,/,p@-P`dU 0S0P@T0 P@|0 pP#-@ƪ0 00000@Pp@-0P00/,+@-韴0PP/,O-Pг4M00040c@0P 0 X0S0  P4Ѝ0 $00 $0$0X S38 <|r utE T %2`0 p0@_  0 rs 0Z0 P @0s00P 0S/d2 0  c4 P 0P0@ P(200@_X 02X0QX`pP 0@` p P 048<00 0(00X00 00 0 P|#(sr, R0S0tP 0 'qp@P *F`ut q`pu80<V 0 s00 } V0zHPu 0 3qpm @P`p0X0/,d+0@-MJP @tu 0 kЍ0@-0 ( 00S@/,!,p0p@-@嵺IP PP0 P 800S(0Sppp%/,!,@-$@$0S000R @/,/,T",O-0,M "0Qp 0S?wyP tC 00#  dPL ,Ѝ4S0S (30S 0S(0S 0(0u0(0P+ X`@PJqp@PNر뮯@PfR00 (PlBlb0 0 0(0a0S 0S D(20SX 2``FS iX1H1X`( 0 @Pᜁut0`V$@PxAut` }810S ,10S $g@PutXZ@P 00000 0 0)@P 0S 00SJ YHSE qp QP 0S 00S1 /,n!,",",+8",0@-$ 00000S@ 40,",0@-$ 00000S@d 40,", @-80 000K00S@ 40,",@-@P ۺx0x0SԺdѺκP@ʺǺĺ㾺 |+d 1A-@TPP 㫺밭&.㣺㠺ED㚺 \0 @  `Ppn0S0S 0X 0?00]00 ,00SA㉧40,d +0+++",G-pl0P` ᯬ @ aP 0S 0S S80,A-` pP刧@፬%0Up0P ~s%p@-HP@T<0   p 0 )))%80,O-AM(RMF`)V A0 0I0p 7P r0S0000AލЍ0!S   BaPA>04S S S ᾦ0S  00 [Q嬦0S 0 C Q ? 0   ^R000 Q\ S$R0C 0N00P000\\ 0  C R  C0%80,O-pQpPpMW My@xcPJTpd3dC  \\Ls PZ PUA (3T Uۍ ЍpPS@DT2P@ Ꮻጫ @@ 0 &X (| S@ (T@"0S000jP ;04P ST@ ,1 Pp 0Q 1T TP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S / P+? T00p000,80,%6&40,t=&!͓0@-@PP P pP `P APA%ؓޓ@-@P @P P P,@S 1O-M0S" @`0 ЍO^<Pp00 0 Ppxy@`00S 000S  0P Ѝ 70 000 { ' ' 0S @`80,40,(P",D",\0@-PP R^0S @T 0 B80,%\0@-PP R^0S @T L0 B80,%0/80,0/80,00S /80,@-LP @P@P@-0D0,//@-L@ 0p PS0PЍD0,\ QR0* /QS QQ*/0000/@-@P &000000/0S 0C0//@- 0#3P Ѝ@-@ 0PSR? P >BQ`  g&` PЍpA-`pP@T@  A-P`"pF$@ QP ,00(00 0dPЍFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`@p?PP@%@ ?0P0U0SP@0s@-P00@a0C`S,     L        T   \  d  l  $  PЍp  000@@0 0 0 0 0 0\/\\A-1!0 h \a[P@1!0 h[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CQV 0p@]^S @p^404 0 8hp\00B,xB,6og p@-0P @R RP D D <@D@ p@ @t=&B,xB,1C-Qp`Mp묁0@ `P0Y 0 '0PR l1@d1`\0 )h\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . C R 8" [T \[R@]S  000TT[T@  \T  \R,0 R ЍXB,xB,B,ݔJ,00@-M00 M/SP $S+ +S00+ 0 0 9S#\S @P0 0 g0IS@P R00ۍ Ѝ00@00 S00@B,xB,O-@T Ѝ0tS bS rS aS @{S000pW G`p 0S 0QU t0t Ppp0 Tgb`0V P0 0&$PH0,K,B,xB,>O-MDD_.0 0\0.> 0 g S \|.t>0 f Q   t   P X P d 0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ P  P 0S| @,Sv p0S 00@P  0S  00@[VX9P00  2 02!a00S +厛+V P0 a0+‛0+J|Xc19Jd! 09 P*8\PP gD:P\e ( p$ 7\0p !7 0`PS(00:PX5000.t0\`0P l000S SP@ o0 l 9(00(06PB,6&"bF,B,5B, <2;T@-@%P ``P@-@@P `lp@-@P,Pp 0 `y@-@P`PP R 0W&p0 O& ЍJ,@-M Q qM`0S000@03 0@0S  0A` 0 0S S ` 0ݟl:@P *0 U9 PQf0 ɟ00ڍЍJ,B,B,w@-P@  0S|` \0`p `  70P S w _ЍЀJ,G-pA嘁0 0`PU , R:(,=00( &U# \U   0 R`Z &R\R`P , R:(,00(P    "pr P qu PE ,  R:(,00(   #  0J,t=&A-@P p0R`*W0 0  0P P O-0㸿OM00PЍ080?PU 0PH0 \ R0S40P0\0 P R 0SQ0A 0QES0=0C>St9 ( ( ( ( ( ( , ( ( ,- \- ( ( ( ( ( (1 ( 1 ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( + 6 $, , ( ( - H- x- ( ( - ( 0 ( X1 ,2 x2 2 6 ( ( 6 7 7 ( 6 S S4 0PS0@o0P0  Q Q*S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0j0 P^S0@oPL0 R: L ` 0p00)0800400S<0;8 00 [4 00<0S  MH0SSP80S4PU 0`  EၟP0800A E4 弒0T P 0  004 0 0  0:00z040 0H:HR <00s, \0P 0S 0S 0( 5P2S 0 H9` 0S0`V: $ 00@ t9@i0S dP 0] H0$ P x0 0H$0$0 S8`0V:v$ `000 00C 000P h`80 R:PW`80  `S p Ü70 P   R:: ` 7B7` 7'1 01S:%` 007 |60 S0`(78 00 tg4 00Ϝ<0S  3_P30800 OP80Sf4 00㩜<0S  80S0p4  HK`P <000F400<0`4 0ኜ<0S  V 0400<058 00 V4 00r<0S  `L0 R: L !` 0pP00pY R  Q $5 0\4000  ~P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ <0 0 t  PQ8 p0V `XDcH0p0<H<p(0000S s4 00֛<0S  :p PB"000Q 0 0  0p V0`0  `0P  ~ P\   p V0S` 0  PX80S0s "z2p0 [04 0I240P0 A2P 0S 00Pn80S0sp!pQ2p 4 0$240P 2Po P R00`<pL0p<R80SO4XL  0`Rl0&004 0V@*000xB,J,J,H2,hB,XK,p6& %ght@$6 B,w!ћB,J, 5W ;&,K,J,B,H0p(pW10 (W0 P0H !  R 0On 0P pW* 0$ (1 0X`pH0`h0<H<h`x0h041 84<0 0R,,0vQ 0{Q  H2,WK,p@-@P`Tp0wS {S sS 0p 1P 0 HZ0`@p 1P `5G-`OP>PU00Z01p R  p@ổPVCGwXpp0!S < CQR2t; ; ; ,< ; 0  xZ0 0 00 00 00:S 0S0S W00 000 0V 0S`: ᴙP 000BS DK,ٛ0p@-P@T P P1 0S-< = < = T= p= 8= 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@DK,C-0@- MMP0@P X Y n0p8Y+ 0 P0ۍЍ05H0  BR R R$4 /6&6&@00CS0 S0 / 46&@-(AᏝ0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@dLL,1@-01\ @T P#Oo\B@T P P P QQ R P\ \ P P Q R  H-LL,0@-  `Ğ\ @ T\    %R    LL,H-A-pA0 5S$\! R  (P 6&L,p@-@0`  :/T  :2t岙h pdPPT p җP000STI @6&6& LK,"s@-@P ȚP:@P @0?SP@P` ثp Ѝp/#P@MP 0S S @ѥ0Sͥ00X)H cO2@-顥 1.k6&0@-@<TQ T00 10001S R0Slp@TX` T@0$P@ 41T(8  0@1LL,56&H-œΜל@-W 1w.룝6&7@-@Pl  0S 0@T ^00 Ѝ0X0"S p`@-@ P  p WЍp@-<0XPP%0ATp "0R   DS" @DAp %0 0p2#L @ "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L "L /0 0p2#L "L /0S00//00//H0H 0p@-@P@!R0 U0 ,?0P01pT,,01//00/00/00/00/00/ 0  /, 0  /,, 00/900/Q00/Z00/00/c00/r@-@x ,00/@-@j4, 0  / ,9 0  / ,Q 0  / ,Z/00/00/00/u00/}00/ᅞ00/᎞00/ᛞ00/ᥞ00/ᯞ00/00/Ξ00/ٞ00/؞00/00/e00/+00/S00/7A 00/, 00/rN.gb@-0  0Ѝ@- @+@-蠵,q$5 0S04c@- +@-蠵,j @- 01,4, @-4,O((5 0S04c@-4,  @- @- 0 , , @- ,3 @- , ((5 0S04c@-z , < @-q, < C@-h,< @-` , < @-W,  @-N,  q@-E, e@-=萧, e@-5^, e@--@, @-%,  @-2,  @-, @- 0譪,, @-,  C@-, @- ,  @-让, $0Qa @-谧, @-@D⦝P d 0 W 0@- 0|1PT,p@- P0 d_ 0  ,˪,W@-$@]P T,A-\`)qW L6@P |Aц0 㕉|T,M00/00/00//A-`1P00# 1@S021(Sp%0irv10#1Ux  Ua wRb_HW80S  3/1SAvL0Cr( S0EH`j qꭠ;6 6 O-@QM`X"L XP%S`PP M 0  0$ 0pWS  ;r1 $x1 `Vp@pGqS100C1ġ`F10Q@aQA\00Q0S< 10 \`(0p 0 0S1S1S 0 q! K10 CЍO謋 G  q0S 0V01`Foa 20S20 0` @p@-@` P  0p@GZ@-@Q7` a a a ,a la xa a a 50S04c @   ԙP X03S B \X T T L00<  ,  ,  ,3 , ',&,@-@Q: b 4b @b Lb b b b b 50S04c @  匙P t03S BF pl h hd d`00S  0< 4, 4,O1, O,N,,Ь,@-@ Q?Pc xc c c c c c c d d 0 R $b @<   C  2P \03S B lh d d` `\00S  谧, ,  , ,, , ˪,ʫ,,Ь,p@-PQ-d d d d ,e 50S04c p@| | / @`P 3S/ 8B A. p ,q Q|e e e e e < <4 40 0, C$ $/2, ,  , ,, Qf f f ,f D D<0 0 0,00S  /@,,,Ь,Qf f f f 0 0v( ($ C /^, , ,, Qf g g g ,g 8g H HX@ @< <8 84 C, ,/ᐧ,,,  , ,, Qg g g g 0 02( ($ C /,  , ,, Q Q Q/   2, , ,Q Q Q/   ꐧ,,,q/00////00//00/00///00////00/00/00/00/00/00/00//00/00//00/00//00/00/00//00// 0@-@@DS,0@-@@DS, @- ,  @-,@-G/0Ь, C@-v, @-n,  @-e ,  C@-\, @-T,@-/0Ь, @-C, 0S00/ @-5,  @-, ,  C@-#, e@-萧, q@-,+@- 蠵,q @-2,  @-, A-T`)qW D1@P |A偂0 ET,MA-@PP 0S l`/P )/`1S0ZP /P 0p RM /`@-@P H P #z k0 0~j000p@-P`A  Q 2@D D"5<0c#Ap RP*U<0p %%@-@%@-@@Q@-@@R@-L$6&fp@-@0S*EP) ^_됍P  ,dNHl|Pss@E@ P < 0@ S< 00pppL,C- %O-,M@0P0 T; R0AT 011!0 S01  R01; aP ,0S  R3/00S 3/[1P  SP d0P 0 0S^:` p` 0 011S`@S0` $0#p$0PJ$0P``Pp1U00$0PeUP0!S$0蹟000CAP PCڰDPA_A$ Q!@ Qʋ` 1  p$TPP 6& `0p0C0CS0V`0Z `1Z0Zf` 0000 0 & #0 "P P ދV`x 0CÀ  S CUPPEPE_P0 pxP 4` 0 0 0P@#D]P Lk1 0 Ox ~ Q 7yx+됷Pg'ZPPt7000HD :! "1 "0S SP 1S b !ġ1S 0C" !8C8R11$PUPLf)rp(r0 wP (v}xc(`P 0PSY *E 5k0 k .ʅ넥Y Pʀ500xPG qPD >P' dP% <P  SuP 5P 0CP  @@PV 400C`F V$P P P0S t400C`F_C}l1SS !0C B/?!1E^xP00 S11W?zP`PxP@a@1S4020/C(PZ( @@PP P10!1 NSPN0Q^ B 88C8 P P?@ "0C S񟗉u Y000 @  S" S00 50S oP  "Y Y 0 0 0! R @ S0 0 oP  Y0S  X00000 00` S 0PSHP P0SPPo0 00o0S ot ?C S XPU  8l0X!0C0S;3PP0 PEXL,t=& @VUUUO-$MHZS  R0P 0L`pDp@ :0Y0 0S 0g Ah[뤳`P0o/o4o0@@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C0D S0  0i oX 2 h0  B0̂V P0{ P>  PN P P!VUA`E D}@DP`4yh vh sh@`"PD P AP;  JR !   ` D0|0@0!P1 `V0p00@  dC`0\-z`F`FV0p00@  DPE|@DU`E¨` Y @ ᜇ@T`— R    BW00000S 000 0 0]$ЍO0Y S L,- 9t=&6&A-`PlPp `En@@n@0T O`P@ P P0000L,@-@Pp 00T0* Ip@Ѝp0 00t` 0 0 @rE@t 4JP H &L,Pp@-@TP0Ps D` R :2P 0S@@Q@p&L,@-@A0000L,0kL,0kL,-@-@00"  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-   ЍЍ/@-@@5@-@5@-pMP@`,0 0( 00 0`Ѝ@- ЍWO-M P`@p\m@WmUkT0 0bP0 kD0SPZ 0SW L00SSDYPPL00PTP^y@DO@W <p PRWpV`KЦo`0 S`K0 8r@PD0@ <PT0 0Pt00L00D H0T @Z  r cwccЍD 00R00S 0S L0X#3p\xrrP 0 r똰mG"Gee @ᆀ0 EGqb`PTG G`eeL,C-@-,, ($ *ЍW@-`$0P@ 0  00 0`Ѝp@- ЍW@-pMP@`,0 0z( 00 0`Ѝ@- ЍW-@-00c  4Ѝ Ѝ/Wp@-P8l@9lpL,@-y7@- @/DQB$eYPU ~% kK00h@PU n%T [ӆK00000S$$x Ѝ0,Cn 8, L,6& O-AM@@UPP4q@ & @1T' @΄Pࠟ   PKAߍ`V  uX`PX Y  Ὢ =R@ᵪ8@Ä `!56&K! 1@-rO-0MM 0p@`P2 PP* P 5XP 0S0 0   e b JPPὍP 0 Q0 0P|ۍЍ0P 0 90  09  !O ,00S/ 0P SI@-z<,Ԭ,X@-1P DP <@MAb(]"P@Cn!O A-@M S@00zS%P,  s0S#|P  Y0Sl Y0] )PevB@PaD'D*oB^&(ЍP@R>~P ( P(20S nAP'.Ap0 $!Pu>~ $ X$P 0)AT LPP AP p`PP 0q+Q S0p 6&V`T(pA`T-@p0T-:W@Q  R@4Q p0Q  R@[AP`003/P 00  h0S  R l 10!84@7APꌧ,T,,,5@-MM+@(~+(}B+( ~B+}(|@PލЍBs@P `0 @@@@@ @@@@-)'B(P?1 !8 -MM+ }P+ }+ }+0} A@P  2?ۍЍ1 !8 0@-M ⯏1@@@!#P @! P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*AP3AP/[P+W@P' AP# 0P=} 囇@=5}  0S 0_ Z(P @P4o0m,&#)*00ꌧ,T,a8 C C-C-@-M -0@@@U?w#P* =@  P 00*!R00$Q 9*@P  r0S 0` 'P%(<*Ѝ茧,T,O-`M  0 0X#*0S ` 0 SS 0p0 S00C `@0S :6PP @B pQ %S0S iSc %S, dS 0T PsS,200P 0 倠ಠ@ZR  @P %Q0 @0S0 aRT @R$R0PPR@ f T 00S 0 ! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^0  3/PW Ѝ 0 |t=&7@- @PU d! ɂG00 Ѝ0ll[P \ L!L  层*( (0['8, N ^ i  / Qp@-P @0@0S   $0p@7 0@8,w,7@- @PU ! ujG00 Ѝ0PP | _d00S ԎL L0[ˎx0 ,,   4,8z/  6&s@-`4Q@Q;;kXx{ 1adey`{eu &aYe27pe`7\{Jg 0All@Pxx巸6P AA'`*` d{ЍpC-5ſ6& O--{MpP`ኄ0 p E 0S  P R  0S p hP XP sp@T Pe ]T0B? 0K,P "kF@P "bF00xPhP; P  D; f;0S b;!P ^;  bC00z3"0{ߍ3n^N3 ,`0z"!03`ˋ1,0ʋ D0,0,L0 L  0kP,00z?"!!0 P#  a PL   YP U $ lgd2P lil?Y0S hPU PL UP0 T 0  SR A?1P 1 ,V 0I2 iz?0YC0P0SP @ 0V 0R0SQ 0~0S9  PH_{yu  PS 2 <,&ptbt# f@,8,D & 5~ 5 ,8   J Ԭ,o T [ L0@-0,M 000000 00P0 00h0 PPP@P DD϶@0Q ,ɶ,Ѝ0@"ԟ &6& , -O-iMps?!0aWP 00iߍOЍ/lx@PX1P L!L0k0&@P jZ` +PPW0FSV030#Z0S n0W0"D!` P Pp0W0DU80P , 00#\'PY',H!  -O-0MT@pX   p$p古 `V\  @M'U` }PP}P8@P 4>H E0ႤnPU 0'SP0U*S/ P x [ }0@ 0 0H0 }1P1Z u4qp`PUQT( 2S022SP0220C2   S`` ဂx$00 0( 0 0p|W  @0   (PU 'd4c%d0U 7 ]W 0X0C?o20S ]b$]'b]dx@0Uk]] x00CS0000D4T0U Z$0S  r7rUgwi 0%S @SJ B B*ЉD00 aw/00L 0.RP 0 01PH00ZpL@P 0A0 \ 03 4Q7qg.Uw00X (#Sc@⩁0U cwz  0UX ~a]awmS PPW  WK0ЍO Ѝ/  B  6 ht@C-6&X 0@-CMl2PP 0S .Q>|@P8 FwCߍ0 P?w L,M,G-p 夀夐PB`A@T:00Z W ,/Z 000  |P EQ 0 @@ t=&A-`Pp p@ 4 pv P4@N,A-P|o@|t pv0S DQ0Q.SP @$ $v vL,T M,@-M4 0PDP u v 0PDP g v "p@ ( ⍈ v APU(p@ l`lp v @(PPЍ @v d0 @uT400{0 ,"040P,   -8 4d0w=C $ CIGTrP, .͟ 0Q(]?P 00 0( 0uPPPPP9<@`,0tD0D, Dq,w \<J /  0>0pa Xvu /PP\  /P;PU 1sS 1lS;"000 0[P p@ v Y! HUhH QpTKT[T{01@+0~, ᝃP ᘃP ᓃP ᎃP ቃP ᄃP P0:4: @p A*U0p HA0tp H0Sp:p*10hKRMP 0H0H0A sp ( AP:PH , c$U { ZPPP@;4@P- ,t)0x\)0wWP\8 0\8UXDy0 yET. ()0z>;@PEPS*PN X0 (\6SE p0 <@P: g5 # xph [7S' P  @ <*@,7 @ P (0AAP\XP@Ps:4S 0 zP '0APpwP 6L'\0b@Pal\8<'08\8(WP8 t8  y&8P00P8 t8x x&8P0060S\80\8P8 s8`0S `&8P8 s8Q xP000S\80\8.P0S\80\8P@sT %0}I\8%0|A5T$A Q0:$R$ Q9ğP \0şW|t^H4   94SP 0@?S @P xs4{ 0Q0:$R##TğR#$R#W%HR3$   Ts0S1 `P 2@T VᴰRHH#00S "0S 8#xy>3S3 TE 4"P0  0@F0@Pc@kP$A?p@x0a80CP,0@, P pV0S ,w zX >0S@0 <X+4AS< ". 0 0S DwDXW5S |!'o0 0S $w8XZyXzL,0 ,N 6&q @  &t=& N,ܬ,"  !O i&Q,&   ge6  P!N,/   L'M,P,%R, HS,     1 < H c q t y  d S   !q } 1S FoP j?8%0J?` @`̠p( p$   $0Y 4 P 3SG lt t~ p~00@? ̀pܐ0LP 0S0)#0C?o27 #3RR  0R6p7P 'Szz0HpA(\ CF QJ NhP XP L P ,04! @F<#ap=q2P  @000@"0A <0N?P0'SzzpH0AR 0 B Q  z? 00B,04! ㈀@<#!0pJ  } }IR }00I? 00111F01p00 84p1<P( s1S%4p ሠ0!d 0A_ 0Z,0! <#@  0 v,0! <#@t 0p c, }D%LV,QNEFX2 IJWt=& 'Q` @-PM`p 0 PPjp ^@P 0 PP jp P;DPQ 7/PЍ+!6 @-0 0P ЍP @-0 0PЍ O-aM,MQ 0`aݍ,Ѝ@PP CyPK p>yP0 QpL4PpUu80$P 00S 3/p0$Qrbb>0Eo`YG_FPEyP 0000!Y9PP 00S 3/pO003/No -P4xP (S("!+"^j b+bVj`oP@``VBaV>+"Fj+bAj3\QQ0QUh $P 00S 3/p $QUY 0` p `` pb.x;8/0  ``px`".;6/0S3   j 2j0 0|q倁們`PU" b ,`P  T^cP"+"ib+ "`P QxP# LxP GxP BxP =xP 8xP VxT i  i` ,w|P" !O !ج,T,R: = v<=5'" 4 00A-p$[?p@` PAP0 >@ p C 01/@P00pЍpP@00003/003/$A O-UMMP\h.(@4Pv{.zr{Q`xFzipU`V`$Z^  UݍЍT  7 00 70 0P0@0Pύtz#Pp40,Z^4S =,7h400C2 7\4=1 V =6h400C26\4=1 0 00 0000 00ptp` ( A0440]40s -1yv0 00 0000 0 0zdp` 0440;40s -1ଔV4 `v00/ htE "h`5@]^ =2,XL=1Pp0Nόhp h \ m$v00?00.Z000Ӧ?'N?/&"@LlT`( Z4@0S N?/$"@4@pW04 0}10  A bh "]h Yh4!0p 1$,01( L!!>,H48 C6$ 1^(1)04 $,10 (q ,148qHL$!R  p} \ z^x# @p#P0"$1H00 4;$ B2P p>{d {@$100$10H0 0 0:0G80<@80Sp  Pt $003/$`vPM `qQ! >,!  a6$H(@GS  GPn<PM <KSI 0.$10B04!8C0(1}1S0}1$1S `4@@ꌧ,C-6& YW5&T,ج,,,W,%! ^PP$030/0@o//BO- M@MPA E0*!Rp0)Q`U0 $0 k  P y Pp ,[*%(0$0 Q|$(pP d4\,Q ܍Ѝ<4p h0Spp0 @0 4p0SW00_ , R\  000;x8,9/PI0  ,x8;;/0  ,x8;9/T0S8S0CS񟗕d 8 4 | Sn "Se S P0~  R{ <p Wv  &P d0S T"8H8 m8Rd0S ("8\0S  "8^`0S !8TX0S! S! 80CL0@ \Q\0S ` R !8~x8 .lQlh(`Q`\"TQTPHQHX @1R<0Q0}P00P0)0YP0 U @' 'pPv 0Q  cT,! , e! !O > ! T ` ! ! ! " " " }W" ! 4" :" ! ' M" ! _" ! k" s" ! " w! _! ! ! ,O-MUM08*aV"e&p'@&| teX pW &0\0 T $Q 0$ލЍ ; )qWd ^P FP!' P % @ P @pH圴` XBT0SZl d \ 0S 8$D 0P000P F0JdP14s10#5:$ W&U&S&0S N&L& 1l s0P@DPF@  pm `V X  `80p  P 0 0 ,0ST0 S00 P0p800SS40 0  0 ;x8:/P00400ST0(pp S S   Sc  SV  0 <0!s<0PPL!@  PP ,0$ 40 ( P 3 ~ 01\P( rP 0045S04+^d14  t0 S r0 it%԰ 0Ȱ 0T," h?" ," # "# Wk# 8^,;$ T$ n$ $ $ -$ $ $ $ $ $ t g# " y!O " " " " " " " " $ ' , " # # # $ k" O-AM@ MTXXp P` f@P`T $[P```OPP@Aލ Ѝԃx̓C̳ @n3(4@$80 fDP@T@@<X *P ` "P430(308 8@4A2020Y P  (딢娂  8@4p20d2@DDAT P2P"PPt$P @2 8 &PI,2,  *20)ATp !0 TP'!Y%0 Z@0S #P 0Sx H04@ 0000@;x8 8/P6  %P !%@P 0  |x @%%0 0p@W:p@!% k" =% , @ GJ)% ;% A% S% g% 8 m۶{% !% ," T,5> Wah?@-0`M2 pR !,^RЍ04P0 @ PP@4 xp8;7/P  PBLV,LX,(0@- @"!P(@LV,@-$@2S {02LV,O- p@P@B`P@   cPP@ g0Ec#ะ@pPU* ЍI >;P  8;P BI@    R0S /pt=&=@-@00 cP Q P 0 WcЍ8 C-JMM bpPBt 8>t@4PTbH*PhsP8b Yo`GFWI  pP 0000 !00P < 8<1P <08 <@XNo<0S0 0< 8`PX 40,0!= 010100 0A000@00 p@@@@t,Q@Z0S8 0S(8RJݍЍATP 08`$!QQ@0RT<0P 0 003/@<08 S 0S(0S 0S8(0S003/@<08 S@ج, x & 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@4M`pP0S4Ѝ0 0L03/P 00@ 0pP180/C-`M0MPp PPp@x; 9/PލЍ0A. PPxP;5/P A> `o% 0@o/b 0!!/P\,10/bop@-@4P0 `a1111pP\,O-P䐟䠟䰟@p`0/ C !  !0  Pr00S  0 0S 0P1SR0B 0 0`p@P X 00,0 000`00 ЍP\, P   0@-MP@/.r1, 00 0d000 0X0@@@@@10 00@0 ,Phߍ0 P\,O-P4M`@p 0SpP pPp 0S00W0#S 4Ѝ0L0 3/pPP0 L03/P+ { 0 Q{ 0S  N`0 0P  P 0 0H  , R  T  X $ \ ( ` p, 4@8Td A- 0R0 DQHa@ 1QRpB   !LAPAP&0` A0Q     TTAU @@P\,c& O-p\BMX1SL2$X\1S,2\X1S \QUЍ0C`1E`1S^_`d1SP \1 XX1! 0`1V$ 1x C H0C 0?dP 0 S 0.S  _3p `Z!X+P \X`00 0`"X~q\P \!tq000: SX1x 2 \1` 0 0 X1 ` SX10 2 ( e (_P\,& O], L' !O p@-MMPMgPoۍЍpP`@+7_ P*t+^ P*+^ P*P@PT!O p@-Ms&o@j(OJ`P7 1i< 00d P (Q7(Q i(^D  @P ލp_ſ& a4,(!) @- `@01SP@0S01S0  P\,  O-M@OP! c0  0븢p`Y  pP 0 04P0SߍP W%0]PP0 a0CS0S p `Vp08Sڠ0S' R$ S\0 0 a00  sp 0h1U0ſ0 0s0ZD+ p q`p 60P![h!R( 00@P(O  00O0 0S*?0 !C M0 = 080t00 00S 0xV<a0 %pF& > d@edA],Q& P\,4 C-H1 @1 R0  (A(h9&Q   R 0<1LPDTPapHbLP bU `1DP1 bU `1TP1 bUP1 `1b808 Up!p@ ЍC2 +!0!P\,Q!W& @-M@  P @oЍ@-| 0S pP`0 X00T T0PL008 80<, Ѝ Ѝ^,W& , ,7 ( ,,,,@-Ml@p9t)0 0 0T00.00 0 [p $0t !ЍP\,x!p@-L<94P@ A"p@xſ|& -?@-@P  ͈ R4 "(0@$^Ѝ0@ Ѝ/& & @-0  0G P L0L D@D @08 ( @0 Ѝ,h) ,7 ,,,-3M MX BP0  4kP ko3ݍ Ѝ!O 9-3M M dBP3ݍ Ѝ!O 0@-M0  0 0S@Ѝ0h0h h@PX0 PPP00L L0PD@00, ,0P,ꐧ,,& ,, ,& ( ,,,,@-0  0 P <0< 0440000 0$Ѝ ,& ,,,,,( 00!S/ /\],( 00 S/ /\],, 00S0 10 1/]],P\,11<0@ Q !@-0 " !/P\,0 10 1/P\,@-Mj/.m, 0lh6 0X 00000@0 a,@=ߍ& P\,H 0D /Q/QQ Q/P\,&@-@0 0 0@ZPЍ& @- @0S00,' 0@-AMlhP N@ [  P<04Px9]/v`0Aߍ0&' P\,"' 5' ,P@-@ 0P  Ѝ8,-@-  Ѝ Ѝ/-@-0XX0@P +D  ' Ѝ@Ѝ/>' K' t -@-0XX0@P D  & Ѝ@Ѝ/g' x' t ' >' 8@-P P P' ' ' @-@&`P@ 3oU@-@0HiP 0 P { ,,4,@-@04iP 0 P {,,,8,QA-@@1@#PP1P#T|p|` `P (B(A'b!!??8868ZA|ZC-4,7@-@+P @m 0 Ѝ0' 6&' 0@-EMu@DXP Z q_P0000U (0($x:@Eߍ0蜵,P\,9@-MtapA ^ P^Z{_H10,m<#0 01000H0 0 00 0P0 00 0PP`P#lߍpb02"lx:\ JHP (Z((Je( P\,,/ (( 1( h &X( &' @-@P !0`RxzDhP [PP YxZt P` 1X +01G@0PM@T X7Y ЍP\, &@-@<"@-0 0 Ѝ@-0 0 Ѝ0@-@M00 000 00Ѝp@-P<@0/SpQ gPp@&@- 0P,,O-$M@p`P0  P(  0PP0#P00P|0 @P rP0PySa00ͅ0݅ 000͕0ͅ$Ѝo( W,/ @,r( ,,( FO-`-,M=^$u@u ^[*pPd $]ePd@T00S@ ^PPEUM T1T!TTi$00  @$0VSS00Y00S ] 0 C H C$]0 0$0   0$ VRR   P # 2R @D j0@Q>] `P$ ]@,Ѝ( ! ( A-`pP@P!j fPP 6/ApO-@ M$q]`P Ѝp0P 0`'0VSS TP$P]-@-0 0Ѝ Ѝ/ -@-0 0Ѝ Ѝ/( x3A-`PMMpdP pLpu@D FlV '(($$cp & 0Su 0CS2PJuS0 ) 0l 0S8 0S r0S 0S QN@|AP$ d0 (T0 @nD2P| 00b0C?o2 7墏006G(30SލЍ!7SfP1Q! F?pF@7od!H1P=0 D 0L$ ' 0S q0Sv 0Sr 0So QN@P 0 0 @PYF? Q. QJFHmo) ) 0) #) ,n;) c) ,,) 7 ) DS,&ſ 2 Wn) k2,,) / / -MM P  P iۍЍ) -MM P  P TۍЍ) s@-^P' PZP E%Pt0S 3 3 (3 03 PoH` @@P QMp@TT$ЍpT ) x0|+R/ @-d|+\0XT0PL0HD0@}<08y40P\,* x,* ,!* |,,7A ,,P@-@ '0@V4,p@-@M L(@H@h0 #H ,00,0@@hU@h(Pp0: S  HP  V V܍p,th 8phQ @P@Pڰa <T@@O8 1!Eg|8<DQiX1 08808PP oQ P00S nw<  R t00 00000 000lp@ m(s(0tQ! ,w,,,,g, +* !'(  ^,,g, O-CM00qSP `@e0!`20S`PW!000 @ 42@3/@P CߍW! 000Z 0SX 0 @T W  00 0  0S l00S `  P0W0 ! !  000,,E ,<* d* 5* Ь,* P\,7@-PQ0@ SS 8`0 000] Ѝ02S  * * !O O-pUM((0 4Q 峒 2g#ß0/SCP3c܃C00P/UE`# 0SPsKWC1 lDd  PPP$ 0RP iP (a^ 0 10S 0S7 0 1S30S kP`F %p2pDP2TT 00a 40 0 0R RP 10 1000`yRP 1R QA  1S Q00R /RSR UߍP 1 00000000 P1 PP 1 1T1 'P ( 8,* ,&P\,* !O + + + + ., C-C-,* * + +@+ w+ + ) p@-Ph`@TU\pUP`fP  Mpp&5O-MM`p`` `T PP0P ^   .*@ڍЍ P P 4P+PP 4P~0xm@P8uDD  ~0X P0=S`  1 ⬴POMV P P  ꈠlP@ PT4@ ~>' 52@, X, .!/10p@-4 P@Ke 0Pp@@-G-P`4 8e@T$ `V! p0F&04 p0RSP pdPp Pp40Su p `ePp@T/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @PdP  p@=@-@ 7(5@2A-P@p`p0S 0pp R"A05#Ph0020#X0 0Q #"0hPhp P#"4`V000S 3/0Q #"04P4 A-8pЍPp@n` ! p|ᗶ psᎶ mሶ 0٦`ံV붹 tt@t s P\P LP >@_T }D%W~, 2p, p@-MMP`;  p  @p LePQHePۍЍpIA-@P cT`p P  0QzPS|d zd@@-M MPp; P`R p  @0PRP UePۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HPc00/00/40@-\80S0 S0010\80S dd@ 0!SR0(SS QU S!0$0S\  0!1Sp@- l@$\ P0!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X !40S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4  B(B(Rt01 408 00803/P,000403/,, H0 , 4 T 8 X !000/0O-p4M@ PPp`314ЍO%0 L03/P% Ѐ 0\ p* @D Z["H* 0*P T P , [p b8``pp 0S0P 004Ѝ0ܬ,O-P4`弁弑弡@ Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P  p!"00 0  `0RPH P00P0 < Q Q  Q R [ _ H \ H H ܎ 0O-Mc(0<00PSp@p`00 $ 80s!3 0\h0r@l0S@3p` 0`@  L3R0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0002Dp0 0 ~\HL0 48 u\00(,(, 00 0h\P23V 4o0p0P<0SQP0 N T00SJ0S[000q p0 j0 Q0 000000  `0 F0 00000PX 00808/>T0 PpQXQ Q(00,0 0p4 80 [`\p a X0S p^ 0$0p0 0(00,0  04 808p 8 0o,,Y- o,- W- C-`FlM0pSP^x S0SXS0S S0S$S0S S0SGS0SHS0SIS0SJS0SS0SlS0SaS0S000$ R(000 "0A W(40S  0$S $SS $S)400 0$4 0M[0E( XbS0ST4 TQQD00Q00S ,4Q ,4 (lЍC W3W0V W LW U 48P Qb Q(0 L3003 0[0  lЍ\300T3 0Z0 0HS(0p`@ 0  SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@,0 <", vP0   R>0 u H0L0 n H0L0 g H0L0 ` H0L0 Y H0L0 hR H0L0  PK H0L0@ 8D H0L0U lЍC; !SH000050PpG0  d 9/0 00(0F0o,~[ _ ܎ 0,,W- - - H H H |k - k ] - - - - - . . . . ". \ C- pQ0EMPE0@ (000S 0CSEߍh0 3/``0d 9/0 00(00 ``>0 0pp07/@-M0@0 3/P 0 004000 003/ލ@-`,MHP L@0 0 0PP@00 RS THP pW ZP00P00P0,Ѝ @T@0/W/0  0mLH P00P0t=&0@-$M@D0X  0P 00 00,0PGH0Dd$Ѝ0- G-%(Mp{@PW dR`a `\PTK`G0,` SS0 Q "S `P  P !X$U0!$U ` 0 \0 0000 0 0000% 0MuPPPW(ЍJ !+. D!6. HI 40C-S,MP80S,ЍS S S !S S @P p萟``9`X 0 000  00000 0 00 0 0M`PY,!K  ^ 0K O-P(AM@0pP U ! `<#0!(p<#UP <aP IK00 P WP  K0O00PJX!@kD 0 0 p `@AB7A  !@P|Q00LC*  T!0C-!  0!0 :D`pPP@!@3@PT -`\T@D@`0@@< 0 0K-\0 0@`0 P .㨠嬰l 00@p `DAߍ!00PRPNW0,o,j. . ſ5O--0AMDpP$VPO -@04`PD X,@0D ,`0S40 ,0 ñXT,  0$ p0pC0$ <0@0 0R80D <0 80 0S h42@@00]? 0$4@00 0A000 00@@@0SH8wP R0P40 0H03/0S0@, p p0C @@0D @000Nj`pH0SPP 1x'x0p(1@P ! B B2"@A$,0&D ,0R BD"[, [ 0 R80p@n I0 Rp0x1Gx1p#0q000AߍD0` ⇁0L03/ 00`0:x  Q * Bq Bq BQ B B  0[Ȱ 0@` X@@p0 0,(00 @@@@@ p@@`PmUߍ pv'0/ `∀pD`H 008*0A-@0<0SH04 `pPVV09V?V090VP:0!Abq0S/A-@P0\03/0 0    `0V R!  B B" B10C+Rp0 !""P! 0 `pPP !@` B"B000>000$0 01P0100A5t O-OM@P H(TZa1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,zpP5Oߍş[@dşP @T00C0p0NC2 VH0 0$ 0RԴ V 08L0X T3/P1]0 00H03/ T 0 0000 3/P#%#t&0 080x 3/0Plp YX̍ 0 0|30x300 07000F00, !@ j01 SH0 V p .4t+`X0 PP00P0003/088q0X 0L03/l 0 , t T x X h H  0T`X 006/P `0d Q 10  0!s"D  V p0 BkAD!2 B"aA1ᴡ0C100C0 gY `V`s`V T00 03/P0 0D 2#4`0Z5 P0a 0` 0d0 D p 00C"AD!2 B"A10C10 0?o2100C0- !V ܬ,X!![  !S M A-Pp`a!@T0P  p0Q p@p X:`P !@ B"@ XT0 01`0(`10q0000Wm 0S/ LP0 05/00P 8p<  @  0P4L p P $ Q:  BS:Aߍ L`0 (06/(0Pf 8< b @_0`4 V  V  R U  U  RE ,A0  ( %S( 0P S ( p,$ ( ,0P 0 pP`=p0  S 0P@Rp`LPz` Pp `P@ 0` O-0AM@ꈧ,0,. O-`4M0@\0P3/0 X ĀX p ppP(W 0Y2 2Z  "00 .  !" 01 " X e/  !"0  0n/ " ]/  !" 00CCW t2t"ttlV0E0 0\20X20T2 0J000 080P<1,pp@12((4Ѝ嗓)08q P ,0S,0PZH D00Z0V 0P P`%0,00啽0P8 @ 0S[00S[ ZP kP00S`(}0,(00V,000 0X3/`m o,t \ hd |L . X !l6. O \a ro,!O @-@P0/SP/QWP0S0!O O-pMCO TtUl4{ 00 rs= 8b0  * 0u P  0@0 B )R RQPR Q0r Q0CFS0TR000US00Ѝ@0  4PT00U00X@0 \%D1R4 !8R0 !R, R-RH T00U0(xI@ PP 0R 0R [X T00U00} [XxT00U 000/SS<p !Hp,IAp,#/ Kp,WT8 T,q, 8T8t,!O O-0MSأ@pЍ`  3W @000PS8 cSG MS  0 mS  sS. gSR  0P 0S cS !MS @MSCS GS W+0C?o20S 000 00SSSR mS @ R O-OM M<00(00 P08 @0 (0PP0@D00P P,0 0H03/800<00 0!6 0R 0 , 03/ 0`` S04 H&P408&XU\a`0$040&00000$0o,`p`0pH0LWX0h05R0p0l_h " `Vp SVh `U TNh PUHh  VU 00,0 TP o씟0`080PS<0dP0O>0=C0H0 8<0 P$x8U 0S T0 Pn0 000H0P0 F0TPT0S Xx8QP 0S40Q00`Q0S 0 L0aA3/P 0P P  2/``dF  pBX!ZP0?OUP(0 Z [ Q PD @0    SD0 R8X ' a`0"$0$000,000$0%$0t H 0zOx 0 \0  0lO` 0$ F0bOȐ 0 0l01h 0Lt0hp*H+B+ B  Z*pV 0 T nU 00d0 Tn08 TnT0P0($00 Q030#Q0S $0A,0"PHhtp 0(P &A00P3/` 0``APQ1V P(0 [ J Z C8P8ЍpMPUJ0 00  0 Y>P@o\1A-MMPM   >< ܍/ 0@-MP@q  q>k  k> 0TsP< ߍ0/ @-@R@A-pPlC`b@P P  P@0 !oPP Ѝ0$ D/ H,p@-@P4Sp@Tp$ T@PpDpH,/ G-px`DTP \LPP@8 0 3PP$0R04fH,/ A-TP4SAp`4! 4 @0= = DH,A-@4Sxp04TU TU T`040 /0 4'H,/ p@-@P 0p@a5p@-@P# @2op/    @-o@-o@-o 0P/H,0@-PM 0 xPP>< 函 0PP @H4<D;P05P0Ѝ0@Ŀ !0 0 \,@-#@DA-A0J?`V=p$X"0 KPPЍ >p C 01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$aT,B$0pQ@-4i[ #"T R0//s@-(@T@ЍpH0P0 0w003/@Pw<./@-tM`P Q@0 p@@"P  20@Tp@tЍT0 @T0x p0p d p G`P P s,20 !O ;0 J0 \,`0 D0 l0 ,y0 0 /@-K @0 A ///@-0@Q TǺ@o?0 \ 0P000@-4MP0 2NX0@T J 0    @ 0$4Ѝ0I@0\,//G-pᐐP@`VT0S0S _JP$1H0PUI0 X I0 `p@D0 \,0SR00/p@-@PH<0<`P" 6D0# A@$!p舧,0,A-`8P@#JpP( ; A`,@-p@-@M @M0p I0S XTPP00` V 88 0, ܍pbc ,Z0 0 0 1G-`1MP@11P!N/  ttatazp@Ph7PsPNaL 0[㱹ߍ BjfB?@ pP0=SBt@ ?q@B?`@P ; BQPp@p P X0 wA@ qA9>' (%!/ 1 ,51 1 &1 1A-P1@,dp11PT N/P`P`  P @ JA ,,d,9A1 K1 c1 v1 1 @-M00200p00`0P0<@P r@T 1\ 1T1H 1  P1 1 Ѝ{Q1 :;$0 @- PP DS,C-`CM P@ `L>P pܐ܀0` 0`0S1 1 Cߍ5S  Ot tP\ ``r\0S H S1, 1 ,1 ,;,1 1 2 ,2 I2 :ʸIp@-P@1 1  p蜵,1p@-P`[P@W0  p@(j2 p@-P@ᦸuP $c11P   pv2 7U1p@-@Pひ1(1 JP1 1 p2 U@-z@:v2 C-[M@,hKT[B嬂rP`U U.S20P$0 ZdPZ l"0(@80ZPW H"(PU ( >$ 0(P@>PK6O?PL0P P1N?0PU)!(A`hPp0S7 S1  @K 0 0`P@P\1M㭷 PYP [ߍ@a!0>ZPX 0(40P0@E9 CH=9   & 0F 0 0 h000  ڴ@ᶱ%&,,,2 2 53 9 , ,,,2 3 7C-C- ̥ JA-P$p2a@P-@T ' q!P( 0 ѿP 0 Z? P >@uoЍW``qvX C< 0㦿U3 ,e3 4 (4 %3 3 3 4 h//O-c@T Ѝ@T@T) ^' P@ U[Z [Сԑ YZ PUPE P P$P@ P$@0"/ᬻ,O-4MpZ$ (%t,@P @ PR000f 000V0 0rE  0V @P 0gE@TPT0@P0 0 00000 0 T0$000R0#02S4Ѝ; 0 0 0S  R# S   @ 0  00PV@00V @P 0E@TPT0@P RK RH RE (  , ZQ R Z5 TT  Z! 0 S0 0@PV00V @P 0D@TPT0 0@PT00@PT Q Q0   ,0@-4MP!! 0 P P P@4Ѝ0@/@-@ پ@64 p@-P@/JP `@ H0P P `Ra BQQ pQQ 0@S:p @-Hr0RH #@-k70@-@P4M0S!1PP Q*  P +U 0@S Q 0S4Ѝ0괻,p@-0@ ^T00PUPU' \$ST /p 2@Q^U@.P@ @$ $ 0 00C 0p0 F4 }p@-,@PH0P ;pA-@d`dPp㌀0SaT 0@P"Rp@P !, 00S@- /ᐔ,,C-ẋ(pX,P0`@$ 0АYĐY T  T: X0WaU U VP P 0U Ѝ 6V0  4 4 F& K& @-@P 0  \G@R I!!4 p@-@P0S|Tt 00 Tp0"SD0 <00Rp( T4p 0ꐔ,,,G-Ph`0Sp;@S S 2@1+1:X =p  QBp\T.@T&RQ0000(Q $C Q 0S T v5 0@1 00 0TRTR"01괻,zp@-P@q@op1O-@0pS`P  0PQQQS SK0UȰС0r 0 $^0 0"90(Q $mC0, 1QX#  E vQ 050  R [ R pR L0L L^F R# Ѝ 0W1Q:P ꐔ,4 X!!4 p@-PL@0St!U 0E p(0"PE0U055403 0(2#p萔,,,40@-@0SZDP0@0ӕꐔ, !A-PA`0SH!U 0E p@0SV Ѝ 4 U(0@⧶`P 0`4p0@00 F` 0Pp5H p `< P0+0'p(0,0`ꐔ,,,- r 5 1A-P0pS@`  0PQQL SD0 F2  0 r!Rv?000  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` ꐔ,E@- @t00S T 凲Ѝ2sX0O-SMM2"EE\0@S2"`0S2"bd0S2l"h0St2P"pH =40SL80S 84 SRN80S %, 70pHPASTPPEP @R@s`P. @  \00`0d  00h X ph;S \L!L@0P@q_oRݍЍ0 :S 000a 1 00 0 [0 0C0 O;0CS||HPp(5 v!!4 @5 Y5 q5 5 5 t=&k75 5 5 5 6 6 !t N6 ^6 '6 ?6 $6 Xp@-@TP0S!R+)r00 S @ 0N Dp贻,O--BM MX\pᦴ@P 0`^ ;( `pʵBލ ЍH0 P᾵  Q 0  d00 0 w$0!`4pX00 pv`$(00C0;S k PSPW +RQ 0P \P SD0Rpʨ0S S 00S 00 0`S0S000000000 P 0S  2 0 R$ ?! 0$ S0S 0$ iedAt6 O-$p6# S0 ? P`;#S0?p0 d00`0\ h0x00X P$`P`l0(08 Hq000 00 00p;!!5 @-`X0S0 gBC\0@S0 h`0S0| id0St0` jh0S\0D kpP S 0&[ Ѝ(5 x"!4 @5 Y5 q5 5 O-TM000 0400,00(0 0$ 80 0P! 0`@ @vP$0SUФpp Q 0U U H0!<01PRPp>PUp<0L @P PUDp p0S H0L H00LS40D 0@0Pp0P4p S 0  S PS p0S; S S 21+1:$0S Lï$0,  QB\X<X4RQ2ȠP,$0&$0(Q $Y?(0 S ! 0S H (v}180ƀ1 0$ 0 0 0S0 0S 0$ TЍXRXB"01,zO-P0M@DTЍpРа`@D0S W0@  0  0`P1/Y  S      Q R  0@0Q0 0`Pp1/P 꼻,!!A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-@p`P1S 3/P @`VTd0@@T0P0S@000S4000S(0000A""!,,!!&!P-!p@-@4`4P0Sp@10S 3/@꼻,,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp` ^$ 4R R0 0`40$ Rp `083/< 0 2 `P    000 0S0\000  00//00/00/00/10/Q@-@@ 0A0003/P@$  @ 5C-`BEM0SP;0p 50S50S| 40Sd40S 40S0ݭ40S֭40S00$ R!000 V F 3@&> 0!C> f`.0 010@0`Wތ(,,6 5O-MP庬0@嶬0` P(" `b0  3000 ;p!@䡟000 ~;!币P00p@儬 G@p@$װpd\3@gt  H!0 <k  $!`0a! 0pz0 R  . P.Ѝ 0p!D0i `^ ` -OT 0p-0@0 NR S3#:`@0W0,,- ݌I,6 6 6 ,6 ſ0A-@\0`3/ pW@@P@P+P< 0DW  \-W0 U  .  ! 0  0n/ 1  |   ]/  "` , 000SJCT H0H HH>0B@@@ qI,  6 "!y 7 s@-@,`P01Ѝp(,0p@-(M0P,03/`î0@ S:000 00 0 0 0 p` ҥ0A0?ׯ(Ѝp0` O-@-MP4,PЍ ܮpP 0p r@ @< 3? PZ0H03/0S@`H@`A0 0\`P |" 0 Q"l2 2h"]? 0 0 000 0A 0 0 0$勨g֨n0Sc("0P L0 3/P X0P@T`@\0`0 S8P\ 80S ,0 0, S001z40P ∡0L0 3/0 0P00;p8`$0`4Z 4!0 `R 40000 40,0 p|0$100$10\ \0d00h0@ 0l0`p:00S<p0  PÁ| ,]? 000000 000 0  0p0fGp` 73d,0ጤl0S> S@; SN`p%P H3/P 0p0072|0 00p L03/P x0| 0 00S 00CS`p 0SV iP2Q eЍ-P00SZ 3/@@OoBS f00&0| 1@0@!Rt!@!x@|@pPpt@媠t0S|0X*@DP PQ 0!@x 0T:x0S@ 刪t@OoB|@|0xT:|@T,I7 "! 7 ,(,h  RW08ſ  , m ,a7 >O-UM< SD [/080<44@`P pPE Uߍ0P P00,Q63, 040S 0R@ <0S6(1SL 0L ,HLAP4#0C4  H@4#; $孥媥 @0P˧P @T 2"B 00P 0S 3/P,00,02, 0SU@`PD`D@t w X2Ru Y8N nH@`i(HD! @<#P`T@WP ` \,@ Y,,V,,00 0040H @ᷥ J,   , 嬥 ?,, 壥ᆩ4,40P1: 1 !  7 @0 000000 00000 0p` DYD0U0 Q[T Y TRP0Nv ᰢ`E긻,,Wo7 mn7 "! 7 O-JM M/0`@0PP+&P) 0S% t"`0`r`!`/90P T  0CT *0C/Q 00P9@m+& P:9?0  P+0: S `V9>00ꨰ  PJ>0@0/S5 0+ U& S fP+ I& P*iP 0/S`0oo`bS V+pS+0&000 SV|+% P*+% P*aPZ9@_V9@]ZJލ ЍT 7 / !O @-HH)@-M @P(0  (@P  P 4Ѝ00S:$c(#"c  8#8S O-M` `%PPp X㼠弰`pV*P"Ѝ0S @ P 0 QpL匤P Xp $0 @Ԭa8 7 P7 G-Mx `P`P PP<+%@P@u  0᧬@ @PB+J_%;J.0㊬3+JP%,J.X0{T$X tPP~D4 kPPu$0+J0% J.0[PPe +J % J?` DPPN +㈁刑PJ%hp0 0J>/P 0. %P UT ,ލtP@Y+J$JsPPpJ.@0+$ P h lJ>PR 7 7 7 7 7 7 7 8 G8 &8 98 " F8 W8 V8 &7 *7 7 8 d/ 8 /00/00/00/00/0@-4M@0#|0$P 01P` P0T0670 P冢 IP @j$צ4Ѝ0舧,0,@,O-MA Ad2(000PB(0 0000= 80s#0(0`p[05 0=1%500%`f0$0 0$0S000`5_`@ @`兜@0S 80< 03/P0p80<P Ѝpv'80s D@0 0 0Q:8`0S0` L0$3/$P & [P T0 SW`vp p 0 T$` 0$00  0 0 0#ڡ400 0`00P00 0S$0Sr D ڥ3 D0Sa @Z%S[eP*%0C?o2 00;0, 0H03/$0, S`pH0LC +0V   0|0 X00;000P0 pX00  00 (00P 0 00 0S r(0 8DQ0v1;0H0$0L01 0,!<10$00H, `|1, P 0Q00000S p, j1, P0,0 [wR0,4  X14 P Y p00p,0Y08p,B YP P 0,00000;0(\cQ  k,00Zꈧ,9W9 0,/ t=&T,* !O C-pQ|MW0PSSp` 000 P  "  /" 0@T0 S>T2x@X"&(@@@,0S:0啠,"(0PP@  00+0@080s=0 0( RT ҤW|Ѝ#o!@&(00\1 0L/`!00 XTƴ@!0(Pp R P@@ F!0 0 h0@< 0400t0S00XT坴00P0 $P@| 0(=@l @8q 3/Pꈧ,"9 f,9 89 - 9 )9 19 0@-)@MT0 p\*3 +@,P 03*P y,-ڟ F 0.П0  0Ѝ0!0P8q0 S+P ,㵟P !H Xſ0,"!G9 , A- @"(0M3( x0PQ2d2 5  L! n/ @!, 1 0 4!8 @`0$ P$p 0PUp 0S0p\(Pp,P(FAȜ(00FC0Ѝ0`0 PCp0 L03/P 000P 0p0  UPp0 "!h O-p4@`00Y)Z]p !!夢PV 0p  0 P 02Q 0S   00,0 84p $0T0 0X05p0 P,[.[ P Q  0-/0 P8q84p T$00Q[ 0  Q QPPZ 00 00 Ѝl2O-M04p@$WP `ޡPP $0 Sz22@|x]?  0100 0A00000@lܘlKx0SS(PPL p0(P嚡!1P0PA x 0R`( b ",0x  Bz =2 92 0 8UPh l庾,0( 040x0?o21000Ѝ0ᇾᄾT, TO-pᬁ嬑嬡,M@0 S0 0000 /00e0S,Ѝ/S  #/00P`pU1(y`P p㘁!rPP PP%0(` 1`1 10400,00 `T00X08`0100' .P 0 0Ý P`ꌧ,V{O-p\M@P4 `儰10 SpU 0 Q$0S   $ p宠P9\ЍO|*.1' P: 0pR  ,`VT` V 0 0 9 .`00000Y3(0S` ` 0 RH03/0p``0[   80s pȟ0PP00@0  BR0S0SP 0[p08 r  *   * U0'0U " [P R 0S  0+ PP p00 . P 0$ PU$p0p[0 ^[np0 PUp[h0[( d!P$: p00 00$0 0 $0 0S 0X +XZ 0 0P pZ$0 0 S)70 0S  0n+ 00#0 P.S 0UPpС0Z 3@ D Z0)  Z$ RRp 0S  S0 0Q0000 00000000 \Ѝp  0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S iP 0 0 , 0R0S00`R  ,P` ,P 0 Q ``T R T  R X `( 0Sl0( L03/P <00S D0SS000(( qTL0( 3/P 80<00S (0, S004 Q 0( `N20PP0Z0[ U0s P 0$p$ PUp0 80sd0 : 0  U0 W[p㐁! 0 QQ 80s 0  00UPpp0  R 0S  0"* @p0  0  .ܬ,(#!T,,%!!O * O-@-M`,p0 40PVY p-pPT Pp0Z:`PU`J6ERUA 6&-00#h R 0  80s0`F`pHU p  /h0S 00  80spHY pPp .h0 0l0L03/, 00Y:pPp p0ӝ0P80h5ЍOp0H03/,08$ $( 0RPP$P(0<00WR:< R4*,0, 0$` 0S `0S< p$`Sp $ PR( P`$ (0W)PU` P0 Sb@D S [0S 0 8P`p0VT:00S40000040,0(pWr싟8`0[:8`ppVp < p00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0(`V`P p0l  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0P~0H03/u8P0@00D00Z|*p 0<0 `80s_00\ <0 0RV04@ RD0  0H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/008 000@0 `0[ `0  J( V00 400Pm۶\9 %!]9 ܬ,! 0 0Q4 0ppP80s00  h0S l Y|* 0L03/Po !0 儐X09/Pe 웟000400$00(0 0$0 0S(0   0H3/P, X$ 0 03/p8  0L03/ pPpP$0( 0S pP(0$ ' W00 40000400$00(0 0$0( 0c<,$ 0 0 0  0H3/P0`q 0R04$( $ R( 0  0H3/P* $ %P 0 0X 0T80,3/00T00X \ $ ` ( Sd ,  ,0S} P0 P  R0P0u000400$00(0 0$0( 0c<,$ 0 0 0  0H3/PP80sb 00_ Q Z 0 SW 0 SL0  3/P@D0 RP RP0{0 80X T,3/00T00X0 0\0$0`0(0d0,0 0Sc 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQCPp`,0 0UB:8.  0$ $0S  p p0 R\p`P p0i"P0R[p Z[ Yl:PpW 00U0#S~ p`Ѝ茀 8/ #"08,0,0 L03/P 00p开8S  8y\ X W08P@DH0P0000 80sp 8Hp0!8p 40X 00 0S 0P*` p p+80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPq 00 80sh p E+Php@-@P(M(0S*(`,`W000P0 F0 0PP` p P(^P,(C(P(Ѝp0000,埔(70,`(PC-TR@,O-`XM)1$qS W W(!0 "@PЍ00> p C 0 1/pP0$q Q 0 >  1/@P@p 0X: @1S<1@1X\>ACl70(0Sp, H<#0@ 0 '8  '0 0 W &%, c0_80000,  0 0Q0L80000  0'ݿX奖0=0H9H0P00T0(0P X0L*W0 000850p0  %  %  P%,  (P 0 %<  ]? 000000 000 000ffpp V05P,0<᫓XpW) 0GSC0.>( CP$ 00S H @3/Wv@DpH L0] YZX03/ 0 05@0 L03/P 00S 0SpW+ WP70pH03/ 0! P7/P%$%$)@0 Q1TYK @1003/Q  01/ 0S 2",($Є  0;P  0 Hp0  @D@儀 0X80X> BPn㉕Km,0S a%pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000T,,Wp408ſ , m !O 9 %!9 @-} 04M@Pp`#@0S $d0 L03/P 80< 0 ` 80< 8PUV`4Ѝ R00S 0 //O-`Yp@P 0< #80 s#  002 -(  0 S R( 0S%  吁( R Q0 2(T 0  < {+800r"000S   r$ 1 SR8C801/ᐘ,0! /ᐘ,$1p@-S@ x1SP $003/p@Nx1KP$1 0SO-KMM@040`DpPH(00S >I @' 0o- 0<0%"P{ 娻 K@T8p]? 00U 0 00000@00 ,@@@@0ppK܍Ѝ(d(0S*o< !8 ;c&@@ O-M0M,0p1`h@0pP 0S (0 S> 9 H`'00 0 <0.%"P@~40k`0V,p]? 0000000U 0 0000000 00Ȑp`ލЍ,➍ ,0S*< !, 00B"X R00C0C0000S0 0,0A$Pꐘ, -@-@ '0  !<$10(10,1P001.@-@&0 0! 0O-,MTPPT`0p R+,Ѝ "P9 @@5/P`K &` V`G2 & "0  00 0(0 00 7`႐0,ЍO/@Z:p@-@Q-<==@=X=p=P姒 0  P堒40 P㚒<0d p@kPP呒80 P<勒,0 P(兒00 p&9 '9 )*+p@-PBMH`@s [ V>8>d>>>>\??4?t????P\0 .PS $Bߍp`H00PSB0`=40P`780S80P8 4 X0S,!F@#0 P\0 `0S 0@ ` d0Ph0Sڬ  @l0Sڄ @xp0SD  @T`t0P]9 99 :;t=>: : ?qVABC@-PAMH`@̑  V(@A(APAxAD`qK0 @00S  k  g8`V@婑 0 P塑0 sAߍ(0Sx  ᳱ@#,0SP  ᩱ@@00S0  ៱@ ]6 .9 /qV1: 2@-0AMP@0Q* BBC C"U0S1 `F` Ა댣0p⇞ 0S 8 4`,pYV o$ 8ᙐ0`m 000"  `Ẓߍ@Z 0  0S  s `pV E 0  1 PSN0  L3 0  0S @0S@$ ߍG<0040!005@0Fo$ 0DL03/00 Fppqr0S !0LD` 0S  p8` V(a0 x Q0W 8 < RFO    0 /@-@ 0  e R0Wt 0ҭ  : ; ;< 6 - ; %5!; /; w7; -o6 @-x @u!+0 @0p0兓d@ 孏A; @-@ @b!000(0,0000pd@ 嘏ꐯJ; p@-`TQJM0@s]/   0Ȋ1S:`RxRRSS(SᙇJߍp0@ 00 @@0华(@_0 (S0 0(0000 0z(iAP(eA0P,@(P0@00&3qV56p@-0QPM,0$0`s@]/  ( 0h$1 SIST TI1P/S X(➇0(0 00d0SvU (  0S `Pps ď00!15:% p ⸏P q Q 0, ($! p h$ 㤏P^0 0 8a4Q101T/᤹,,ج,7 W< !O 98 E< < 0S@0@-S@00 0S/,O-0زEM 02@PT PP0 2P |1S$ $P| 003/P `2P X a@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 pPP2@0S- $P* 0 x0D 0S|,L,= , , x,(,= A-0M$AT@ Q 0P`p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T @ TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 |,L,x,(,,,\0p@-T00P SDPPp0AS@  1SAD,T,ج,0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S",p0\ Q0/\P  ^U Q0000@-,O-GM0M40d2@`T]? 00V 0 0000000@@@@  h0:p@c<   G܍Ѝ$1SpA08 L03/P H0Z Z ZT0S p$ 0ST0S8 P P0  KO,0h 0 t0`@W 47 4|4 VH0G, <0," Bج, ,0@-DMP@T P08 @\0 D@  d  0 0DЍ00Sꐘ,0@-@DMP/ P0, P\0 P  T  0 R X  0S0000000 0DЍ000Sꐘ,p@-@Q@M`P<@P  T0 0SP@Ѝp@+0@00 D0U@Ѝp萘,17@-@SW글ЀL؁ Ѝ0!{P4PP<<0P0<0P0<0P0<04PP<0 S, 0<0P<0 S@  0"{080#{0,0${00000u}@-@PD ;x , t 0 p 4 l 08 U,0<    0 0x` 6/Ѝp@IЍp诞+u@-@$P04ML0` p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-|M@8 P 0 $唯<  <Uၺ 0$bP0 |! |Ѝ0T,80@-S`4M@Pc00 0P 003/00$1U Ut  4ЍS0  000 0xp 7/( (0׉ F& = % p@-00MPQ0@$ 00x` 6/< 㸉`Px1x1a1S0C€10Ѝp= p@-@<P ᥼P $ 㝉Pp0S@}p ᒼP ㊉Pp0S 4! B! }P  uPp0Sp mP R P0 a< \Ppp >  > -> ;> P> O-uM M4p Z-H0cS_ C 0SS zB0S 7PBؒ0SzȲB0Sy2 P    P 2     PT2 LH   @  P00002 @@K @xP@ PHPP< ,h@ ,D@.1 0101010R0 0K000PP0 `}p@  PSyU} 0S10$1S10 0Suݍ Ѝ㤂P`H㝂Pj㖂Pi1S |!R |㏧P  &,x,(,,,|,L,,, ,,,,,,p7HK@7T,ج,_@-@C00S @PX꨹,g> @-@PЍp$QU0 &`P > PP C 01/P ,00 H$L Q>T,80S 0 @-/p&!m {> G-`ᔐ唠@PX0r2 S80S00 00S80S0|1 P S$1S00 0UOp@-8M`8 @ T P $Qz$00S U  0|1 08Ѝp)P ႭP P Q 1 ᮺ P n ᶭ 5P ꐘ,A-M|8 PiU`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `p<XDD2 08 8/PD> 0!! `7# 0 3/P"0#"#0 03/p 0` L03/ⳬ 0=p` 0SWp`?`B414!440<0S P L3/00 L03/P @0D t0Rxp`00 L03/P @0D t0R 4 d00`RP  v00`p 0Sv  0|1 0@%!~&! {> ,G-`RMXr@ uPP8 &P(` `SP P7  =p 0S  ^~ߍ<08 H(00,0 0000400!4 04$0D0(0P cWP h pJH p < 0n 0 `E rT T T T T , œp 0`?`a8SĺPb   00*P*00  0* Mod@edAdozd@o|oooooA-CMMPPp`;8 vp@P  0PAP0U00 ## CލЍ /O- &!> @-@ 㣄@> p@-`0@PTPpD P  P @P@- 4MHPL` 0 1 pjP4ЍHy~@P 00᧷P0PS08080#1 PU0``PU`@00< P$`D0HB &!> &!0@-0\S00$P (0 0R` DO-PA0pX :S0 0<0{~0P0p<` (  FP@p<  l0P 2! !180 04 0 PpW00040080ꠘ,1&!'!@-0@0T ^3#%:/o" ^Q0 t 0Q    $ ( ,   @(!O-EM8AT& `pzP儰0 P @0S + 'T P40 p僃oEߍ2 (!v<? A-@0PpUP3#:/o"P RP`0SmFzW@000000Pꠘ,O-]MMp60ŝ60@` TP 3 # :/o"P Rh\   Z DQbQ_Rw 03# @JQ R Z0h3h#pR00S; 0 0P  !R431TQ  @#-#-@0S D0S<# #@ "0;.+PP 0 YpJ0S) ]ލЍR00SD0S0 @2.C@0\Qg"ᷙ00 D@z@0Sа $ !p (,0QE $0X |Pt0 Pភ 0S0Z00g Z ZP 0㛓#000X  4   9,( [: }T  x P ؀ \Q 0R\   0R8 8 "? l)!> &!? ydt=&|d{dЀ> H: ! 0$\ (00S l S  S00/Q 0P//0S 0S P/!R808 88@- R )r0@/;? )!> 80R*@-0M@"P0 0! 0!  P0Ѝ/00S/ꠘ,Tp@-@(P0S0S0< 4 p蠘,@-@0S蠘,A-@lP0ST 0S` @ <0P@`PV@ꠘ,S@-@P ' dP { Ѝ<P {`P ((PP )$P` zP tP(  lP` D|bPpp-YPP 0SP` P Q`P @00@0P? W? ]? c? k? q? x? (!0@-M  㞀Pڔx P p@tPxPA|=|Ѝ0X0S  (0f? X)!!O-M M@@P;B/$@/`P!$ ]p 00@QD0S.8 R( (y0( €P0D0 ܍ Ѝ y P P    0xP 4@cT4@0@T0@袟brT{ 0 700#ᄀp{@0T  00#x #r0000D ` (+ (00#?P X\ 040RP`d 8<0RP,w0( S 0`0#DPDpl]P `p#6Pu@ph W W#\`)Ph@4qP_ pp#iPV0'% D0S(0 D (y0{S  0 ( 0 0{@00 #B@#000@T(0 0 0{d@? ? ? !w@ O@ ? ? @ 1@ DG@ @-M0 0,s 0@S|( zPXvT x@08ⵖ8 P 0  Z Ѝr3)!> @-t0SЍ@-M@ sT0  CR$00S ЍvA-@lP0ST 0S` @ ,2A ;A ,MA X!6 v)!|d@-邝 0P 0P蘵,,-,M0$00 0 00 00 00 00 0 00000000 |,Ѝ7@-@ P00~0 0x0 0r000 P   S Ѝ0C-M@pP `\ X0 0R0000 0 0H0sS 0lSp@ P$0㓄( p l@ P 0㓔) p Ѝ@T@Tp*!C-`P B "-!A @-1` QP@1`qdQ@-!A P-!>p@-@pP0S0ST 0DSTPS$D  p# @0p贘,`,08S^-/`,X,p@- @ 0(  P0R0PS 00Si ppC-NMMP<Ѐ@` u0  ` P`Pᵉ000 ;@PD 'pNލЍ貇 g? ydG-xM` ✐堠@pLP! !0@P 0S PU 0 R<D1D!DD'00S 00" !P@&P0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍY Y ZL   YZ( ( )8B 8.! A > H: ! O-`BMMp@P/0; @Y0P0p@ X h;   f P'  y BލЍ jP  0 0  rf0/SX m0H, m!14"So[ 1 SR 1S  RS1S1Sr`2p?B冟@0Q g0 STS "0SO[@kpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 0\뙤G00 " "io@ U01U01XOMURXA- 0MHL`Pp p1p!ppP8k@P( T00f 0R`0 !?020!2002p204 pClP0Ѝ 0PS" $0Q00 L03/P Q P0Q    R D0QR003/'A L.!A >`,P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @ P^U0PP 8^ @T ,gP ` ` `b` ` p Sp`" 2 `q`!~``Pa k00`U08qRP08}/ ^Q 0S`P82S01111111110 8m2~/P/<`0Xh40S0St  P p2S222<040WP 2SX.JB O-bM M Q 00P $00/;R0P0`bލ Ѝ$ zp `xy?00@ ,(Z 2S 1S(2("((0@0 Ḁἰ  &      0S@!?⪻Dp  0 e UD ; (DdPVbVT&PRQ 0 p  W p!p'q ?p? @p  W p!p'q?p0?_h@P  pd?WU E ,(v pcj?W U `d@_.!A Us@-RU0 @`d0T `Š P";0H0`04 oЍpB i.! A B @-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0.80@0 0",<< . 0`,ܬ,O-P@pdM04005Q 0} Q Xg QP8B0^  RW* ,50'D0Q   R0RS }υ0^ @^TX 0SQQY WvpdЍb004@F@  0T@TT0@ 0@4P SI 0`P P\ X 0`VBT@`00T40^21 SR8080<0 0Q"80 0<0$0 0,0q?Ⲡr?020 2S 01 (, (0 PO W2m`!R   R" 2S SP 2qrⰠs?0 Ȍ \ 00 0 0\ 0W82?h "QR 0S2"02#38^0WN dJ,0 (S$ 0 802o0 <04pP6 @0 Ē2Z02H[ 1P[ 0h 0L0S 1P0S`10T80< q?r0 8Z o0 g^Q  Rl0 ~/O ` 0( R 0C0#80`,B B {.!TA .!lO-40|M@0HX0(S S|ЍS S5 ( [x8x(xxD S0} @(00$0,,QT@0S0(S$0000Q 00S 0[SX v?70QP"~, 4š $(( (00) 00P0U00( 000$00 00 U00040 080408 0,000, S 0 08BX6yu? v?( $R BT@200r/q?`0sh 00(` 0R   T R,0S0u0<0f<0pP=X50~=\0o_P"0Ha``V PV gᵟ0( 8  v@0o/O @0S U SQ0-  R 000 0/ !o/ S㴲< $ 0 ,0S00@P0PT0zTX2t"0S0 `  0 D @@0D`PD0pS0 00@P[SHPLp0K0000 0g Q0 R 0$$`PU PU0PPT04`o4"0HW`PU q<PU f᪞<@B3#H81 0P,02S 02#38TRo_ PWPU Q1oώS U 0\ ` \V U 0S^wτ0 8, R X00`,:C .!A QC ܬ,UA-`Mx@X0Pp8 P34`0 P(0  0!! 20 2U 0  09P" "0#"# 1 D0x0 P 00S&!003/00S(4`0 wPX`ЍX0 0  #1/P0(@#R 0P 0"P25/0  @#1/0D,!!s@-@P04P00 Ao0S  `VRUp 0P 003/P8oeUeЍp@e> .!k A @-@0MP M 003/00 ;㠝pP pRd`P  !eVۍ ЍO-p0\M0SR `Hwa@Q0 P, P0zbH0@>S@0 P P0ib70@SP0 0HL R   ?  ?/Z[d0P @10`d ἐ 09/0P@\ЍqVT,G-p0@PH8L041\`  S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/T,>00@-M 410@810!`0 P00 0LP`0 H0PU ! 5/׸Ѝ0T,* @- I@ p~@-T@S  0wo~WED 6&@-@@0s~,00p @_0Cod&|--?$M0 0  ~$Ѝ-4M0 00 000P4ЍO-p-KMD U_ " V|4 0`p0 `V0 R`V"R0*` ğ p$T0S 0s 0SKߍ0S P (0`30SP #)P#S 07{0 A (lT# A(e{{:?dSd 0 3 3R - BPP   BRڒ "B (" e"2PŸ 0 R#3SPjSt0100(0 \"ex0 PP 0 0SZP=9 =:rk{1 AP09ژ A k Q| 5 P;!%#3\Q0  d 0!(0 eT!6(1@P0& d( SP P*!0"%+0!V6  @0S(0d @0 0(p |Y@.A-p--x- h-5`-M-QW.!MNN%N2NX|--@~zM?N6 0P }0 A xD0 A k{I{7{zWw0P x  ~` f@<h(0<pP 0~@  ~@-@r@SRG-@  700pP ąH`P:X:00X 0s~PS @-Pp@`P0S -S :S S 000`  0 \P00 ЍU0S T  _Pt=&p@-@P5|p  `)|@A|U6700@pp@-P 4`|p@  {P*|@p@-M@ j}p$ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M Qp 3ݍ Ѝ!O p@-P@@ }pPppA-@Pp p` j ]0W0 |0WxX Uh0X`0 P  0P 0h}ЍU0 P 0 jWKE E E T @-`0tM0FP?o2p @Ip| |pf{|@{p h2Sg|p L0V#4 - tЍ|h"{p0 p@-@ 7{0 S " 0PUPUp@Na0S   0 0S CaAa0S   0 0S 5a3aA-pM@PU `0S@PE7  0P00TۍX700S @ Q@BPE@C000  pL)0S 0#S @UX /!E E E @-MP @  zp8lۍP  /!h1p@-0SM@` HHD! R>P0  0  0 Azpr0 S n09S .Ѝp0 S   000 00P0 PS p0@  pHP  Ѝp@pE /! 0!F F p@-@$`P^Pp0 @ `P0 002 0pSp@-PxM@`  |j0 0zp@) zp'  yp! yp  yp  P P0  3 p,4@xЍp< 9y"0!E F 0 0 s@->@P`Jp @t0 p``X0 7p <0@  pЍp20!F p@-@PqP - y01pP`qpG y0#1pp@-pM0 p @F gypfy@pЍQG-MU700ۍ -  Y I` @V  y@pP`@-`R300 Ѝ@PTp  ^@P  Q*@ 0S0S0 S   0 0S0 S*Z^P ` 2_0_0ST   00000 0` @@0P 2 @-@I@ @0!L1p@-S@T1S#d1S.RU9lRUppbV:l^lbp1C^L10CL1L1PS^0P11C^T10CT1T1XS^0X11C^d10Cd1d1hS^0h1 2,P0C2bV^bp2,P0Cp27@-@0 PP" H1 0D180-@@ CB Ѝ0@ Ѝ0Q@-@    b4xP p B00` Ѝ@ Q @40  pЍ@ ЍE W0!F Q@-@    xP p 00o Ѝ@ 1S70|1^[P| 01 @40C pЍ@N ЍE h0!"F p0@-M0@M0$+p: Ѝ  y0!/F 081/@-@dv(L0S  P 0800H0S S@]([F QF ap!@-RM@ Qtp0  Ѝ^p1ScF 0@-800@@A P@-@Ԁp t10cSt14 Ѝ@J @0d  ЍkF ("Q7@-@  ,, _ BGwp  Prw Ѝ0@% P 11P,|1@ R  |'AQP |`00CS`0X z@X0 tp 0< Ѝ0@ X0 X Ѝ0E 0!p6&6&F p@-PDvpp@00P @wpH p@wD `F p@-P@ `0 0x8 , ?U\' 0 0 008 , 81pp@ F JF p@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @C-`P.H0$:0@0   10 &000 0sD00,PQ 0a(!"4a4# 0v0 >Q & DPp `W  g080P040 Ѝ 0b"!4b4#@- @T0800* IP  : {IP%p@-8A` x7rD!\10B0H1xCl l<(x9 PʍT1!F vH XH fH H nH H H -&H .H 8H g @H GH PH @-@ 1 ,rp P<1 ,J,r0,1ЍPDH0 <1 P$6E e1!H H H Q/@-@  0S@qC-`@ x @Pq00@ 0S  l0 Sx   0&@ Ѝ0 b pPt @P G@00PEoX  x  PP 0S  Y$0$0> > R **)X  0S 4@0 S   000x1  @  0SP P, 0 +0 S   0I I t1! I 6I C-MM0000"@0sp<00B܁P+ qP`pQv07S 0 S W l 0 0\!`1 `Px1 ( ލЍ Pp P  R쀟쐟PU Wxx  x  0 S   x0  pP 0 Px1p  P  0S 0t0 P1!JI YI I 1`0Q@-@  \\,pM07S@YF0 S B0VS@E 1!A-`R@M@p PP U+70 h0d@ЍA"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *sP 0S( <0 *U  2 <0K |) 0S h0 !r 0S>0 P 0SV>P  *@ЍA1!wI I I O-@p$M`(PP  P 00A $ЍOsPy P000 pyp XkTP  h  C0pGpG 00 ZppIV4$pp pp X#3ps 81 18100x1Z*  pPx1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 2P  YY k p 000 0SZ81181$Ѝ P  YY I p 00`` 00T0 :0G [W0 00x1 Z R& ` @P `[` @H0 0 0`0  WB W W 0S 0`0 7 0S [ xx0P 0S [{0x rJ $J +J ;J KJ TJ /&2!iJ J@->@T( "44p P`0a"@"44 0XW QL L0 b"!4b4# 0I@> *D>0@D Ѝ耼p1p@-SMP"!` %@P T 0p1!V RU 0S X\{RP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   {0 @ @P 0 @  B00.%p ,*l1S Q R 52!%R HR R tR 0 R/ 1/-/A-@P 1 !  NXSp0 RqP 0`0S000S \ \_RP0 S   000S00@00P10 paU0R !2!GR R 0P@-p0p ppq U00P RJ0   UR 12!R p@-`@TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M`@P7o (0x`p`FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41V(@p 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@|Q@P0S 0S0 @@R D2!R S ʚ;S @-@^00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@|,p0 000"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ R X2!R P 0 )@-0PT0/R o2!R P0 @-0T0/R z2!R //P@-(0( ((@008< D0R 2!R @-,MP` 10U@0$00 0@p000 0<0S lp,Ѝ8010C>S00@( ( 03(00@000 0<0S80 p @HER 2!YR @-XQ@P mpR@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0RPU `0 P  S   p0 ^l00C0HR0HPLPU0 P(P0P0V00 S   0hR0 S ,  0_R0 S 4  0VR@-@@NRC-@PM bȂpT0SY 00C01@0S D3/2"(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S* P% HLH R 0|S0       @@U 0 H)K0SPp0S} `Ѝ\ P RUk Yh T0e0S 0S   PE  \P 03/-R 2!R @-8 0?(@ 0p@ t@Ѝ6&A-M`M4Psp l0  mp@ k@ۍЍ4F P ڣ# "P  RP@@#C 4,0 @4   Rl&6&-@-  Ѝ Ѝ/@-MMP`@0 p lR  0pۍЍw-@-  Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/l& 0p/ERl&p@-MMt ejp P@;00 dSV l00@ۍЍp P0 4Odl&50/l&0@Rl&p@-@PPg; @## RT <V00ppl&6&Q@-@P;A@UP@-q@ $j01p j01@"k@-M@    0  skp1$0Ѝip@-MP@`   0X Zkp 1@ R! (0 p`Ѝpii$0 /H0s P/0 #:60#//A-XM>PUV0P0XЍU700p@ `Rg0 PU B0>00 0<0  ,> "PP> *4S @-@T?@Q/@-@T.@@0P/ R R /0G-`P MU0(0S @  P P P:`P 0!00 0  0S80 +00 Ѝ080 00S # P`p  P`0P 0iS.S  P`0S4 040:St=&O-YM `F/@H9X0LP>Yߍ0p1N 0S 0S iPP@ Y P @T0SL0P 0@S0@S@@pT1S X1 KPAT1S@p\1S`1 =P5\1 S S R@L1SP1 ,P&L1SPC_oRPU@!P08S W0s0qP 0*81 T48#88 S R  p ,S 0 S T W @@ 0?D0 p 0L0D0}>D0 @ 0000HPPP2!ZS S iS S 0@-@PDM QP@T 00+p@DЍ0U  P @0S@-`@MPpTЍ 0S P 0S Q 0  p=@P @-H000Q/Px1P/$0/0@-MP@    UP 80 pЍ00 hi~iA-p M X`P00 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ S @#h@-@p !p !p`GgȀ@$0R% -@ @$A @ @   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`Pᩄ@P─@Ѝ ᑜP\LL0P q@)P pP  2!A-PR Mp@ 0S0T00 Ѝ/P WP&`0 00 0  0S XT 8P3P/00T 8S T O-@P0"S0Z"SJP Y pupP wp700 ЍT WcYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8ijjjjjjjjjjT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: H U*`XJ:0\S 0}  0 P0N[ SP0Sl  HPTPp@]pt=&P /0 S S /S/P0/S 0 S S/0/O-P@P ЍOJ=`Pll M ЍO K U qWK@P  P 1 A Ѝ=o0@S- ᪂P'[ ۂ`P J ``~I P 0 0  0 02!T p@-@ J`P 0SJ$`P PP(0S $J0(0$0p,` P,` PO-4M10CXP`@Sj (z@zTzz{{8|L|`|||||q}q}\~qqqЄHqqrrqqr4spsss4tqtuquvv0ww(yqyypXxqx܈<d(l`q|$$4`Ht(PؑȈh?x 0 a1p\  P ?3@H0@?U ,P 0S UA 0 Ap H0@50hh0 50,0@$ 00 0 ,00,YPT j$@t pgPW700@ A $C@4@AK0BAP@-@ 0A  Cp P! H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 H,0HS ?U H0P SPH0;00H090U `h o`,#pPL BE`P 0$'Xc CgGH0Q7;0UlQ aP0l1 ZP0l1 SP0l1 P pF0Pp1tH000UH10 2{ 0PH0 2s (PH 0 2k  P PH ] H000WH020R0hU3 | 00pP`_ 0 S;70=H0208H0603H0;0.H080)UT <1$8bhvl儒00 0 ~P000 0 tP0P@0PU0 <18∂hlfr000 0 ZP00 0 PPP00 0 EPp@0  @U =&P jx p_~PWH0p000S P0<00  D~P WH p P  4~PWHp   '~P  !~P x ~P d ~P=WH  BmP  ($p 00w ,p 00pPk $E (B H,8>   P? B:\ }PWHk  B) $xp@ pP< (( ( H$8  \ P  B 'T h&2!D YT fT T !T T T T AT U y% U TU MY pU 'Z ~U ;eU U U U U U U U U V V U U V 0V 9V CV HV WV dV V V V V W W W a W W W UW ` ` a X @9X TX oX ` ` ` ` ` ` ` }` ` ` ` ` 6W a a  X X 2!X X X X  X X  5}P $ /}PW ,0-00 0/ E,0HS}  }H`P8W  m/PP `.P`,0 00 0  uE,0S80L .P01D hR  Y/o"B6 ($PM/HL P0P(0P= L6$ P! (0L&0 ($gP//gHD P0H(0ϔP D6$ H! (0D&0U% H0X UXH020H0 000H000H000H0 00H0 00(07600 2R  *|450S00T01=5 =5H00U <1(0@0P@l6h&P ?0Sv4U H\dD`|P\tU 81 800h (0 00 0 D(0`S, 5`( "4`4# ,,0 H080_0 PP0 0 P 0 0 H010GH010BH000=H0508H0503H000.H,';,(U&RH090 AK⚿O\ 00` U0C Z AK'OAK➿OAK⣿)N<"U0 \0@T$X(@ `Pl  ,00 D,0S  PP  n:pP00,P  ,00 C,X<@DPZPKpP`p=PDP`CP4pPh DP6jP&pP DP(fPpP  $DPlP pPL  TDP` hDPi |DPl DPb DP`Y  G   9 =lw X 6W pDPc 0jDP @eDP` T_DP` hYDP` |SDP ` MDP@` GDPh ADPd ;DPe 5DPe l .DPe (DPl "DPg 4DPg HDPl \DPl| p DP| ft gW ZP0$, ⃒PP" BRPBP00CpPb wzpP  RU  RR 0,PS0P , S%00 0$0(00XH`  p @ " dZ`0Pr ʎJZn\0PkZ Z fU  `P00,000 0 uB,XpjPP 0 p`_ 0S %]*?PX  0 PH 0P 4v`&6vaP!U;JH606H0"800H080 H07 00H070U- 6P0h2h2SH000H070U z`P 00`Hp؀GP 4P DPVG h}P xxP1Ȁ0H040H030H, 4,H020U t0 9pHXAH000H000H0@00U ,0 00 0 A,0HSt U ,0 00 0 A,0HSx_ U ,0 00 0 rA,0HS(J ecBX Y Y 5Y O-pPУ8@` P P `kV<1X ЍO5R$ RZ8 ,0840 ЍOT Ѝ2!T O-S$M04 0@ Q`P  8Ȁpz⨠娰<1H0  00Bp0   h   "P U (   $Ѝ/&iJ hJ 2!L-A-PQH 1`Sp51Sp:x1pS> X@H@\@hfl6S?h@pft6S@pz@xf|6SAxt@f6SBn@f6SCh@`f@Ac@b@ 1pP[@Y@1pPR@X  >P T0 STl6,`0Cl6t6,`0Ct6{|6,`0C|6+@6`0C6m6,`0C6O-MPdBbX@ DL3&7 D000 0000 0606} G000 0:00 3000%0  p Y +8 0 D 0l0 D+,[01 P#Z H0E,>P0hl6 (8CP,:؍<Ѝؔ80$080,C\P(/h6p2pl6,2hlt6囗 SJp?xp,|6囗 SDx?&0l"&p6t6x6|6p"66088 p,20! ((P 1((pW 400000(00 0A@(0S 0 S S0P\S @pp8000SS (38 P,,00  C0 ?oP20804P0P$0p((P ((0S&0' 6 PN(PI Z4 PpPp80,CP(0)S Yp Q0000@(0S 0 S S0P\S 00@ P:0  dh ÎPP`(hQdqvPpdq PD P0S (P  P 0S (P PpP} 0)R00S  yP W400000(00 0 q0S D:$ D0009!h:!-@ 9!;!lY !wT Y 0Q//Q *///G-p0@0P `<P` Y 0 0 R:@CS@D"@3X HGU( HGA-TpW0 T`@V0 H0HS @sP X X| |00 S DD0P 0RS  \ 9!!\ O\ p@-P @Pp=@-000] :!] v^ p@-@PQpT:!^ C-TM@` P `cp) 0 %c ````1c 1 pW0`pV& cc 0 0 R@ bT  U@TЍ00C>SL00`"P!@03@000C>S;00p"P!@03@02!1! 2!2!-3@- P ip@Ѝ0@ Ѝ/@{pA-@R4pP`@0S p^ A-0Pp@`S:0SS 0   RS* R0 `V1S* P a 0@DpR: Q ^ (;!^ ^ O-MA 0TP`0 zy>@PAP@1081 0S  up 0 0ĀP P P P P P P pPp0S t Ap `61@ R P7p 081#?P 0,8а00&&&p H0S& S% p D p L  p $ p~  pu L0S p00$M0p X pc t0S@ 8111 _0x1Z9 Tp K  P= Vp> pPG0 ddd$k奼$P p) URl p,!p]Lt p 0S P wQ  ۿZ T  Sp  #Sp PO PJ PE P@ P P9 X00S 2"Q`` Kp  Ep &%P =%P0 x1`$0  0p X00S!XppW" b a!@p%P `V%R  p0S0S" 0h 1SqP2᩺p@0~i  Spa 0p!pYp H ApO 0,8!pFPp@ 1 R0S  P2 Ѝ0Sp pjP;!_ _ [F aQF G $_ I F ,_ :!9_ E_ _ cG UV_ c_ o_ }_ _ _ D:!_ ^ _ _ _ 56 _ _ _ _ _ "8 i p@-@Ppp p@oRRA-P`p@@H0s  S  U@ p@@@dW0S R H R U pQF $_ aQ/p@-P0U@ST` f00p TmP@8@T:p_ @-`PM1pSAT  p@lЍ\ ,mPЍ@!R 0$  00 Op@ |a@V 0 !p@k`P p0S ltZ00#40 PP YD SP 6( 0(Y;!` ` j;!w<` u;!` 1` p@-PP 0S 1 `@0S @@p00p SU   \@ .S0.S0_S-S.00  @R"0T0 0D0pt=& @- @0P PyT00Q  DP `00CS`0p S00 P0S X0X /XQ6&p@-h1@SPlPPE @p 0.SSPP \BP L=P < lP 0  .϶PPa/;` p@-@P'Ua 0 |aP0 l\P0 \WP0  LRP0@/8,0)(&  #@       P0  P0  P0 P0 | Pp@ M KP` 5W T` ` ` ` ` ` ` ` |` ` ` ` ` a a a {>a 0(ƒ -\ lp Q^ ,\ ,@-QMM@pPcX0p0 0YOQލЍA. !. t l0LOp`0SPE@Ep 0S:0@D0$J &a O ,a O--,MlhpP. ^k}`  @PV3 0S  k k,P$P@ kP@ X_P$0X27300,Ѝ P,P, R P,PE0S p R* 030 Y3$ R, R P F3$ R R ,Pp!@P !!! ;a Ba P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-MpP@`UQ:T 0T00D0S00V`F@@WV00ЍPWM"0$?S 0[ PW RPPUT  P.70 0 + .0@I0 0IU:D X0 0 `TT  DSPO-p0 0$09`@P00W*0S T [700 Ѝ!0 *00K@P  00T [ 00 P     @ \Jo"  & Z/Z#T [\*00 0000K@P\ZT [T [ KP|t=&;!C-RM MPLHp`p; @9pE  lNp V=p Z94 [NpTG    |0 Ip P; IdP <I/    Rލ Ѝ   20!V002 0I@ p  p@P0P@T*cp0S4 Yp `@T*T 0 Mp @ Ap   0#$$("( Mpm @  0d#$$(B(   04!c#!$ c$" MpM @@   0b"!4b$#  G   .0I/P* I/ Mp$ 0S @00SP%D{Mpl005  }- qVλA-p PMU@ ЍR` R K00L0S 0 -0 0p00#M0 .V 0 00 0&LL0S 0 `a Fa O-4MX@p 0S\`d` (0S:0 p20"4ЍOg 0  ,   xp0,0 ,0SPCDQ ,<Xp 00"0H, 04ЍP V0 00!00  ֻ, p0Bp00X!0h `F,P 0 S(0SVP$ (0S(00 0$ `;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R0, 0 (0S ,  09,P;!{a a ^ a a a p@-P`@P 0S $`P(0Sp,` P,` P  0J0@-MMP+ p P0@ۍЍ0;0 C@P ,P @- PΠ R 00\L  ^@-Q00P`PV0 V=`V xЍp@@T   ܾ0x@ `D;PЍp`Vx1@P ȿ0>0S *1P PU@P PP`ꩿ/0P@-000 ,FQ 0 @ 噾a E!b /b @-` ,M00>0@SP  '0x Bgp ,p0t0 0 0S00 0 0S0S|0@0|0 0  X00Qx0 xPT ,Ѝ0 8 0?0S 10xPT( A-@`|VPFPPP2Xxp`Eg-P x倂|"x20 V0  ຽ|20|2@-Mp@`P! ᩽ (⥽ (⪫X( 8pXIPU@ Tܾ700@Ѝ սi///0@-M @ ƽ+PPЍ0 3"Qp 00000)Hp00000@ Hplp 00  0"Hp< p pb E!;b Ib \b p@-QUp@p zG-0x1p@-p@-FM>`V eP00Fߍp@PF/ 9  0p01 0 `M0 HF?H 0> *P?0 F?H ii@-@MP4@ $8P P@Ѝ,E!Q@0@ @@@-麻0SSL`///zb LE!b $0 /Hp/M @-@p000p0@0M00@-,M@P(  ᛼  ᠪT OHp 0 00S p,Ѝ08i(p@-MP@ w ` r w  (P%HPЍp:iC-PQSM M 3 #  HT0S2"`V2"@p@"E0B01801T0t0H0 0C@L0@T0H 0H0L00L0@ P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0T@L0 0$L0120@ 2:T@D@@@0@L0 X:  @L0  XH@L0  @L0  XP UPEPPP@ D$("(Ep`Sލ Ѝ E XH@:] WE!b &] ]  C-0M@" 0 0@@@$@Qp P )PP @@ 0 Bp `@`$+Ѝ00V :0 ( P|pPh (▻ AW 0@T*x0V*00+T`E!@-DM`@ pP@  *  / !> U 134  R2$ $@0 JDЍUi@i*|@-QM@  00p |20 x2"\FЍp@-]M#PEp PP -R &000S0S S SS wR0S HypVP}S CQRS@ 0`  x@P -$0 Bp 0S$ H H80Sq S} S00,0S  R000@0S  R00@ H @ 0w H|!>50H \0'FpX0S 01S TT0St0 0 0 00 00 `eRj>S S^  ]ލpRZx1@PN _ GPD 0A H=ETo90S6 HeM P N0 +00S%i@jE!b @- 00 000 0 ЦЍtE!2S/2S00/@-@@/V002@-S0@0 @@!V0002S  ㇀/|E!G-PM`p (P忹P(@P. PP`Cp<00 E CPp0S p  VEp PU0S Dp C*@! (⍧( \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 'P 0 0B ) 0 S2X00cSc@-@ 000P 0S00Ѝ@-@ 000nP 0S Ѝ@-@ 000YP 0S  Ѝ@-@\0S j\0\0@-@`q0]`A0`00@-8@\=@0p@-800P@% >Q" &T⣷0x1 RpR 0S TT0Q  >0S ,p@ 0800FTc A-p`KPq&P@00<000S@ (0? h@0K0cScO-0IMⴐĠ@`p0 0000KC<&PP d0S  FRV ( Q  R x*Qh 0 0000200> 0BS0*  0360 RS00~ T2 $0K^0pC90$Q 0 DPV VdP h  Q `)/$ D9p HQG4@`$Q DQV R <0S @HT360 <0 ö @VB0HS80 0 嶶@(1S p0 H0S=00(  ⥶(100@0SMbp ?0E0 S A F GP81#<141817%#810o0F0p7spVg@4Sp 0 HS+00@$A @e@4V0@B WeV M@4S8Vp0p 50ST 0HS300k ? 0HS 700  0 0 "@, 02 S3h6 ,0 l& Rl Ip0  0HS20 0 W@(1SWVp 000DKPZ*0W(1SG(, 030 PV:0BSTG  ,,S P R:(, "  PV: ART#  ,0 00D0C00s W00HS9000 0C!4 1ᚵ@?3S Y 0 HSM00?# ?30@(1SW`VrW08 2S  $8 "0R PH  [:0Q 2 000000  @VP VpWE A5S 0 HS^00A% =A50@6S/ _``,0HS|00R &v p6Sh@W08 2S'V0081 0 Z00 HRp P0@W00  ^00HS_t00000@0 HST<0 0 "  2V0@ WeVb[@Q0000 00@y0 0P0"9s 0H R*0   Ṵ @c0HQ0p00S0 $Iߍ0  ឴000`0 r0, c cSc259c +c ?ATc mc 7@-P\ R&@iP\x0S x0x08  Ѝ0PP @0@ p x#&c LF!wCF A-PR1!@ `C0P p@ R1 0R000 N 30 006 P0 0:000, P00;000" P006000P00ЍP 0000t 00 0p00 0p0 000c YF!rc c @-0p0i0 MS$MP` 1 !p =p@0S i p ۍ$Ѝi@ 0 cPp  8QQ0500 0{pPf!P( ⇳c 6&$wc cF!d @- 0080PP `V@Ѝp0S B!@P  g00O-IMPpkHLPL `PR - !0@PIߍOm#0,0-g#600 0-400 0 P` p00,0S2 V30a2@0 0!,0 T9`0 P 9/[@PIߍO\@{90 P VT` \`00Tg9D0 ` ^9Pd nF!b@#d 3d Fd O-P`@pQb帠,`P,2S$PU`,@ , ?P?, Q 0S,9  > P,`0xF!Sd [d RO-00! `pP@T:p T  X ⢱00U *s"0 p Ѝ0R0  d @80  d?p  V8 @ W?p\ . A-RMMA00@` PRp0F R㼀 /00 pۍЍx p {p @ 8 ?p 00CSe5@- 81SQ S0 000 _PЍ 0S 0# 0O-S4M@ h@@ `00_0P o0 00 0 2pP 3 00 y0 'pP3 0 0S0@0`00T0 @P0i 00 0  `P` 0 $ ( ZXXpP  ,≱$(,8 2`P@ [0!P*j"0 0P 0S $)( ,Zp$ (,8 P@0Sh0` 0h0  b0304Ѝ$ 1 0 kR p(,$wtp 00 !0 pPp @ kZj $  ,,0pS =P@,0$S  S St0P !R "R hp( $((%,8" P@cd Wgd O-PM0@040p0`2` ##pp#ppW9 pW6l0S~,0S0p㄂,0噇 2S0p8h,0噇 8l6S0pl,0噇 p"R000, 2hvSl~l6S 6p 0 ?pߍ00 `2$\p $  0 *p 00 `2(J$p 6 0 p $6 0 p(6| 0 p#0}0P,04l0<40 po#0n@0"04,040 p`p`pgpn,0 !P ,@ 0,00lS  R, `"UpP 00H1,0,0H0 0 p Y, 00}R0S 0ȯ00-P 0Ip p 0 ,,0 !P !, `"P ,0 0L00p 0 l,pd d d d d d @d p@-PUp@0L0pp@- MP#p 0` 0 0 `@:po9@ Ѝp 0 `~:p ` 0)`v:p  0U 0;100b:pO-`@p 0崀SMP$H` b000 0 0000 ``0 8Р 00 `  $5  0Q0004H081v xHЍO<0 $~5 <700004@0S$4H000s$8040k5 $S 300080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!>500 L*S:G{k0{'{*z8 S zkg{{'{* z$500 H0S0SZ h W 0R<0S 0St2p2H000s8040 PT24 P@28 P,20 804 @ 0R00i |00.0  p h` 0HJ " P0dh0Ѝ0ST1T1 P0 4cI08    0S  0R`V Adp`aЍOwP0 Fpx|ЍOQ??e -e _ 4e Qe Xe `e {e f e e l 8f ((x5Lf zf f ?f Ff F F!EF A-P@T R0A o0p8` l0 R 0i0}P 0S <0S $*4   4`0 B ` ``000 00`800`0 Hp B 00 0$0080A%d0h0f O-0R\MpP@` 0$P X0 #3P 0 RT0t00 p` hPP. dL0S0 0@S@0#/L0}ހ?H00XP X0 "2P 0 Rzgjzzz{T09d0S  $ P $[ <X x' h2 0`208#<410,00000<00@0,0D00 <$P(P Q48`LPPPTPH06p` 6NpY  PPP  hɬ&h0 0108#<48#8 10 E00`<]@008#<4 01 P00\ 0`v 됭04S#1S0810 * \ЍOt   0S 0@ \Ѝ7S zDf F!f f CDCg 9g Fg "g  &@-`pP@`0 h0X \6S R h0@0 < ` 2 0m Ѝ@$0  TKg f j wg p@- P@$m E0 00L0p@g  (p@-PUp00CSp@0D ${2  (00>0L0p@(g  |(p@- `P@p3800  B\00L 0{0<0L008 %p@ g g ( RD)A-@P` h 0R 00P3 081HAJp` P08!(0 ArP h    ePh0h h) 0 d0 P0 $Ah 9h Bh c F!c h00h0 C-@p0 PR  R $ RP508Ȁ `1  i@0S PP  P0  lH81pppP( p(1" (> *>Q  0*!    ЍO|  ЍO80  0S 0 0#0 QA  $  S 0 0 00 R* $p060@00S( gP pQP#  u00h00h0d( 2 R 0 00 0S:ЍOS 008000s  i pPqp 00 P R  ] a0 00$0C40 040800 080ꠑ0 S06 PUS RP p xЀ  L0&  7P 4ЍOA`0 l0 ${/  4=0S 0S 0 S&$k/  $00 <`0  @ R |0@ [ЍO= H0@ЍF!EF [F h h G!h cSci 7G %i Ai -x50p@-800P@  Dh00h00L0p@F i_[i i 0G \/0S/08. / d R  0R/0G O-M00000PS`@pTQ 0 ЍOy> R*nP 0S 0L6SDƛ Pƛ Y  S.  pH!  Q  0 S:500 0p00 0 ЍOH Y 0 0Cs0n0S0 S0L00 0!p 0 # 0 0 0PH0 ZYA060@ 600 0p0 0 g H`P  0 S 081|izd6@P 7P0S0 0<S<0P0Ѝ0!0 0 # 0 0 0{P 6ZY7Z00Y[0S0 0  Br~  Brz0 l00 0{P0 RS04%KSK?305 0M30 Y0S0  PP  ЍOici0 \4 @Y Y0 $P$0 0 0 Y  0 3 @ $ 0 0P  S 0S0@00 D$0Y<0<0818 ?  ; 0 P0DP4 000а 00 0 ^0P00 S*P *  p屦 @ 0SЍO600 0<P0( 10S * eP   p傦`81 000 0 0000H ``0>\0S   T!0YP 0 8 R 1@ЍOY Y' Rr   0 P0Pd0 $Yk 0 =,  pЍOuk i i i i j j %j d 0j ,j &{j Qj @j 0G j j j j G!_ &'j j j A-h0PR@~, A0@a0BS`pbp थ0 Am$Ak O-`  0䘠x1P@pT ЍT 0S R T0S> R* 3lP   0=@pk G-(M@PplP Q0 (ЍG PE ፍUV`0@SR ZO "448#8UH:`aVD0UA: ⃥1#ĠČ Ƞ,Ƞ\5 U2:1 S/ 0$    00Pp   aaV Q ppQp% ! V +  L(Ѝ "448#8 C!B0.G!k k @-Q` M\@MP  0p000 tp 0S TH o ۍЍ0 Q`V \@TE *G!$wA- p`@PAlQPUn+ A0DQ0S0 A\0S0 A7G!k A-M0M0 ;`pp@P @ p0|0<000C$00(00$0C,00@pV004p8 \\ U0`$0 0.p ݍ0ЍDG!E   p@-P@T  (@x1S0pSq {.02p u.02022p R Rp07@-PX0D @P 0S$ >0P 7P7;00@0S02700000 0#0 Ѝ0@}wz  P<gjzz+SC$0@  Ѝ0zDk .p@-@P0 0Uph0Spp@ .O-`@PU Q Pd0S  0 <'\0(d0 V ЍP0/Q 0S 0P O*  08p|0 봐8 R0, 00C0 m0800<0  MP`00 00 0S $0 pWp:#<0 2 0 0 R0H0@St 00ppW\0H0(H   p^00l 0G 7l -e ,0`( "4`4#S /0 @Rp@-A00pPQ0`PE `@@d@ $,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ SoQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScx1O-`@TM T. 0S pW$ P ⩚ tPP@0Sh0S d0S|4|$||⏚d0 0S rPPTЍ|0d 0|00 00yd0 00s090 8P 1p8(P P  # | PP$0 00 #PP 0030d8,dX( PPm |0d 0|0XxjU 70S P 8 P  OU` HP < 0$Q S "  Q  ᮚPp h %  <  hpP@ t0<0t00 00 80bdQYx X zP ᚚ  U ipP ≚ĠZ 0$8 0  h %  <  ${0<0|D:!l QG!*l m l p@- P >p` 01S 0S 0S 0S  Z0 @T 0Q0 PSP 0U d0S0h0d0p@3m aG!w 0dP/ (0/00 0S/p@-@T PP@0pnG!G-Pp`P@Ѝ0E @P00 4i@P 00000P00 000' p' 0 k,$00PP&0 哿pc0S p徿0 9P  0@R 0 0000@@|G!\ ߪ2Nm mm s@-@0T  PR8 00*:SR h0S QH`Ѝp$`  P (0Q,0Q  / `P h800000( ,0CP0S 0 h dd0S  $0R  0h0d`0SHݳm m 0S/0S/   O-M8PRD0`H 0xP00ЍpP P0 X@ XP R R R0 00Cs @ЍOP 0S4Y00 0000000Cs ЍOn4? @PЍO    p @@0 0%0$  <+ SG!\ 0S/G-P@M T 0p `x*00 0@0 0 @^@ЍP/@-@TP@A0S   0:p@-@PPP 1000pۑ P 00p0000 S0 @00:S 0S @\S000@:S @-t=&0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/#& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO4E`VK `0P0E@ 9 PP] 00pCލ Ѝ@@ ;04pW 40p(0= yP  0 `R0 :R`00Fd4@0  0(8804 PF0P {0S )(O p PP ;000P>p 0S#00 0Ԗ8`p@[ + '0P R 0'0SJ @@ '0P 0S00 `0 SWG @DpW :Sp:SY @\Sp S Spp p00T:C @DP 0SJ 'G0@P0 0 Y@ S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 @D0J`FP  0S [' P 00, @ ` P D,01  -,0@PEg P0S 8'$ D0A00T*y PPR 0P-#&" @-0  0 Ѝ@-(@ P V0 0-C-MB0M00pS 0S`! \0S)  R&    RA^0C R[ y0Pv Ps @ SV Q0)P ލЍ y0P P 0@P8V0 PP U P)P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0SPZ\R    B{:R|R  -t=& p@-@PDp@NA-`= @P@ d# PPd fE 00@^S0S:S_ p0 R0S@Ad PJ] \Sp0S:SH 0C^ @ 00LT1 0L\0TSpASBC\ `hh\ghh\g\g\g\g\g\g\g|h\g\g\gh\gh0bC ^ 0 0 00:0 0Pd @0:SS0AR0@A $ P A-p= `P@ d P`FPd0 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS@ 00A ^a0ASW0AA0AS70A\2" @-04@0P (P-m G-Q0S ̑`pʯ #PV00Ѝ  P00CS0U Pp0  W00S@( 7P   , P P00SW  X  R00S 0σ47,P R   S@T PR   R -(--@0@-0S yP `P-(-@-@WP08G-p@-P@PPp4TPp-@-@AP M 087S@T -(-p@-SP@ P@p p@-@P & 087S@T -(-O-pPW`@P @ ЍZ K P lPT  RT@ Z //////O-@@00S 0P` 4 PU00 Ѝ  ׌P00CS0S Pp0 0 ř  V00Sp P    P P00SVppZppW  P P00S  P  P | P ` P H P 0 P$} :aPx@-T@-04@0P $&P@-m X0@-0S H@ ;000D@FP0DЍP@-x-@-@`0P0`Sp 0+P PP Ѝ@-@-@P08D@-p@-P@PPpRPp@-A-P @`pPЍ0 (084SPUP @@-@- 0 00B;P Ѝx-A-P @`pkPЍ0 (084SPUP @@-@- 0 00B;P Ѝx-@    /A-0@@`P@0 %Ap00D0& SQ] 0@/0PA/A/O-@PDMpDpG``b0Y:0z  Z # 0@@D3 0DA\0:Z: [=0 S: p `$ Ѝ `p|-A-@`Pp] H"W B"Q <"KA 5"00@-A^ 0 n$ P/o b2 0.0AT d$ Pon N$  A000R0@-0TM00`p<` @Pvp TT0 w#p @ R<0@404 4/,00S 0TЍ#&Xm |-A-@` 0s P0"0p0pGWp0P"P @P @pT0 @@PP @|-p@-?@0, p`000000PPp0,0|+0@00`o`L` p A>0t@lTllH0SpW W D"P !P 00PpXA C9R񟗈       @    `  ܀                     Th  Ѐ   0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0塖 0 ;/Q꼖$0S` /!0 R 0  40><LT@C3^A00@C32 \  02` 3 d ! XC2 hhh 00C0'08S 0 0 00͍h `| če,`PPDAލ Ѝ, !/P 0H0|-n #&n n 0yG!--0H0S/|-0Pd /|-A-PDA@M|0`S*0S' 0S S f 0P 0P@ @Ѝ % ĀpW*P 0 000ṍ0pV p@ 1`0pוX0X 7/0S 0SP 0 P0@ЍA蔍|--#&Xm G-dqP@0L P12C1b05R0 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R00J0S0PS ؍&0S,P N,@GH|--!\  0L0#0|-t0@-M  L0@31 ^AP 0C! 0Ѝl⬌|- @-L 0 0@11D ^Q       |-A-@@bM0u L0 @2# p PW%cP_  Bc p\  Zē$0 HD@,X#10000 2R01   0 0S0" V00 S / ЍA X 1(4/00~X1威0 ]SV Q`ЍQ0S mЍAg`\c  Zg l@l%0S  ZU a00@|-G!C-`QM0S 00S` L@P: 0s%@Ѝ ✌널pW   @哌 ᴌ00|0pS0S %@PpJ00pFV@@AP 00T p@巋``pW 0S:S* Z {00ppp|--O-`PqL10PSU$,@T,P@P6 h0d 0B1 `P 1ⴋh L0C R P!050%Pd @T: 7 囋0 p[L0CY1T*Q@@|-G-QT0Sj:\0`S& 2 c@Oop @d(0d$00@X1 0S. L  B 0PI %Q * RB  Z0=408@S 1:X 0p@D7C 003 c0< ?o@@Dp@  ᦋP  ƋNP `! @(0 a 2!`!  000p10P|-#&A-p0@@ `P PP00`Pl P@%Q *0S  |-$00S:@-@@W|-@-P`P U(0SP@P )@T \0@T0T 4/  00'0S 0, ( @Ѝp|-#&W+o O-$M@PpD00T0SdS )@TPY P3@归H3H 4/Y(0S p0dpY`WT0W @p pp0Yk0 # 30f*[`C`fQl: L7~@PW KL ) D2 10Z 0F30 %0S6*0S  B0@P1'0S 0 0@$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@%0 f`[x [`K``fpP @P00p KF K0`F@  L @ȉ%Q *0S  @|-#&WXo o -@-M@p0aPD(0SWTP )@T: 0@͑0 4/0#880 pP0U6@P  ㌐'0S 0 ( @Ѝm@P %Q|0S0S P굑 00|-#&Wo O-@QP$Mp(0S@ P u`(W +0TP\\0T**P* 0`0?o 0c  `o `S, `P T 1q*zJ'0S l p@`$Ѝ4 T$P030#P0S X 200301S%T#2Q EZ*0T00S  D`P 00P`P0 0#  0|0S0S @ @p|,f`0<0 0 "p`  Ὲ`P% 0   屈%T#2Q JZ*0T00S  DএVv 00FP )0S 00@彐,0, 4/`P|-#&-Wo @-@H0'0S 0 00 0T Ѝ@Ѝ|-G////#&/#&000/t=&000/t=&000 /t=&000/t=&000/t=&000/t=&000/t=&000 /t=&000 /t=&000@/t=&000/t=&000 /t=&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/ ;&f0 0CS0 S P0 /p@-P0`@Pp@ Tp3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00x Ѝ0S/1>3 !/0S 000/-0S*p@- @P>M P p Pp/0S/p@-P0 @R`*0 PQp0Pp0S/0 0C@-@0 0  (  ( 0 S/! ^R/0 @-@0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!t0`0A-s肟Mp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ0 0 |R 0S |0 3/000Q R R0SQ|P.0 0R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ-A-PRp `@P 0!ڋ000A-@Pp`0 SW' WV00S񟗋xxxxx(xxxxxxPpV VjpGPX1` X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0 SHPp  B0s  B`NpG`FPe`AA-@`P0S0<R"1 21<0S0 0PPR0S! !x000S!!!,p (K0P A, (0 ,P ;&p=&l=&A-Pp0 R*S\ ]\ t`@BX T 2P}P`#& @-R@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00-< 08 C800/`Q'Q!//t=&p@-P4`@x@P@p TpPV!Q 010//PV!,1p@-@0PS0<Q1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0P` ;&p=&l=&O-@P 0RM 1 P&  1 P 000Ѝ 0@  JPP ЍO 0 PS@ ᄉ 0 00<00S*^Q000800R ]R00-R Жv0S* ]R Q-R\V0]Sj-Rh0 S{:0S00L6000S8\ 00000 60S0(B(RcS ,0Si40Sf$0Sc<0S`(0x\ g 0(` pc0@`F p@ Uf 00C0a-R [RQ :R =R 0S`:  ~0Q00pS00p00-S]S0pS00px4 R*000`BV R:0pS00p0 S>*R; :R8 ]R500?  0 ``BtP┳ 0(SB(0<R$  HP    n P `$0  0$ 峠0S00pp0Q00pS00p00-S]S0pS00p= i R:0pS00p0 S*R =R ]R 0S0 -RB Q?]Q< -Z00  V1 0S. V0pS 00p0S ,Z00V0S Z40 nHP   `hFh400!0`Რ40 P0S 00000 P  P (B( [g 0]S~`Q\08C8 0 0 EB#ЍOp p ;&-t=& 0p@- 0(M@! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@t=&p=&l=&C-@pPP\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  lHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB Ht h ? 0 D OX &(  RPSxPA4#X z 0   0`00020%U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP  B   B0   B0V0\S0{SPP0SP<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S X^0<0S 00$000*Xe .X< 0e-)>{^ ]t=&0@-``P?Q@ $0A  R S(((\,,((4^Qn [Q \Q 0S Ѝ{Qx |Q 20V:0S00500 @0` V1@`(P 0 S*0)S  )o V 1L  0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   0p00030 0V:0S003000 <Q >Q x`P  &  R  #+S  *Sg 0S9* *B?RP {R2 Q/ 2000( <$,Pu 0S 00h2Q 0   0R  0 S`|* ,Ry  2000< V0 R  !   _0 S*}Q00 0RX}QR  Q +S ( 0  BE  B   B09  B~?S {Sz   B0'  B 0  B  B  B " A 0000S 00000-t=&^ ]0S C-`M pQpG wpL@P 6W: ЍPPP P $PPxP @E0 6P uPP  $ ( , 0P4 8 < @ D t00|0 ^000G R:0S005000 S3:  G0A 0rDP  00Q p0 P>3S! 1St Sq S <0RQ00p< 0o )  rSW S<0RuQp< 000p000Q S S SS8 S S4 +Sf >SQP>3S S' "S 0SU\ S:?  <0Sg 20@0020 0H  @  G0S EPR, 0E10S*YP  B08B0SE0 A1S*, ^ R0C*@ Q U B!U \1L0XR#3S#^S!7Kl80SD 0>Q Q QS 00 0R 10C/TUUl,-Ee,1p@-@0PS0<Q1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0UP` ;&p=&l=&0p@-P0@SQʡ@P80 p<0S P pP0@H0DH@P(00Ppp@ ;&p=&l=&O-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T )P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  ~GP?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 Mt=&s O-P0Q,@p` V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. `F`FPV00@>N>0> \0C~>!0>#0 R@u @O-4M0\00(0( 0 00 002   0 pX = Q  0 R)  R # `ZX !,    R  $  S  R  V  PP$ X$@1`v X PP(@@ xPPP @(r P  @ @$ X1  RvX PYtt vb  (B( _V R  !    _X RG v@(@X 0x  v% YPt P I_Vytu xLt  _`V `R`V t@@ v(  P Px Ptv  O_XO 8@Y (@X bY0txPt- xt v  t v  (B(   _V _XQ ( X ,0 _X @itg v xx ,    R (ZS $X  $ `0 (ZS  P 00004Ѝ0S00 x| @P t=&O-MP`80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R>sp 0 `800 0@WZR  D>sp 0 I800 0@@ZH  D>3 1> Q p0p-800 0p@$ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T xP0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  BP?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 Mt=&s O-,@pP W`> ^* +^` ^i ^O ^a pP ^o ^Y  1P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>0 E0 0000S0R0SpG pGPt0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-3S SY S$ SVSc 0 F>s2 R>sp 0 G800 0@>ZR  D>sp 0 0800 0@'ZH  D>3 1> Q p0p800 0p@ ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R>sp 0 G800 0@>ZR  D>sp 0 0800 0@'ZH  D>3 1> Q p0p800 0p@ ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T ,P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  ;P?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 Mt=&s O--lM%PQ0y @%Qt ppq        Q 0#RS. 0 YT,Q 4^ 80 0S~ <``F`Z01S` 0s vQR\R 0C1!S` `0Cg0 Q[ 0000,@4H80<@ ' PP  TX0\ L0`s Vd 00 S`FY10`0 0 ,`P XD0S 00D0 ,`PD00D0 0R < 0JS : |: PZ Z `p6`XD0S[ 40S,0@440S pj, 0@ R0%00D ;0$00D0 ,)P5DQ/*0 F0,0`P& 00D0 ,CP HP 00000D0 ,0H0S}PHDgX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XP4P HP PR [S4 0 Y-,Q 4^f 80 0Sb <``F`Z$01S` 0s vQR\R 0C1!S` `0eE ;&f0 Q.0000 V,@40H08 <@P0T0X0\0 00S`FY10`0 0 ,`P XD0S8 00D0 ,`PD00D0 Z ` 0R< 0JS: [9 PZ`XD0Sf 40S,0@440S  p4P HP lЍ, 0@ R0%00D ;0$00D0 ,P5DQ/*0 F0,0`P& 00D0 ,P HP 00000D0 ,H0SWPHD^X 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPpS5 0 Y,Q 40 0Ss 80$0So <``F`Z$0 1S`0s vQBo \R $0C1 !S` `0d0Q000 0,@4H80<@PP T X 0\ L0`qV 00S`FY100`0 0 ,` P XD0Sa 00D0 ,`PD00D0 0 S` 0P< JP:$0 28 $0PZ`XD0SY 40S,0@440S , 0@ R0%00D ;0$00D0 ,BP5DQ/*0 F0,0`P& 00D0 ,P HP 00000D0 ,H0S:PHqDiX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPppn plpj-Ѝ///@-- // //p@-08P00@S PpcP p -7@-@0P0S TP Ѝ0P -@-@P 0S c@P/cP 00 0/ / 00 0 0 0/////0P  P@- //s -'s P P/ /O-$MPpHWLp `d@P1!$/@ @ T0030#`W00SP 0Fk[* :# 0 0 0 6kW0! 0g$Ѝ  0#k $:60 0%$0 %>‚!!!0C@T0,P5#"!0/#1k@pPh p ` 00P@0$Ѝ00`d@Pꙙx Q)\(\ \(\@-PQM(p,`@ U00 V Sp0`_Ѝpw`Sp 0E`Q-00Ѝ r00 r0p`BG-0M@p`0W PV P%Y P.X PmZ PNx P4 P ^]Wf  W] R]V+  K] F]Y  ?]t :]X5Z! L /]< *]ЍYXZ-  ] ]   ] ]Ѝ \ \ZVY  PЍG L d  G-PQ00RM00p0` 0 @P @0S nS a0CSsNU2  0oSm #kPN ЍkPZ V000U000 kP[Z V070U070PjPZ V000U000jPZV000U000jPZU000V000zjPZO V080U080i0@q@jPZ: jP jP jP`ZL V080U080?jPo jP ~jPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000l4jP T-jP 8 h X p ` $ 8  A- `M0 0 !!0@PH@>SHPPP PPP8"`!P`03 pP0  p, 0 np@ np@  p@@@dn 0PnnPn 0PnP`Ѝn00@lŸO-1MM   @PD08 "( p C. ` pY@D;8 (@0Sm pȱȑp  ` ᰱ00 $ %0!`gt0p@ !0 0SP h0S RYn001ݍЍRn0S 0K0S Rk P3p 0A8D<4! @ P0 0x0Z  0+0h,R @1ݍЍp` FtH P X D gt0@-M0P  Pp Sp@ P Ѝ00 0Ѝ0@Ѝ0A-@@0s. \PP0P 0%p` "``00`mppX`p m``00`m 00pp@-@PCM0 /Y_P2 ,pPA ` @m00t2 7{C>@ F0 P4D@ F{@Od0S VS00 SCލp@@0SQm@h0h 0P@0 ] P@1:dm?00@^m00@ d l p@-MQMP4@SX TD /^PA QP0s* LhPQaP` 0%pG @ 0@dqp> D p7 ۍЍp,0s i/10p +Yl@0 P@0  P@1:l?00 gp 04l0#S @l@l@-p@ l00l ,5 %@ P @-rP`O-$(X,P0p-S`@/U'W1 ? dfZ0 0^fP : [#P?5# yq 24x2 zPWi@rUZ0[% 0@-DM@ P, Pnm~^w_(iTTx oT0dYP`Li0PPA)* 3!R ^!,! RX \`T0R@p 8T 0VP T ` 1<`S> \ Ѝ(00(0000,00,0`@PT01C`/ADP`@T0  T   0`0#[ )[U Pǟ ,!\ \Z ^X S:pU T0`@P0T0701 <` 60PP`@0,^0 <P0  0=R  @%0Dh0`@< D {{APP$0S`@"Dx`@ D  ,\VPfS `@0 S  \Q0s<D 8`0d Y`@0 00000Q0`@00L(0`@0(0,00,0D(00(0?$0S`@"x6`@0002`@P0L dS0 D`0D0Dd D 000#$0`@0$0 0`@0 0 `@(0$ S r <\m=Qh$\NPHL X@0 0D0h`@0 ST<\O{H@^{L@0D h`@P0= 0LS0$%h`@d @$0P x0v> 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#$0S`@P" R"  " R,"2!x"~$0S"x`@s`@00m`@ 2 0 Q00$:($^0<P0( 0=R%0(h00c @DHL0 0$ra 0$t!#:6 00 0.$0Ϡ.>L!! 0!!!0C 0"  R Ό ( "!P$?#"0/  "1? A ,  , 00S($  0P 004 `@00##q"X",!  ??Hl""""'.%Q(\)\²( `@R 0S $0S \0S0Y :6l 46 0! 0Ϡ!>! 0# 1110N 0P 00( # 0,$0(0.,, (?"\ , 0\0#0  "$0Ϣ 0, 0<(0,08C.: 6 460!$,$0,΃1,#!1110L0^( .$0"! ( 0." ?"!00 (  "͌0 ( 0, $ 0^ T P00t"000t`A0`@00=`@2 0 Q00:P0 0<R$0h00c 0 0$L` 0$$##:6 00 0.$0Ϡ.>L#! 0!!!0C 0"  R Ό ( "#P$?#"0/  "1? A ,  , 00S($  P0#`@  0 P09*^3*{ r0s{P T80<`@ 0dR#  \ Q $ Q $ &PT8<`@  \0000 Q00SPT8< `@D !{`@ 0 D!t`@ 0 !m0S(0S `@50 Q00:c 0$ _ 0$8&#:6 00 0.$0Ϡ.>`&! 0!!!0C 0"  R Ό " !( &P$?#"0/  "1? A ,  , 00S$ (  R0#00 `@0D0`@0  0C0n0 @00 0Se 0 h00$%`@ h$ 0$% 0S 000000$0`@2p rp t t `@  P0P06  0# D%`@D000 P 0S  %`@D000 P 0S!D% &`@000 P 0S D%P R  \Q%8< &z 0 R#P dP(  01) :60 0!$Ϡ0! !>*0!!!0C 0P88*! /.P P$ ΁!$?   "AL00 h00H%- 0C00000S P0 0  B 0@0\L$   C00 00Su ^ 0 0  0   N+ R" _ZO-Mp@$VdXl`00Qd0W0 T/ 0 2c1  ?80PP O 0v> 0`0?d00 0P0?T0 080?0 <00 4@$@$$%"0000  000T (;0d0P] 0TPP dPN$`P0Sʼ Rʨ  Rʰ  R 0 0` 0S0`@dp?O$@T'pET0}Np0`@dp00c0 @Dv^D PE  0H000Q0SX0 0d0800QpHP 00| 4 JPQhltxPWx@RSY  Y  d@px Ut Zp 0Sl0Xh0[d0 Rwt [%[8P0>C 0C 0p00@t0p` VP x0S \cpt0 0000@4p d00Pg x8( "ό R t0"! R RYv 1 ?)/!! #.ǟ/ B Y? ?.P  Pʉ 00#1?4v.C BAQSx  \tp Ppb 0 Oqp 0rqpb0S@T`p VPy 0R?o20Sb00ߍ 0bd@ 0 qp@pK Q#! !pY@#NRp \TPd0 P0,P`000 `0  ZR 0`S 00@ b 0d@  ~b0S 0V0ZS0 dd`  PTd 8<d @Dd HLd$`X\FZP ?`p@1b0SB H2ß̓"bY2+:##c2S% P#q8PP 0d#0dT0>H30@p9 b00Pd000@p `P ?/( R ß&0Q| 0Z/0 #10">/ 0 C!a0C0 0"#0R"P#. X#0,lX10( #ΌQà3\!=30S 0@! B^ A 00 0'qp: @p(p;Ca#00a0S@@㴰p d @p괰[0"c01 2c1@T 0na0 Q  s!P `aT00]a0S10(` #ΌQKa00@pvEaT00]AaT00@l()\P(\ ףvɻ %I$@-@T pTat X00 R 0 R 0Q/  /  4x h  DQ p@-0l` SPPH 0@#  T\  Q p/ H  Q j.0 0#  Q/,00Ɠ\ 0@-o>lP 0@" \ 0 /A-@P `p@P@0% P PPA-`X@@P pjNP@0& P PPA-`X@@DP pH@P@0& P PPhO-` M ppP8 찟` nPP P @@ & P P0S L Ѝz P W Q F0p0S A-PpQ `@Q P 0@DDB(000S  ,H @- Mp``PP( _  P00S@ _0"S" 0`000S0 6/ Ѝ_0"S1Ds\0`T000S @ Ѝ1Ds$ .D ,h @-@ @O-`P MU PP2SSpPK P@N iP K <10`0,@P6 0nS# =QPP00Q Q P ^  0\  KB" 0 0Q@00oS@d000S ^\p Ѝ4 pQNL` XO-BMM@p_D 0 0QP:PPP  tQPo00PP C @P@`K$0 PPsJp 0P0  0PPeJp `@P" L 0dQ PkPUP p` /0s| 0 YP v@PP0 PpS 6Q P ^ 00BލЍP/U ` P rp@|^0SQ  6KPBލЍ ,K0H00 PPIp=  JY^ P00 0Kd! 0 >0 0E^@ 00 0JC9^0 ! %6^]00& ^ 00 0JP}^  P00 0Jq^` 00 0JPf` X l X zd@$ |ȳ Գ x P H t - M 0  lIPЍ- M> 0  XIPЍ- M? 0  DIPЍ8-0M  0LIPЍT --( 0P    0/ 00,p@-PJJU@p],0,0? `0  6/pȰ p@-PIU@pk],0,0? `0  6/pl @-@P 0003/ @-L@P 0003/D p@-PU?o20S@ 0 00 3/p A-P`UV00P00S@$0$0p0 7/ p@-PXU?o20S@ 0 00 3/p p@-`P@Pp\( ( 0 @p@/pH p@-P@P p 0 00 3/p$ -@- M  Uup@(0(003/ Ѝ@ Ѝ/ @-Bup@0003/x O-$Mؤ @00`P aS0Sp$Ѝ\<0` (P@6/$Ѝ O-$Mؤ @00`P 0Sp$Ѝ`\<0` (P@6/$Ѝ@ !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////H 4   ĭ | l X @ ,   L ܬ Ĭ x d P @ ,  ԫ p d $0(- C^ 0CQ$ :$0S 537$05 0$0(0, 0 0#  $0 0@-@$ MP05505#0%A0!0%^P$00$0Ѝ0 $0R  S 5,3,07$050$0/S 5<37$05 0$00 /0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-DM@YP@f P, p@Y U a@Q UL UK [,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R0#0C R00CT,@DЍF, 0R0537, 5 05 R, S #0C 0S 0C 0S 0C5$0P$ 0@YC @0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S 5>37,050,0@q`@T  p FT")TW*0DSSQPONMLKJIHGFEDCA@>=<;:987bT1 ?R10S. 032 b0 B12 00`s 0 00Q,  P0Ç0,  0, 0Q `YfT ?R0@SQ p9 b@S B77r # C  0c1#0p0FT 0, 00 R Q05 705,5 0,0 5RQ05= 3 7,5 0,R`f 2$01$0```0VS@TI1fR=0D?o20S00FR:DoQP Q P=T, Q05@7,505,Q,0 P,00,0Q  0` Re 0Sb `[ ` 0PV `  ?RL0@SIp9 b B77rR00`F 00R%#jo%#jx%ju-M{00{ Ѝp@-MP`@0 0 4/ЍpG-PRM[  `Tp|PCa@/JP @1< 000pp. Ѝ80S&  1 00< 0 ppX0S0< 000@ ppX0Sx X0S X 0 < @X00X00ꨥ x 8 < X H (@- @MЍXO-EM M`X@Pp+`EaE W0P@'T 0 W@0PT| 0 z0EAP  E EUEލ ЍsX00nX00H ȟ @-`@M pPTP% /W RP$  rR$   0@ P@; rR  Ph 0 @.Ѝ0 Ѝ@0rS +X 0 < < A-` @p 0P/S /KWP @0 Sp 0 S > Wp@-IMM@`PP =p 0: S X0 0vp IލЍpWO00@IލЍpW00\ p@-IMM@`PP p 0: S X0 0Kp IލЍpWO00@IލЍpW00D - M 0  !CPЍ80Q 0 080/p@-@PP`  `PP u JP  p@`*PPp-40- M,0   ЍЍ/ <--M  Ѝ Ѝ/ -- MN<P 00  0 ЍЍ/t <0-@- M@#NP  Ѝ@Ѝ/O-`,M PRpp00:Q!0P00@Ppp @PPX P@ 0 @QXP M!,Ѝ Lp@-(M @P`U& (Ѝp0 0  <p@-@`PMpp p@<0< 0p@-(M @`P-& (Ѝp< <Hp@-P@0 0@`  Mpp p@p <p@-(M@PMp `&8 _(Ѝp\@-@T0 0,M`P gMp p% F,ЍL <C-PpPEUP,M` 0R@@t0 0:2 0U P@ 0 @T *MG!,ЍLp@-(M @P`% (Ѝp0 0 <p@-@`PMpp p@<0< 0p@-(M @`P}% (Ѝp|<Hp@-P@0 0@`  Lpp p@}(<p@-(M@PLp `T%8 l(Ѝp\@-@T0 0,M`P Lp p;% S,Ѝ< Q 80 8@-M80@08 Ѝ880/DD0000 0<P 80880Ѝ(p/0@- M@0@00S 00000 X x PP  d00A%/P00 Ѝ0@JP,[h$  <L < O-M@P D `830 0p@[ P P00U pp00C  Y 2ATT00  RH LD@D T^:[ 2 0000`K L0 V0 W9 @2ATT 0`Fs 0RC K  0 0 B0SH K@00Ѝ V0& 0 K 0 0pHXG0S? 0 Ku B 0  B 0@  0 B  BK`FtZ  B 0  BK 0 u 0 l pK 0 vh 0 0 <p@-@PVKpp p@ 0RS00 /D0D0p@- P@ :Kpp p@<808 0 QR00 /H<p@-`@PKpT T   p@php@-P X @ 00`JpTT  p@p<1!0O- M  ,0R!H ?D`c @ QpVA10A1[10CP8u 0p , PPDEQ Œ Č Ȍ Q`|0?Ap4 @[0S0 ? ^ \\@[u ,0 0 00GC11r 00R0,0@è  Ѝ@80 00}H<404 0@-00 @s@P80@080(@-@h@P80@080-M0 (Ѝ-M0 ЍO-`QⴿiM ȡ̑ЁqP@ nP|?`K͌U ^PF͌(Z =P>F͌(Y ,Pyt>C͌ X Pm0>JB͌8W  Pa=̌1S P,=^B͌`x= 0@ S708T 0H0P, `P P  P P P P` P< PP( QP PP (P Ppx PqP'( Q78 x00CS40000C,0DPPh0 0HLpP(T O( a0P^ , `  `Y i V2 q @0T0 @T, 0Y  p @daZh@0p@ 㰾pP'  W  V 0`1A1S ,0 00@!1S 0D 0| 06?piߍ00,,00PL!!\Z, @  B  $ P8<@ Z& 00A 00@S= 00  1  pW  PpW ,PZ00 0 p,0匰0[$0 1p0@ @p(P  X 0@0@S 8<@PP(04 0R(0Lp DPH1H0i0P@@X$@Lb0P0 001P0[,`0P000FX0TR0P00L80PHp( ^O( `O\( Og( |Os ( wO (  rO( JmO( hO,  ,  00P !AH01 `0V0!P0 @`刾V0,@ `XL($0Q1B/0( `Pp`P V  P p (` 0,0SU,0 00C 00,p ` W# 0 C 0`S: Q P01! @TQ @)T0,   @0,, Q 0@@1.p`Pp`$㶻PP- U  p`$p ` 0SA 04 ,01 Y 0i1 0 S1 1QL ! @0T0p0 @۽T0 ,00 P @T! 0R1V@`n@0P T  0`,0 SY,0 00C00, @ [# 0 0 B0!0@SC 0a0T !1 P Ua P卽U0,000 P0|,0Q0P0P1}`@`0P T  0 @\4 0 0R080000SyO-`YM|0cS PAX3? 0K͌00 00S 3?HPK͌0H00S2?p`F͌(0p00S|x2?@F͌(000Sp,2?pC͌ 000 Sd1?耍B͌8 000 SX1?̌  0110SL1?<1NB͌ 0810 @:Yߍ 000Sk HP0Sv p`0S @0S p0 S 耍 0 S  10S N L0 D@-<@M $( ,ЍL<0 D@-<@M $( ,Ѝ<T0T 0  D@Q 0Q(00?H/<|$ D0D @ 0 R ,  R$ 00?H/|$ 0A-0D   R  R' P?UH0@aaS,p10 0D   C(  \@Ts@T 00|$0 0 <\ \0 0H0S?30 -88  D\$00D/|$0O-SD4M 4Ѝp᣼PD H0 L ! 0 0|!09|@吼P` 0`D0ZP`@P0Z0 TP V@`|@`9L ?3Q 4Q< D pH0L  00|"(09q9`P0S R,@PR @0P 9 R0`S4ЍT `@004  0㻸`Ps @|` |$0 0 ^<X0X 0p@-Q P @PKpp<0S p@-P@P5ppp/H ?300 -00S pp0 0 S| 0DR0  0R0 S|$0 0 4< 0 0 /sO-MpRp2P0@`0Vu T":L"@"4"("2 2 $ 2 T 00 1 X 00 1 \ 1 ` 0 0 1 l  1pmp00pnpp@z20吲唢園 $0TX0\` 0lm0n ;1Q0~'0 0 0 0 rЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000 l4($x<C-pP☂M@ 㢸`P {p2@0@Z- @022BBB {`@2C{@@ÅCC^PU C pP pK 0p R\ @B0 @@@W(P9 0 @@@L(P. p* #p& p0 @9(P  &h000S :3S 5ЍP 5[B2T@ TLJ`Ѝh0S,>pPa$4pf A-Z`pPp [B2S@ T/X000 R A A `@-+ hQhP@EM`_0  S*<10#  !!!- !!!!>  !< !^ v : !' !.{_ !| !o !* !Q>{ R pp1 R 0S8ЍQ L0 0 0Dl00TЍ!fmdml@0l 0 S/lO-`Dt@M[p+%(($ Xع0CS0S4ι3ڹ ߹P*40H @08p{8 t%p{ġ\T(ÂLLßDDßP<<ß44ßx,,ß ߂ß@ßÂ`h"Ÿ! ⼁!: R 0S1810S XけЍQ d2 0 0CLr'>ppGl`( @G T (0Ѝ>P@ <J ^GvD#Ax:>';#8 #5H#2p-/-,`_)|&o#p ryz{@|h}`am c Pm%8k+!,!-!.%0%f&i%j%k %l%m<%n#qs%t~$%#up4%#vr,%d"wy{#%e"`"|oxz(k@hhjp@-'^(@@k( @FT(PpPhO-Mܶ6 `0&Jҭp6划006 0 000SVF  p 3p PP[ D p?P4S S S|V0SpPn 0@l   $ `00 4S  00 40 s 00bR$ 4S4 0%00PЍp PP 4P40 s 00bR4 44000P ?21 R R0 ; 0 $Q B q 0 ;0 pP.4 S S040S$ 4 0r0  cR0$0`S 404#`| pse0 ;0  ޶ p PP4P0u0PPcRT T4S{0z$0P s 00bRS4 000V0SapP 0@  ^ $@ `00 4S 2 0 zS 202#`' pR p 0$ $P0 s 00bR40 ;0 yp@ P< pg 40 s 00bR4 4$RP2$0$ r0 0C aR?o$2&100 ?c p p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100 ?c0`00$P r  aR$ $ Q0   4 00 40 s 00bR 440`00\0\0! 098CP4{{{zQx wAu V 80p@-P@ 0 PD TT TptO-`T4P8 0$QDM@h v :Q{#R3Z 300S 8 {6P@P@P@X@-@?P @?P 6P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o"Q P O-P0,fS`MpvpJP dU0 pr(ʍ"(0I"Rp 3S(0$00 08PK ḰT8P ᯰ XRX5$P50 2T P850 0504S0300SL p0SI 4SC 4S 0d$V、匑Tp"2 =PN 4p2Z LQU P P 傌P oL4Ytx2 PY $4x2$4X|2 Pm 3|2gЍH5S4S 4S0?o20 D $l h $ <% p 0$0(0lX >P Y >P Z >Pp2?;~0p220P_0 r("(0H"Rp7XD  >PZ2Zx2X  >Px2?;~0x2V  y>Px278x2Y n>P<2|2Z f>P|2?;~0|2V \>P|278|2v1S05 4S1zL%R.pZVY  C>PTx2!78x2|"ZYZT!T1tx"|2OZV*  (>P%x278x21|29p2Z0bxatC X X0- M 0^  ž0  Ѝ,X0 Q0H00S :\@- !j/ȳ 0 p@-P0S :#@RA# #p `:0:P ##cp# B'0:#!BA##`T0T-0 M \ ʌ0  = Ѝ䌲8 80 0P T0 0//,p@-PJ|``p@0@ @0SP0P0:3S 8 80 0l0 :L#pر(O- Mll3 0dS0``*B`pP 'WW p p PS p   r  `R  00/"1 R" @0S S8 SW0B S l20d2#`npw  @U ` Ѝ R j  P  Ѝhp P ` Ѝ0 r  `RR 1   S7K @y ` 0  S q  lR Q1   Ѝ>p  q B`R/o"n000 ?c Ѝ 0\0\0 01<  0 8^]]]Q\[ 8= ZG-@P4S43P`Z 80$ RG V ʌ3S23pSoW " Rp *8  @ ?0SZ(?@> 0<000DH0 0  0SI $@5<000h0S80@0801 H0$00 S4$>( P0@$0, 0!0 8C8PT( H00:  @HDHT,0Q0 $00S1H00Sd $  R$ ,D  HD S400,01  00Q 0 0P0$0AQ0,S$00,0,1 0000 S 40pHLH0@0D00|00^p 0SL01H@400 0,00005,00 0Y0Y> 00 0S9` S0F 0R4000,00 1 1 01IY0Cڸ</o"L\ R Y@L0l00PP 0 0 SP P+0 0S0R0S 00PQ ɟ`V0 0CS;  S<[p" 0 AS 0 V P0P ` P R  0R^  `9(00S)< Q0C0!  0Y00S3 80 u9( 0`V 00P0 0CS 80 @ @ NN Œ Č Ȍ N LL80\ɟ`V8 L0T T<00D R 0 R PP+! [R  [ $R   0E0 0p  0E  <000$R ( t7@  <000!R tx[ 4000Vq0 0C B 0,0$ 0S$000,0 0S(00 R, 000:3s D  RD  K<6( 00S60X *1h"0T( 860 04 ` 0``0, U Pp!q@000 @0p 111qW` 00S<00 00S 0X *1h"040V @ 50S 4( 0pQ0A(0 0C03ꔄ 1D0L 0 S P 1 11RY@[1P RRQ 0    #( R R% !#`FPA p0p`P@ !?3 pGWaFP `/0 < p  L  P 0P0P00 PP0kP0D0TV H00S $080  400 H (L2 0 p`\Ѝ $0 0}H000S1( 0<000h0S$0< 40 H00 R d1Sn\Ѝ4 0080@080'P00C\!H00^ʟ00@ 0C9 08 0! u0S7 t0( 0, QA@` 4`! ,\)@XP ptt(|l\  eppX@P P0@, QJ   4p@,@ APWp@PT ```TPp P0`, @AVP4TDE q@DP P! X @   \`Q  ABQ`P P4 BQO p @ p   ,@0 8 R pP p , [!, !`k @@[`c |P0 p WPb   Q   P,@08 p P LPA\H0$00a0`, Iy8 @A[0,  \ `$@0040 0 ]40[0 pWP p p P,  BQ 0`  W G 4 DP  LPp 40P pL0Y0I D|  p0UpP:W WP@ ^@DT GpGGlE@P00: 40R0pp,@0A0,00W0C00P pp000E,0ች PU U Ra0 R  W R RR.0 S0@Z 0 RAA 8 LD@H ,@ X LD 0B0 B 8 B!! 00C0U40P0P,0a0 0R0d400,@\@ `*`vQF RC dP@  =P d1S ( 7@ & 0E00p 0E  <000P |8(  <0 008(0 +0,0 0000S 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  t9( @` 0  `Y( <`@0 0PL5S 0 0RU `>( <@0 0Ln00 0 &<000.( >@ X0 `C`0  <000tW  B0 U<`? 0 0L2P6Pj <00p #U `ʕiH5Sp@TL 0 `P@@U= 88PP ` = 'tƒ /A\  B\  ^tƒ    /$1P0A 00` P;ʀ:l2 S3030 /@P%0000CS 00000000000000000/4@-P@M@&\\ Y #3t P P 00 +000 0 UЍp`P -P\P Y # /@0 0 |  0S h h0 8=0!H00 R/@- @~$881 @-00*l"R !@@ R  ,Ǡ 0:'.tB00 R @R! AR  d}$0 000:h/p@-P@0@`M0*l"R R`   P H000 40@ 0 @ &Ѝppp02C-00$RS MP@ "2` @  "0S 1#{0 Q  l"R. R !`@ '( v@ Ѝ1=00QM0SJ\1`20L100 10剑Q:20t1=00Q!0S0`20l000 0剑Q:20h000 0`0`Y0!Q 00`M0!Q p0 0 0/|0| 0p@- @00CS0 S 0 S P00p P0l0p@-0CS@0 S 0 S P00pP0000 0p@-00P5y@ppp@-P+y@p 0 @-@00J Q T\,Q    @<0J0P\@-\,AP /0S/p@-     @ BJR@P`,PTa@@@AR  Q0p3O-0PQp$MC`@ x0P   BR 000$ЍIɟ, A A!RA @\(` VH aH PuT(P`F lTPE0P ?[1 P` 0P`'uPPq  U   S(@0 TDIPD@ 0(0C\00C  8T0 S~80 ? x1 0@Y  B@DT bp`$Ѝ{aa X@ @ Pp D0|0tp H0001@D T `V ` wV `:` p P@Z꘳@0 0 <p@-@Pppp@@0@0p@- P@ ppp@D< 6O-0dMQ$0w @pw`PtR Pmt0P 0L W00P  040R0000P0@SVK8-RQ`0XPP000PEPUG0000PS0401 000 `Pp @R?+40T R80 # 4 {w$ 400pP }pG0`00000C?00ewP`F`wHP`0 `p00PP Y0 00 0E4,Q,pQpP Qձpp( X4 R!! B qH" RU`pG UH04 S0 0  4 `P,8p04,0@,@0 p<8PU0 4Q0 0C0 Sa 0( 0C0, Q00SPj 0007000C?00v 0pGPSH`Fiv0Ip0P_ v$d1000 0 P  峭 000K0p00E!q Xy0 0H000ᰡH XD0|0ptudЍ004 p` 040T pR0`40  P0K PXu<dЍ` Lu0 0 j<p@-@`Ppp p@\ Z0 0 R`<p@-@Ppp p@EHp@-P@0 0@`  pp p@1<D0D0p@- P@ pp p@<0p@-0P `@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``\O-S葟M D@HP 0W p @` 0Z  D 4/ 0[ ; $[0<ST10000#10#.Q00S0>0P 0@0 0z00 0HP8  #8 S R0 0?P4/ZWЍ0H\8  #8 S R@0刀0pP4/pWPQ" @-@M  R ! R "R pP^ 0 0 @\Ѝ /@-0QM   S S PpP$8R@ @ 2Ѝ8- M 0 Ѝ@zD0D0 - 0 $M  Ѝy p@-B\\@0O ^\1  @ % a ,\'\ n{ \"LB!!A0 ,"!! L0 }p % !    >{ \PUC 0 ER:d!@`P    P0 B! {c\ "0  \\:\ '  px @ l %L  + {l {e\QO-M  pPP 0 &  0 S  n u@`\,S 0 @ 0 S -  QS%S+0L GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 Sir8 00PЍ %0i\@0 `f` 00#1.Q0*Q 0S m@0 SP0% p  0  @0d\% 00 @ d @ 0 SP0%  p  0   0 @@%  c  0 SP 0% p    0  G0%  + @  @ c  @0 S}0  0 @0  00 Sj0 0 @0  0TY 0@x0 0 0  @0  0 00 0 <y000D@0 @l 00T0 S\R [# J00 S $0<   m/ 0> 0S0\S 0 S0 000\hțp@-@P0P`M0S PS   00 0Ph 0 Q00QH  < x0  Ѝp 04p pooA-M0PSL!00@0@P0S? `0 0Ã!1!1"b2c@AL0L  00210Bq0P pW$P@WP 0fSPЍЍ 0Ѝ$ NgA-M0PSL!00@0@p0S> `e0 0à ‚ @0!0A1 0120BQu0P pW$P@TP 0nSbPЍЍ"0Ѝ謵kL>C-M0S!0 0@0`0S2 P0 p7p\1G $@0!b!bpG4p r1c1c@0 0#3c`10Bq P pЍ0< qW X $`0sSP p`XWT 0S lPpPPЍ4-?L*S0 O-TM뀀lmpPQ ,$  g0: 0 @P5 5 e000`P 0: @P} 0S  R 0[ @ #[ =[ =9Pb 0000PX  YS[  M RRnpP W,0 0  Pk[ k0S` P@) 0 ᤓ[ 3$ 112cAt3L112c B L00)ɒ! C 08뉑0P0 P0 0$0 B `@H, p@X 0Sp Okp= @P0P CkXPp00TЍ o  0 ((   $ 0ƒ00@ B0! 0)⩑ቒ C뉑PQ 00 @>  0 〱   l1$N I$04‚!bƒ1c!b1c N0I 00  ࢐9)1i1c1B 뉑P 0tS0cS0S㴠 0 @00 Z@PV  < 0S pp n$gݵNД>kLh-?L*S. A-p@`0\ %\0PpS sS lS@ 0\TTW /000P1CP0@CV`1D !00O-pQ┮qM  PP, 00S0405 `$  l@H 0S1  RS G@T l P  4 @@pT %T@%T400 R,:PmP 400P,H=% , 00,P0 0͟0p0 :T T) `DV%?#"< / XT c`D`Vfz t``` 0`D@lQ0-0 >T0p  Tg@W -@@@C?T@^ >Tp A0D =R=S3t 1CYbevV.`^`0^@ C @0! D 02\* R:0Z'TOP͍ ͍R'RT0   R'R'R@@ppI@[jP 00040jP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 340`0 R,[*P  0:p 40P040`OU:= !1`010@0O1S  0C-11@ST 400 Q,#*P  4 @@8AT @D=AA0@a DQA DR3@D1@ؕ% R ?R ;RK  pR 0%R 0@a0D RA0DS 13 DOS !01000@Sl00l0 0St00t0QU PE@=1QP OU4=!1010@0@10D R-1!TORP=1=1 @pT!1S 0C110 S@Ra  ?R ;R QeR  pRS 0%R 0 00000 0 B10 OQi͍ 0 0}RR0  R}R}R@@ps!R =1X@ BT! $400 Q!`Q,*P  0(p 40040@N, 40,qߍ! 1K00@QU PE=1@1@QOU=0@-01P @Q %-1 1OS00PHjP 400P,V 2=jP 400,`V %``&``VP``P``Ì`@oobP``V d`{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2 iPQ 400 ,R@p00@ 0 o}00 @v00ī ' V84_`i00f&@D0Q0VT&$#"y p ]K5#0@0D!@D0OoB000@00- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/>A-pQM@P 0S! XB hP `V! 0v0* V U~ ``Ѝ_pP0U0f ``U ڬ. 0 0 R U ̬UlƬP0S U8 ᷬ( ڄp 0S R 8(C8B((0 000SU00 P f  8C8(0P f  8C80TzU@t4pL( * * ) ) ht@<<d) 8) ( ( ( 0R@- ME0S@  ЍA-pPP U) @T`V 0PS |@P0DV  PP HoO-PRM `Q 00Ѝ@ pPb % pPb jPc P%d0 ES  gP  P  0P P P0 S  P  `0 S  `  }0Sn  v0`S  n0PS  f`V$ `P h$`%PgP !IgPBgP  C뼰 0$[PP " [ `$@ . (B8BBXnS0 sS fSU0/oS" R0000P0`h&h V 0@:  0S  C("(  ` P0  P W0U PpU 00d P`Vl 챟Q`Fh&hVPb   0 SPW   P`U= op嫲  `PEX%X U !   X p *`  p0 00  PR0W00Pi0X0  v 0P/W  R000Wg  ]fP$+ _P0(C-@a!`MPp 0= P E00B0S? PЍ`P  P0 p  R 0S 0PPP  PP004PЍ   0 P  @``+ P*F`PH|! HGO-M M0p0:S&0:SS@ 0PS:S``E[ P!* ;0d@0  jP 0P:S ۍ Ѝ@ۍ ЍC-PŸM Mp@`taP# 0/SB ȞP/xTP 0 ۍЍCH0P ! p tP+ph80P 0S/S pP fX vfY WP ;0 ۍЍC0 PۍЍ  p 0lif XW P0P 0 $ۍЍ404 0 $PF     @ tD0 PD G-p`@P  _P:fU  VP `P@PP @T P  0@010Gptp-@- M@00 Ѝ@ Ѝ/E Ѝ@ Ѝ/@-@eee@ee e0e@e 0p@-S@M 0  Ѝp0`P0 0 0 0` 0 Ѝp 0p@-PS@:pS dP!pWcC- M `@V pᬐP0fU@@`V  k W0 nU sU ` `V  @0U00 Ѝ R@@@C- M PU# Ѐp`fRPU @ 8E0P 0 @nR sR 'PU 0 Ѝ 0S008#8 ЍPA-P# P 00`p`0,SS00 0\,\@CbP   `p`@ c C-p M@`P(P>pWX*nUO sUF fUH0D Y)RA @  dPK H0D@ pH0@0 H0H0nUp@0 H P4 sUG fU? L00L0 Ѝ@P%  @AP80W D 80400 Ob 0S00 80 @H0R# ,0 0_H00H0H0@ HH0@ 400MH0@04 H00EH04 0H040, R0 08H00H0X   0O-M@0[ ` Z p p(080H0aP0; P0  `00 ` ἀ[`   ` `pZ `   ` ` 0@ 0@Ѝ0 0@- 0 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\耂A-`P0PUM@p"S& bP !P  ᴀo0V00  pd  00 0ЍPЍ)a pL  O-P@ 04M 00P gc`Y`4  pwb 0P 0! Lc`|  @P @^b0P 8c 4Ѝ  0 -c +c,0Y (0 0$0,0% P@ `,, `AR   0S00WPv Y  Tr  `" bLp W@`H @ D L F , `$fV8   0 P+ pW9  BHDhDnVDH sV  "0 S   ,@  `b 4Ѝ t B `$b$_^@S  A-P`0`VM@p(S, aP$ A`  㶀A000 P800 00 0 0 0ЍPЍ_0@-P pW M@`R ^aP 0 ` 00P 00 0 ЍP Ѝ_O-TMD0 (0D0,$0:080`P ||@P00PP 00zP|T Pd:P{P`P|  P" U $0 T $0(,P `= $010#0`,00 0xGxwP 0s 0PI (,P 0S , .S  ROS1 = .@P# )PPD @ HDHt 0n P L^L00S P PJ$0 F0 0S t 0 0E0TS$0 P!0S000040'X0_ 0S# ` @0@SR xGxwP00$000 000 f0:PV 0 `@Z 0 Z` 0 Pg  (\Z  RYX%Q^ZQi @T 0&0FS Aw  0P 0 `I0J0 SE0J/SVTSRQPONMLKJIHGFEDCBA@?>=<;:76{3210/k-i+*)tyu0Z@ Z8 50 00@ 00@0t58 0000  0P` P`00_ 64 $ 0P0@f P <P" 0$00 000000 s0lPi r` o TЍ  00P0` 0 0  0  0  0  0 04 $ 02 0?T 0 #t  0 S00|Ps `

$0P00?//@-M@u0  0C@N $@L0B!b!bN?AA4 1c1cL0P0@$D$C!d!bA@C1xPЍ-?Lt*S p@-0MP0`2@P 0ЍpY, 0 0S Q20Ѝp1!0G-@a0PP04 0 4pS 0p02,0PP0  |Qp`  WPepEȄQ  W| 0 ȇ0H00Tl(\(@-@P ^^^ ^$^,^^,00!R  !4' 001/&001P//&xG @--@ \@\ @ 00s@ H PJI HH @Xjhp@-G-(M7@ @`0@PS~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " kU{F{{!00 (ЍpP P # 0U 0 f {Ukka!00 P ~P T# 0U0  0"{P  0cP0J30{U 0kk iP  0cP0G20U 05{kF{{TPn  0cP0t20U 0x 0"BP;  0cP0x0 0U " 0P;  0cP0|10mU 0 !a1""UJP.  p0cP0%ʘ 0U " R b0cP0$d10U 0T1""P  P0cP0$10U 0 1""P  >0cP0@00U 010""P>  ,0cP0@ʜ00U 0 0"P  G??ih @  ( G< Ǭ X , 0cP000{ 0kF{U{# P  0cP0uʠ30{U 0kk Pb  0cP0\30{U 0kk3 mP  0cP0n30U 0_3""[PF  0cP0L20U 0=2""IPO  0cP0ʔ20U 0x2""7P  0cP0EP20U 06`2""%P5  |0cP0 20x{U 0{ P  k0cP010g{U 0{ PD  Z0cP0ʌ10U 0`1""P  H0cP0H10uU 0 P<  70cP0k10U 0\1""P_  %0cP0&00U 00""P  0cP0ʀ00U 0t0""P   8 p  D  x Gl  0cP0(,00U 0<0""~P  0cP0l00 0U0"- lP  0cP0ʰ00 0U0" ZP  0cP000{*Rk 0F{U{ EPn  0cP0`30U 0q3""3Pd  0cP030U 0<3""!P  x0cP020U 02""P  f0cP0Wʔ20U 0H2""P0  T0cP0HT20 0U0" P  B0cP020 0U0" P  00cP010fkU 0{{y P  0cP0ʈ10U 0d1""PN  0cP0 <10@U 0% Pc  0cP0Z00U 0K0""P  0cP0ʸ 0U "5 ~P  0cP0qt00 0U0" lP  h  Gp H $  Ǵ 0cP0_(00U 0P80""DP  0cP0h00 0U0" 2P  ,P  00{kF{U{!"00 t3030vx303 U""00 aH30@303 U""00 Q30\3 U""00 D20{Ukk!00 720202 U"$"00 'x20p20c2 U"!00 @20}t2 U""00 2020L2 U"!00 1010$ 2 U"p!00 10b10101 U"G!00 `109X10kh1 U"t!00 (1041 U"g"00 0000 1 U"BW!00 00400g0 U"G"00 00p | 4 , ` h P 4  , D \   x l x ,0 U"T!00 bP00FX00`00.htp00Nx0 U"!00 I00{Ukk!00 9303 U""00 ,30{Ukk!00 X30vP\3 "ZI aI 3 "U"00 20{Ukk!00 20{Ukk!00 20S"00 "00 l" d" A K| :PI S @ w"00 r"00 m!00 h!00 kka!00 \"00 W"00 R!00 M"00 H"00 C"00 >!00 kk7!00 2"00 0Si *!00 }0S2 "!00 u0S !00 m0S !00 eP  _0S !00 W0S !00 O-DT! @h 4 X $ 0 0S "00 70S !00 /0SO "00 '0S/ !00 0S "00 0S !00 0S !00 0S !00 0S !00 0S !00 0S) !00 0S  !00 0S !00 0S |!00 0S t!00 0S l!00 0S d!00 0S~ \"00 0S T"00 0S L!00 0S D!00 0S <!00 0S 4"00 0S ,!00  3 H "zP !H H 3 "0SI!00 e0S !00 ]x# cp# v"00 R"00 M"00 H"00 C"00 >"00 9"00 4"00 /"00 *"00 %"00 I mI |2""2l0 02L0 0 2,0 0@2 0 0\20 0820 020 0|10 0s1l0 0j"1L0 0aK1,0 0X^!00 P10 0KS,10 0Bj10 0990 @@n0 ,L0l0 0#?<  Ǥ x | T t | d  8 l 8 | 0P0 040p0 02X00 0|00 0`0 @@ 0 s0 @@0 100 0u,1P0 0,P1 @@0 o!00 10 0!10 010 0G2 @@(0 r82 @@X0 el2t0 0\20 0S+@!A*?B0CS Ϡ-6S!R#  S Q0 {+C 7G 01046n kȠȠ+S 0+C{6F{7 +S0+C3S S 0A.B B03200Psr/ /P 0S $0S 0S P? @4@P//A-0Pp8`P' , R( 0"0, 4000R40G@BT@! V @D8 ,0400G,0 4 00(@ ( 8/P8,0S0Q 400 @-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?000CS>0S! 06c@<=0 Q,=00 C/(0 S0(0< 03@`<0U 0PEd@T0S`& <0-T0PEd@TU0 C0 0,0 Sp P<`@@C0S 0,S40 PC0000 00 0 0 00[0"1<@0Q3 tR0 p (RR  4,00 PUSYt+H; 0 40 30D <Ѝ D R S R  P;0 PB 0S  0 0C R 10U 0PEd@T 0 B00 00 000R00S2P  0 Sf8&#4<f4#0R :00:0 00 80B4 R,5@0 0000 D 00R1 P! BD A   B\000D0Sp90l9 UR000 0 pP<`@@ d0)pS ʈ0  P<`@@ ;tTUL 0PEd@00 S  Sg S. 8a@D00@T6c0PEd@TULQlP80 R H0A S00 CR*ʈ+R~ 80070LQcD0ʈ;70\0T U 0PEd@00SQqʈ@6c@D \700 $ R40,0000 700XU  PEd@T  E !RB 60U 0PEd@T: H0!ʈ0H0;6a0@D;Ut 0PEd@T:0D 1ʈ0+D0 6a@D+D$60[ U 01[![V 0 0C 00  00HD0 PE 0CD0 p0D`l QT U5 0PEd@00Rl @Da0 T ld0h \X ! 0PU 0PEd@0S^6c@D0l0\ 0x R! / R>400 Q 0SU 0PEd@T 0V  $400300 C R=0 U 0PEd@T30F?o20$0S0a #3$&$B0#22cRV0S  l30T0PEd@TU  0t$ R R& D U1![ $Q P LQ0Q 0 B0 !t0  0D PE B pD Rk0h" D 0$ R@" D C$ R$ " 0+06c@D;D10 R 0 B D  0|10$0S  &$   0K` `@U) 0PEd@T$0D`S` 010`+@U G$ 0R $P (D R2D507S U      0c 0S PE p0`> =?>?N?P?5? H:M? Q?H?A?L? J? D C?ct B| 9?:?;?0@\,( @Dʈ+6nc2a@D0 D0B $0S`0  03`@03&8#[ (30Q Q6c@D;D  3 +0l3HL0  300@S3D0y `v0aS3@D0P0;T030 0X00\00 C[PEd@[U6c0D@C c P5l01r0ರ^l4a@D0R!B"0$ 8 S0l0S>0p0P00X0?0X00 p0tmP 500 (Cu @m X50`5@0 0`0n 00`P50y5l 0[pPEd@[jUEF0L0Sk 0 0006c0D@Ca|(1 T*U $((UW PEd1岐@^ $(6c 0DQ6k @CD 7L0 $ R&400  0Z87@`0F 0cQ0`+@GP6c@Db 0ಷ@D&a"@`07l00 0 00pP<`@@0 $(C S>0p0P0 0X0 Xtp0(0$$(0P/ \80( &b0R0 S(08@D0 0cSR: 3@ 0@l08@0390Ud p T  \  \ h VP H90j0 `C^0Sl90Tp@-@JPP80S $ (2/$0(3/00pPA-@`2PP@p0 QR 408 B'4 08@!V000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000@P`P-@ R2Q <001 00S!B<@0 RE R 0c Pࠓ^ S R6 0 1 R` @ <001 R@ 0 <l0P\p[ G R R 0c P  R S R 00S  0S  pl0Sp0p0Cpp0)x 000 0AP,040p0 p0 0 0 30 Ѝl0S  pl0@@@ "S???0 P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPZP 0|!(`3/@PW 8pW8 (  0(3/pPH 8 $!P S>0R:oRS B P T  B T p W0Bp$ (0 #88p@p  BS>00p08 ` P S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-M@ @㬰PX 0C0 0$SQ $C0p`0 sRpW0- p  p0 Ѝ0` R`V40sDJB 0|=J^S3 0b6 08#8^0X 0 0C∀Q\ LX P!P0!01 002T 00(0! T 0SЍ0W0T0S Ѝ 0D?o240%R00S020,0@0000,004@0D?o280 00C$0 (00 00PU?PU@PUAP0UAPR@oPP 0CX2p0;(8ӗ1Ӆ1&=tPxl0PfPEN N0NxtPAPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPPh`l \0S8 B0l0\000Sn tP LP`,0S P'p00F S#0`0 h0S:l R1#P0 6SL \0P8 Bl0\00PЍl08  :R&ƃP&ƃP&Ɠ) )hP\0P8 BXl0\000SЍ  O-ldl`,M Pt \l@80H00XT 1#D04 @  QH0@ ,0 DA?C0CR`Pƙ Yp0&0D8#( ƙ#<0ƙ3@0 B0(1I>RP30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80XpT`tP` l H 07#0H0Xl \0P8 B l0\000S,Ѝ80&6&6!Ɖ909t6l L Qtl \e 7t0 S` R S9 Sl@sX 1`o 00400D @$H0 A   @`@ Pl @!0 PPH0P  `  @P$ll R1#\ Q \P80 B0 Hl0\0v0P,Ѝ\P80 B0 5l0\0c00S,Ѝ O- M ,0PK[@!ܔ0 P0pUpX/o" Xp ypHor 04 0 0B % B 0 0B 0 #40BVU2W0>&* Q!L:l`\A `Fp W P!P1UP! U:XUppU0\ 8`1  \ 0PE0 000C00U00\  W 0 B0 0 PpU` , 8Ru0A6d,0l0 &\0PpU`l0&R65V`    R\S#` Ѝ R R0 PR \:0S@\!f!glU!1^  RX  p\h$X  p\h, Rl R O- M`ܟ 0P0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPD/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S|>00000 S *S0SWq00Q 0SD0@S>P0 W0Sr S00V0 00#400 0 30  0#400  0 [0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000) R0f9S ,0 00 t0  R ,00S0Q01Q0$ Q R 12 0 0 0 0#40 0  0 0 S0 S 00R01 0 0  0S 0 0 0#40,0S0 0E000S ! P B R  PE[ P 0 X0 *H 0 ,0 SR0 B00 0 0 0 0 0 S0 S 00R01 00 q00? R}0ES IS< [S7 gS7 /0S0CkWi @8 RC0SS@ S   00#  #800#"0   ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S+  Rg00 0 B00,00g  S  0Qq R0000 #40k0q00Y0SZt 6l8&`6&6!ƅ909&tl0I0Qtl0" Yt0SWd :W㴖K 6SW \0l S8  B0 l0\000SEJ\ R8 C0 l0\000S8 xZt0(l 8`R B  ^C 6ƅ6ƅ6!ƅ909&6Rt0l 0C t0l S+t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [P Ko᫲[@ `P``0P&0@&0!0ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0800S=q#  #800#"0 00^B  00d*W6F &R= \ R80l0 C<0,0}j 10 0 0010 B 0L0DC0C -t0S*l0\06\0l S8  B0 l0\000SD10-\ R80l0 C97531/-A-`pPTqP@G Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0`]p# 0S%t l00\ R6S S L D0 B C060@! Rppp@-@0PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV0P0pPO- Mp`80S04< 08Q1S00PP 0 0S{ $0Ss wpVjV`F0HSs0FSRo WmZkYFo᫲[dV @!( `4/@Pi  @ X  P "L  BT  A4 * 0`, ` ( P6/, ` 8(6/L ` @(6/j 0 D(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0` (0} Ѝ8  40 000&-M 0 0 AЍA-P@PUP_8 ` 0l!(3/@PR T!@ 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/`O-@QM R0 x  0S " !,"pHP` p@00 + p % *0 @p'0 @$000Q  B1;`,:)7(463041 R P%BQ` p@!0A $ " Q"$, !!   R!,  " " Q"$,     R ! P%%   R,!@S4X RPR aR,d&P%PN&, QR,T% R%, QR,T% R%, QR,T% ^%,  C  0@S 0 " !T," ЍP ""pBW1C1Pu$hl@ C-PRp ` P  01!0\0 0#@B .P@@1R0  C @$'\ C-PRp ` P  01!0\0 0#@B .P@@1R0  C @$'  @-@P xpxPp`@` 01ē!0Q0 0#B    @-@P xpxPp`@` 01ē!0Q0 0#B    00@-8P^00# @L   0 G-Rx 'xh Q RO SRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#pG7&c20N 1pW|GpG1^NNPV=F10C>@@P  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0@0C 00 pQ80'7b"c2pGNq&R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/e U/0S0`0//`4 H466@-S k>@@0 #400k.06S0 k΁ς 1O- p:PTU0!`Q` !ᲠZ* V @: U @0ς!\KU V*  p0Q=0^ Q- Q- [ O-@ 00 0p0 S01 ]Q ⵟ 0100W0 X.0[ A  װ& 0А#"^& 6 2#60 SZ+ ೞ0JYJ Q LG⋰@ 0p@Q0C Y> 0@N0A0 \0000C00 LQ @00^ P0 00Q00S@\ R 800SC00 R0@\<ЍW@  yQ / !02@X1Z Gೠ6;#6pQ^p N  p=A-P@1T`R`QPEP0+~T S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O- M`V00Rʀ@kf W !.⼐ 5b8Z#8$PB 000#406P0cY 8#8V⼐5a8Z#8P000P%TPVAPeY58#8 B("(Q1P8#8000P#406cR!0C 6V V0T@R p` RPF_oRPU RV0W R+AʲpᰐgZ5P8#8000P#406pGp0cY38#8 WvA7Pp8#8k.00P0p#406VPcQ 0C6B0T@ Ѝpᶐ5i8Z#8PPI0 00#4 06P0cWs8#8 UVZ AU0pX%Xk.PPP0p#406VPcQ 0C6 0h0cQ^`弖0ᾠ9`jY8`J #80 00#4 0编0iQ8 #8 R0἖`3006/02PV , B("(5VPk.0V0p B("(7k V0&0a8p#8<ʀ6O-Skn⼖0M $P  #  # #  #  "!A 9@b8 T#8@p000@p#406 B0c^8#80἖&R @ P$ pḀ9n8 Z#8 0N 00#4 060cX8#8qX tq@DH$H>phW8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಐpi>X8#8000#406I0cWs8#8 0@弖^| `D B("(9@n8 T#8@@p000@p#406N0cR#8R0἖\ 9b8 Q#8 @Pk`0`00@#4PP06 Bc^ 8#8k0&Ѝ0἖10἖-     0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&ʀA-Pk@8` R   pp "$ &bS1 B k>&0  8#̠   4##<V0 0 Q000*60@-S S00k@@6 0C60k>@@@!PPƂ00@-k6 # S("(00@P P 0 #4@@06 c\  ( 0C"(k΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@@ @"$PP Ɓ0O-0 QR M@, R 0p&]P+(+0N  q/ ! RF@P j   Q&Q3 "[r&k R0E 2 8#8000 #40&0bP8 B#8k0&N.V }G.0 0S0 0xS0  0LSI>X&&&&0 Ѝ,  \ P+R +R ,RE R  Q ,^ R3 "&][Pj 0q ЍO R \3 "[k 0("( Z:8#80 00#40缦0jR#8 J#8+ ZB!(:ἦ8#8kΆ000#4 0缦0jQ8 J#8 ! Z:ἦv8#8kΆ000#4 0缦0jQ38 J#8@! Z:ἦU8#8kΆ000#4 0缦0jQ J!lMk>⼦ / ! Z! ! 缦jR! J!^ἦ   u Q3 "[8!8#88#8z8#8W!28 #8`` :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  p@-@P`d0P \0P @T @@pVpM&@ pyaratcid@-M @PoЍƿ@oЍ@-M @PЍ跿@嵿@Ѝ@-M @PoЍ覿@oЍ@-M @PЍ藿@啿@Ѝ@-MpP@ `P `Ѝ I@p .ЍuP.U `0A-S ` 0@ Cp&PIU PW 0 0A-S P0@PCp%`IV `<0090A-S ` 0@ Cp1P{IU P! 0 0A-S P0@PCp``IV `00@- MP pIp 0S p@0@C%`AIV ` Ѝ0 0 Ѝ߾ Ѝ@- MP KIp 0S p@0@C`IV ` Ѝ0 0 Ѝ躾 ЍA-Mp@P `P I@p - 0S P 0 C @HT@ Ѝ菾`Ѝ芾0`0Ѝ胾P-U` Ѝp@-@PW0PPptcidp@-@PK$0P p! 00ploobp@-P`@P  '0@@p@-@@@-@@@-@@@-@@@-@@@-@@%@-@@A@-@@Y@-@@q@-@@@-@@@-@{@@-@u@@-@o@@-@i@@-@c@@-@]@@-@W@@-@Q@%@-@K@:p@-P`|@P  0@pp@-P`j@P  0@pp@-P`X@P  y0@pp@-P`F@P  g0@pp@-P`0P2@P  S0@lpp@-P` @P  A0@Zpp@-P`@P  /0@Hpp@-P`@P  0@6pp@-P`@P   0@$pp@-P`0P@P  0@pp@-P`@P  0@ pp@-P`@P  0@ pp@-P`@P  0@ pp@-P`@P  0@ pp@-P`0P@P  0@ pp@-P`@P  0@ pp@-P`n@P  w0@ pp@-P`\@P  e0@~ pp@-P`J@P  S0@l pp@-P`0P6@P  ?0@X pp@-P@A(0P p&0P 0pgntsp@-P`@P  0@5 pp@-P`@P   0@$ pp@-`P@ <P pgP U Vpatadp@-P`@P  0@ pp@-P`@P  0@ pA-Pe@ X0P p(`P  P ` +gntsp@-PG@ (0P p0P 0pgntsp@-P`/@P  0@ pp@-P`#@P  }0@ p@-@R s0@ p@-@!Pu $0P pK00ploobp@-P`@P  *!0@j pp@-P@P e!0@[ p@-@ @@-@ @@-@ @@-@ @@-@ @1@-@ @@@-@ @\@-@ @t@-@ @@-@ @@-@ @@-@ @@-@ @@-@ @@-@ @@-@ @@-@ @#@-@ @1@-@| @@@-@v @Up@-P`@P   0@ p0p@-P@P  0@ pp@-P`t@P  n 0@ p0p@-Pb@P  0@ pp@-P`Q@P  K 0@ p0p@-P?@P  0@z pp@-P`.@P  ( 0@h p0p@-P@P a 0@W pp@-P`0P @P   0@C pp@-P0P @P ; 0@1 pp@-P` @P  0@ p0p@-P @P  0@ pp@-P` @P  0@ p0p@-P @P 0@ pp@-P` @P  0@ p0p@-P @P 0@ pp@-P`| @P  v0@ p0p@-Pj @P 0@ pp@-P`0PW @P  Q0@ pp@-P0PD @P 0@ pp@-P`K @P  -0@m p p@-P9 @P f0@\ pp@-P`( @P   0@J p p@-P @P C0@9 pp@-P` @P  0@' p p@-P @P  0@ pp@-P` @P  0@ p p@-P @P 0@ pp@-P`0P @P  0@ pp@-P0P @P 0@ pp@-P` @P  {0@ p p@-P @P 0@ pp@-P`v @P  X0@ p p@-Pd @P 0@ pp@-P`S @P  50@u p p@-PA @P n0@d pp@-P`0 @P  0@R p p@-P @P K0@A pp@-P`0P @P  0@- pp@-P0P @P %0@ pp@-P@ (0P p0P 0pgntsp@-P`@P  0@pp@-Pp@P 0@pp@-P`e@P  0@pp@-PU@P 0@pp@-`PU@ <P p P U patadp@-P`@P  _0@pp@-P`@P  M0@pp@-P y@P 0@|pp@-P @P u0@kpA-P@T X0P .pA$`P  EP `&gntsp@-P@6 (0P p0P 0pgntsp@-P`@P  0@*pp@-P@P %0@pp@-P`@P  0@ pp@-P@P 0@p@-@Q 0@@-@R 0@p@-@0 P &&p@PP0S p}0DH@- @@dGqP 0R @-P Q ȱo//g g 0S p@-@L`P`PpoP p@  P ᘱ0 0 o@-#D" d" @-P Q @胱@ @0@ 0 a( (0( 0 b @" " D" ! 0  0< @-\ ," ! mA-P`p #@P P` `ppܭP`  Q% `F%C%,n|E@- "@P $0 0 0 nA-pP "@P" z0 0 0 ˧P"`P  ` P0 000 ,0X |@mt D  @-@P @ xi-A-M pW $P0 P@@P"`P  0P@ ZЍAЍ/ЍAЍ/ 0 0t :l P  E @-@P f@ 6'p@-@P x0 00R0 PJ"0P Q   p@Dppka p@-@P `0 00R P("0P Q   p@p8k`a P/0 00R /jP/<0 00R0/P///j` 0P p@- o QP  QQ N /@j`` P/ 0 00R/i@-@P \0 00R  !0P Q % 00i_ P/00 00RP/// il_ A-PPM 000/o"P R Ѝ R0 p 0 px!`P 0 S  R H  ? pP` #  00h5 |^ p^ A-@PM 0 00R ЍQP 0 I 0p=!`P 0S d  PN? pP` #000( (0( $0 g4 ] 4 ,  + P H0-00/o"^ R  R/fP/D0 00R /@-P +olf\ P/D0 00R /@-P ofT\ P p000/o"\ R RP Q  Q /e[ [ fP 40 00RP ܮٮ/$e[ f$0A-SM`"P@U Ѝ0 PqP  pP 00 0cP S " o @P d0 0 0 @Ѝ4 PRP  0,dX 0 //p@-@P& R 0P:P Pp! P `0` `0 L0L L0 808 80 p |  \ , < p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ Ppp@Jp@-@<PEPp/>P Q 7P Q>/P  p@) 0p@-SP` @ 0S @Pp<P QQ P/P >P  p@p@-<X@P@(@Q Pp$pP  p@P  $@-@P@ @-@P  P 0, 0a!@^!A-PQ`@   0 S S C\P 0 S S C^\<S>0S: !S#0-S50F?o2-P0S-0S'S% -S0 -S0>S  0/S^ p(p 0 S S0` ` S S /S >S S 0 S S0FU0 R*wP0/SZ 0$00>S] S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p 0 0  S =S`B`0"S0S  0"R "R RW0$00>S` 0   0C  >Rr0   P\ @-Q R$P <PG &P@aT lT gT, qTuPoP tP;P"tP @mT pToPsP;P';P<tP;P>@pT@;TS0S/Q /@- BvoO-MM(@P00H1 p0$`00 0 00[ Q`$ 0`;/0 ` 0S Mߍ vP0 3/P 00$ 0:/P 000  0SMߍ S  00 >SS @S @@KP@ BA-`RM\PPp2 0S/ @0U  UO 0/P B 0CU/PU  U0 0/Q B L!0C@T@!  ߮;@04D .00Ს 0 S* ͮ}p@  8V P8:빯Pۍ贯?00갯00S08p !9`9D8p 88pPH C-`MhP_@PL ,s8p`C 9pC 0pE eS;!0 `܌l8p'    0 ʌp" 000Ѝ 0 0 `庌J8p  Ѝg@;8a9\@- @v9@O@-fP 0 0 ⸬ x  O-IMP  @Tl p ` Y 9/0 pPS @T[ 0 R 2/0eF P003/Y@ 9/T eT T @@TA 0SM 0 3/P Y 9/e0S, @0 R 2/0e( P Y 9/Z3 0 03/Iߍ 0 0 > 0 0 5 0 0C/, 0 0C/# 0 |0C/l l0l 0C/B(   E x x ; T T  4 0    t   p@-P@PP  P $0SP  R Pkp`sP P ^PP ( P : p P0/O-MM(p@ T 000 000S+`P$  T%0 ` P4  0@ 4/@P`P@003/0 @PMߍT00 0P $ 0R000 Mߍ R00 0 0K/S|   0/0/@-@@P 00#0 0 P 0S S R/P/ R0/  @-@"" 0p@-(M{P@ | { P8h``oP (ЍpD { @8P (Ѝp $@-@d!@- @@|!Jp@-MP@` `0Ps*0 00 Ѝp0"Sp@-M@`P Pqp 0 00 Ѝp0"S 00 S 0 P :\03#/S 0 P \0///A-P``>] @P UQ(pP (D@P u<=W@0(0( (0 $ H  00 S 0 P :\03#/S 0 P \0///0@-M @P  @ Ѝ00@-M @P  @ zЍ00@-M @P  @ lЍ00@-M @P  @ ^Ѝ0@-@P ,0 00RpF /P/0 00R / 00 !S R!* R0:/ - ^0 : 0P0*  R*/@@/ / $FP $0 00R //P/D0 00R / 00 R /8>P/X0 00R / 00  P :/R /=P/<0 00R /  R*  /t=P/@0 00R /0S*8#80/$=P/X0 00R / 00  P :/R /<P/D0 00R / 00 R /d< P H0-00/o"^ R  R/ <P/L\ /  JQ\/;P/L\ /  JQ\/P;P/P\ / Q/S/Q\/:P/P\ / Q/S/Q\/:p@-@ 0M PR000 0 Ѝp$0S `0-S 0S0xS P T P ЍpPP4Ao/A-PP P`p @@P@@@P p4:0,p0P4080<09L  @-#@A x@-$@@( ߟXt8ᕣ④@-@@O-4@T ,`@D¤@@`T PpQㅑ rPZ PPZ P0 0 $L 8z @-R 0P< P 4Q ,  D D0D @0 ˥0 000 0 ¥@7 c p@-M@4 00R;SP,0 S R' 1`V8 P` 0 0P 40, 0C40P0 `ЍpS 0 0D ↥Ѝp ЍpR t t0t 0D n\ \0\ X0D eH H0H 0D a\먨 PaH 0$ <q 0A-@`,pPP W 0 !ᛦ,P0`,P0`G-@MP `RP m00pЍ!  0P (0S1  0 P (0S$pW00 0P 0S  pP  P X p  0P f( (0( $0\ ӤX% ܥ K 0  0 @-¤뜥 p@-@P p0`0VPP L L0 0 0@S<0  0pp20 0  0 @-鐤Ԥ (0p@-S \  Q @PPp 0  0 p1P h4{p@-0S h`@`PPpP p@ 0  0 K@ P4 @-R , B04 P @@ @0@ <0B/1, ,0, (0B/(T 80 \p@-@PP0S ,  Q<0  0p@=/O-p`@40SK nP@y P /P 00S 0Q 匑 # 00R&P P [G CP P aP 0  03/P PP 0 S k4Oha 00CS 0 0PS Ph1@T T0T P0J/⌣@ @0@ <0R/⃣8/ X | pD@-@0,S<SSDPG-Z `p0VWV@P/ 404 S"S` R000,0 100,0$ 100, ,0P ! 0 ?o2\0S! `  P :  404 SS`  4 40S0SP``D D0D 0.}, ,0, (0.|,p hXL h0 poG-PP' 0 0R"p[4b`P 4 R @,0儡ᄑ1 ,04 儑@ 0T:80804 =` +0P 4  Q@-P80080/h*p@-P@ 80080p@p@-@P 80 0R@ pP 4@p)p@-@P \0 0R@ p`P 00S@#: p@)p@-P@ @ pA-PP 0 0R4 p` 40S @40S ,0 @P ` (A-@P 0`0VpP 0S P @T @ @0@ <0R/@ @X(Ԛ A-`P 0P0/o"Q@@T 00R pq  @P @T f @ 0  0R/֡' O-@PM h3P 0R @Ѝ4 00R80`: pP @P@+ ЍВ  NpP0 004QY 4 R] ,剱1Q   P 0YId  B B!Ἂ,0 p 04 P<0 04 <0 g ᜕p,WC<WEW+Y& 堡0 2 p K  pP | C 0,S<SS5 P{@<0, 0pP4<0x ,Yp  ,L<H! Z,0p 0 0^/hd d0d 0c/UL L0L H0^/&$ ,x `T 8G-@S ` VP p P X 000 GF 0 0i/Ⳡ\ @0P L- ?o2 ^0S 00 S/P"@-PP M @1 0R Ѝ`@ 80  Ѝ@  ^0P 4 Rp@ Q(*, S1 B!౉400C40<00<0h h0h d0s/ST T0T P0s/J@ @0@ <0s/A!ܓ H $J xI0P/4  ?o2\0S/00 S/d 0P D- ?o2 ^0S 0 S/ P/0 000R/P/0 000R/ P H0-000/o"^ R  R/lp@-P@P P 0 03/P P @pN@p0S /A-`@P@pP $0Sp 0P  pAopp@-P@P ϓ PP p0@ߡ@Pp@-J@P 0@@-@0P P 0R R@-P0S /go/808 80 D$0$ $0 <|| L \ ,O- 0S: @`P1 X3qPp 0 R"  0S P XP0UUUB!#10@<0.B,? @H0SOX% X0@#r 1Pc @-@P ( 0 0 7-(谱c x@-@P $ 0 0 7$hb XR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@x P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@P-8000 0@0 !0#2 /UUUU3333  4p@-PQ@{ : S R Sd0 X Sb0?0 r - 0!=w- S ] 9SL @Sx00 r - 0 w -   R> R9 Rx 0 `r- w- R0 R* R2 R x  00pRs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- H0H H0 9: S{A0a0-0|\ O-P4A@:  pPA ;PA  lpP% 00` 0@T' l:P0=S AP` AT BX!  D0D D0 >* O004[ ܠhh"h2C-@`M 0PDH L0PT@g X`P ㈐@@@@@ pk pp p` n{$P  {j{{p[ X0p 0S00R8@<@@@@40040,4,,0,땉H1H000D0 00[ᣉs,X  #0S pp@ 㽒 㹒  Ѝ oЍ @0 0 㟒 㙒 㕒P؞O-PMp 0GW"S00` 0t@P-TPe +T@`0> ǿ 0 6 0 .P !ʎ @00D \a0DSW0DA0DS"70DWUX: QP S \ KP"000T@ W. 0 p 0U00S 0pS 0F0 Ѝ0S U 0@ 0` 0R00  Ѝ p夀夐 p0 0 ?ُf XR A B0A PR W `@Wp ppꙙܛU 00M 00Ѝ52O-PMp 0GW"S00` 0t@0P-TPe +T@`0> ǿ 0 i 0 aP !ʎ @00D \a0DSW0DA0DS"70DWUX: QP S \ ~P"000T@ W. 0 p 0U00S 0pS 0F0 Ѝ0S U 0@ 0`P 0R00  Ѝ p夀夐 p0 0 ? f XR A B0A PR W `@Wp ppꙙR 00M 00Ѝ52O-M8@ 8 $000pW'q)hlll Pl lk<jX (hg0 gxg gHg dh g HgfhHhhKh,hC-P"`2 0TM@Pppt0L00E UN VW W` ! 4!,8#8  6 x00000 0 0  $(ƎPLQ P,  n0 p@ !0 0 L0 306TЍ 0 P 0U 0 P 0V 0 P 0W 0 P 0@巍@ P(ܸy Xdd ,0S94 0 0 L0 30*TЍ0 >P bAPg4{00h h0h 0@ YyL L0L 0@ Xy~"ܠdQXXQLQx j\O O4O!1 O-IM0p010mWW PPN x@ `0 `@P; 0+S+0S(u P   0  P   0S3 0 0 1 30Iߍ P zvP3a{00< <0< 0P *y<"phV0O4OP hpmvmzܼNSflp'jep`"` ek`(g|d{dL`P)a[`dk0 P%hnPbk*@`nKbk&[l[<`@'i@lKLD.fi`kjK(@nᏴa`ˌjK$n @%g a, dM`bKh &8bh  j jl͠Ꮴiˌf$n .f!e+i "  adhd  d)h hb-Ꮴg+n,n  )g p苠Tf`! `)f `Dg|Ꮴe{n"l )e PfjLdka( a)d @He]Ꮴn[n'b )n 8X叔nMl`Klˉh& h)` h0a a;f$%f!g `0)ah@ h3eib *b` +g+@bˌ`d ,0ln hf,fkg p$Dixe{`!,*e P`Xm]n[dkdKeˌa(,@dJT`KDb h nˌ (h& L, gi*i ibL 4d+ˠaˌ, f+$a "i  b*e h 8n` g (d+, g "!8p P-ef+h{fk(pa{pl{(p'i[pPP%gyd{hk" P,`&h `H`KeZfmn[lk@lˊ0n@$f @,MHiKhgdb') iah ,( g&) d$lʠ陠`ˌbb+Tli <(e` * ꩠa\f( !0<\ ag{h$gd+ " b)e+e;b[h)!f`b aakl   0d `,@i;'0#0j8h;. @nb+lcK nK " @g!$@,ɠiˌ(@a# !` gc;,-j+lˎ0# 0  j 7d P0j;`] `PtЍG-`pQ ?P10@@e T0 U?W@@P@@PW*TP(@T(pG  Gk  kPe W*0@-@ 1M?0 P @ cR c B T 0E ",  Q"$  D 80 0 0 30` Ѝ0@4ke8b aQ. 00 R. xB@-d @@4  R  *4 8/B x0 S\ R `0S Р@- d@ 4 *8/U1xB /, :#( /$&:0/--M  Ѝ Ѝ/0  0c <cA-@PMb p 0 `P!0 pp WpZ [{0,pp{ xWpN Q{0,pp{ lWpB G{0,pp{ `Wp' P ?0p  B@RQ 1 ! \'{̠0+{ S 00 00//DX@-M `P @ jppPU0D>S 0!3100 0iЍ>SH 0!3100i00i00W/-p@-MiP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( W" h"p"A-@PpP`W =UB 8X ERR14/.-,+*)('&%$#" V&2!0` 0`p00+XPp -X' =X00+0E0VpPppV-00d00+0+0`00@@p00,0, ,0 ]*g00  p@-PP@`  0RuSpWSRX0CSG5 +p à 0R Q PSPQPQ  0    T0 0+S -Sp0$ $0$ 0 bfI@H O-LM0xSp 8@0 (P(0,00040B@ 0 0h @ h@T8 `0p00000.  0a0GSW MD$00+W@ 0-SU=W000 0P @X B R h `ZS  "=W  R!   P:0$`Bh@  :h R  "@$`0ኡ  m Y" @ T:$`!h@ p h0S" @@D$`@ @T 0X0 X 0  0pW ,WupPVS P Z0$`gP $ g R" P0PE$`P P   P =W Y+0G?o20S" Z$`g P$ g0S P"2PE$` P PU 0X0 00X00P PZ$`g Pn g0Sr P"2PE$` P P 0T0 00  HR; I?I00 HR 0P01 P1 00S.p P 071 00S:0 Ѝwd0 00S@d@ Ѝt t0t  0bX{L L0L  0b0mDt0\ $ @-PP\A M@G P1p0S'@1@T0 `0`S@# 0SV+ 000S"Pd0S/ qBp  Ѝ+0@T0S !wd00h\0 0 L L0L H0 7b8Btp PG-`PHMP6 0p0 0p@ p@ HЍ -P 0 p p@ QHЍd0S @XH0H H0 >aE0P R@H O-P4M\p@Py W>X0S1 `00 S 5/000 00!S5+0 0 00!WeW0a Y_ X00Ut5Sp50 0 0 0 0@P0` (0`0t5`0$0XU 0S70`lW A,0 _]`W00V0S ,@P(05#[0xQ` 2P X $ 0 8%*&  # #.ğ BPU 3 2#0!/#1##ʂ0# 0I`V4Ѝ3+00 00!k3/0 00!dh30$0H\.Ld0a#0L0|2pST0, P `@!\`P 0V ^ ,@Px ^[`"$:600%$0D"%><!!!0C,"0TAP%"$A0O#QX00 0 0$00?S%4 P! (`1T10&1! T$?01>! R01"_0A`(0x10X00`d(0T!T1T @ 09`@t0P`d(0 T  R'@P5 Q4 0A` X0A0PE$0 `0P 0 u`*`* 0 @ 08I`{`괡 GzGQ)\(\@ XSQX؜ X O-PPM@`N TV VA LL0T:R P* Ÿ PL P R# 0Qy SQЍR P P PP[@Q @| P @0 @0T1T!TT0 _@1@!@0 _T$1$!$$0 _^ # ^ p0^p 0^ @0T^Pp# W @ 0|T@^*?[t \<T <8( !]-p@-@PP U p@*LX X0X 0 h_U8 808 40 ]_p@L  xEG-P@U T^ Pp ppq W00"5gP: Pc 0Sb 0 R 0C ` -PP0 XA V  00S0 0 Q 0  ! 0pW3*_oRe`V^P( U ! _ 0 0 ^Tt t0t p0 ^\ \0\  0G^a00Pؖ   8dA-PT!T1 0MM@P`040" U=  00S0 0@ $03/ 0 0 4 300ۍЍ!Qp夀0p$p0 ^U0 0^p p0p 0 Gy^T T0T 40$ o^32P 8CLE ܔ O-MMMp&06 0P0406T0D`$03 V< 0SE UN X  㰰f`UT0U@@ R R 60B?o2 00⃰0S U0 S0E0 0S0000ShX. 0+0L 0@ 03/0Sp 0@X5$ 0000,00G$0(@03/P   0S00#*  0.S @T00SW:0S 0S , P8 * R  P $0DQ/ 310 D1 0 (0(P00 0S  0 P'80: S#X 0S 0   000S0 P@T  00S0_4/P; 080T<# $2 MލЍKf00m0   0A x 0.Su0S` 0.So\ Ru  @q 03/0  000.SH W P D0 P7 @u  2/0!1 , 0]!1 , 0 ]V!1 0, ]0S!1 , 0\U!1 , 0\X P_0S PPP8@!@1@ <4 0\9H 0@ 03/^0SN 0HQ9^0/ 0 0@ 03/0nHH0g l1L1*<-t PL ( | XĎ (p L/O-`#p3 0KMMPؔܤP0409 UB WK YT \[ /\@ 0@ \/\0   V"2 0 4 30KލЍR_/\8VP/0p0/\Vl"l2l @ 03\UL"L2L H@ 0(\W0"020 ,@ 0\Y"2 @ 0\@Pp PBP 0   R  T 0T/S 0: S+ S 0 0 0 0 pX! +00S0 0@ (03/0S0: SV/00ā00āg R90ꨰP0 P0H [0G 0[]/00ᲰH*l) 4 m pnh Do $S|O-M$M L%L5 0PQ`000. @~\< 0   pH 0/SS;R/ 0B0 4ZS 0H*0 ;;P4S 00C PR IR*00S;R X @H p0\  0  *\2 @\ ?\" [\!PI 0^N \@000XS 0H 0< S @ 0<@Ⲑ 0 0R  R QR Რ@  +P[@PU "2 0 0 30ۍ$Ѝ0@S D0\P ]\!PLm @Ÿ]P 0 -P]^ 0]P @ 0< 010t  0BW 0R S0BW 0R S@c 0Q 0{  00P1A0 dJY0 !P[00@ E0 p 03NQ0P0H*0 ;gP 0ꐀp@p@P 0xAZt0X SP e@TLPPP 00p( (0( 0 IULs DD@-,@@Pz00O-`(@8 0M0008P00P pUpVpWT 4  Np007 [Y VU ((8 0 0 30Ѝ `s?0l0` 㰨wp X I pU[ 0 2c11000 0 0p0S' A0  $0vp PpW<000S[ vW00z@pW@Z 0= iW00p NP}ZpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #Sy R BQ #S I BQ #S H BQ #S G BQ #S. L BQ #SI M BQ #S? N BQ #S5 O BQ #S. D BQ #S E BQ #S F BQ #S 0S:U 00S! R B  *P 0 `000  00 D  PS0*Z +p0S V 00{VW 0 a[ V00@V@p, 0PU @u  @# 00 $ S #   20000"   2000000u2"0 _0TqHp00,(@ (@(00,0jD  Pk0Sk~[p+Tac/V00_ Vd  ^ U0`000`0 0SpCx X pG w00;0 U0SpY008[ v0S0 V  p!`00C0G  ppp [V MkJ4@l (@pDt4-0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFo7pP dP Ѝp<A-P`@ A@0S)A@Q0,pPpPR @? P Lp0 @BA QA3M@  6p0 .p0 ,0, ,0 < S  Ĺh ȹp@-p`pP`Pν@T T0T0 R@@½pP00᷽h<A-`P@P@p᩽0S |@@F R"@`S@P00T0@刽اL,@-m 0 0 C-`4MPI@P 0S|0V ! UpЍ 00P;  =R6 0Q*G B&R&>$#"M = -?;7RpY WꘀqꈀvKSБp0X{FH 0PppH, (0@t45O-BMM00  5 u %0p 0 0 $ 000 0000+0 ͡P 40 4tAP P@\ UP 0S l400#S \ FP 0S 4d44`0`\ 7P 0S d4`0`\ (P 0S 3 0   \ 0P 0S r30\  0P 0S r`30X3PE0 +h@@@3 0`0P\ @P 0S vEPP[[ NP200xS0xS0Se "`2 0 4 30BލЍlR@P\ Pq 0S @200#SF \ P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ w0P 0S 4rH10\ j0P 0S 'r10 ! 10P 0 $Ơ0000 0000MPHc Pb b \(LypH` p` xH` _ P@0 p@-d@@0S P Hp@P@P 4P ApT4LTlp@-@P$ P0P 4P PPMP UPph`h`PLp4 404 0 AP\ pp@-@P$ P0P 4P ܠPPeMP Pph`h`ePL۽p4 404 0 PԄ \ p@-0\PP 4P p<`<`8P@୽p@-@@P~ 00O-@Pv,M0pJ 0SR 0SL T60`P 0U 0C   6000?SN Sl *S 00 *Q @R50*QLU 00  *QA[SU \S0  0 @ @Q8 ,Ѝ?[ [2 *[  @[[. \[0S @@0S /Sx .Sxv 0X q 0X/Sn.Z] Q /Q CP  /P P,ЍQ /QT 400 000  ^[![00$0  00 @   /S \S> S -RE S0 U@ ∀Ḱ0]S^$0 S w ti - 0Xm  0X/Sge @_2U0/0 0 /ZU0@  0U ∀Ḱ^]^ \^  @S ^U@  ᲀ^% @@  $0\ @ !  [Q  @L1L!L0 {xN0S,1,!,0 |mN P0 @0`pC p 0U0   Z  0 sP/ZY  /BQ /QY 000 0 H@pU |xU P@0NP@-@ P FP 0 Q 8Q c ?o2c p@-@lP:KP X4KP T00pT 00pP 0 p輦O-Mp! 0 "  @p` P #!10230Y ߍ轼PT 0 pI  㱼P: [ ;` 0 0P P) @@ 0  p@ 0 qP0P S P N"> 0 "C 0 lp@O -Rw$O-Mp! 0 "  @9p` P ើ᜾10230Y ߍ8PT 0 pI  ,P: [ ;` 0 0P ᔽP) @@ 0  p@ 0 P0P S P &N"> 0 "C 0 p@O -RlO-Mp! 0 "  @p` P 10230Y ߍ賻PT 0 pI  㧻P: [ ;` 0 0P P) @@ 0  |p@ 0 aP0P S P M"> 0 "C 0 \p@N -RmXp@-`H@P@ ePpPpPP @M p@-`H@P@ PpPpPP L p@-`H@P@ APpPpPP L 0 00 4@-H- M0 S0 00 0 0 0 00\100M \0    R8 00 0 0 30KH Ѝ/x-H- M0 S0 00 0 0 0 00\100M \0    R 8 00 0 0 30KH Ѝ/ -- M0 0m+--M  --M  A-PPp`p Q @Q ePD@L0 0000Al$0$ $0 RKDhI $0P R   0//ḉ0'07 O-@P0 0S0 9=0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!Tl00p\@@PT $J08@@0/S(@@ @@Եfff XA-MP@<L0PB @!0C `0 00   ! 0b0C S/:-,+*/('&/$+`J0 0ጘ0S@p 0S 0SJ0"S $7# Ѝ T1r0:J00Ѝ|@ @-@P1 0S* <@T. 0T)  /Q0C T !@# *0P@/S 0 B@T@!p0 0I  TD@8@0/S @8 dchU-0DM 000p 800S DЍp@-`PN/p' P@ p V U ph UX "p` V(@TQ?o 0?oA-@c^?c%^& ^ P@5$&pc`c&0gCh5(5D0c1c  1./ "0;:(0C0 /0 @- /(0  +C0 @ 7+C 0/0E0E0C00 {+C$0 G{6+C{7 Q/0E0E0C /0P!Qo oC-@@`T?`(T) T `P6&`p`3x@y66U`1p1 000? 1?1>4!50;:(@000 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C JT@ @-Qp A JI@ @-Fp J@ @-p J@ @-pPP `@-I00p@-P@` <<Ppp@-P@ 1<Ppp@-P@`D &<Ppp@-MPP`V @T |00GЍp 0 : J&p@`$ J̴6 00 R D,@-H00 0S@B0#/"br1 0!@0lR0cR0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BPPX `0: @:PPY  8@-P@, $1M`00\7 00@|p\ 00#30#^0#02S000R0@ | l0 0 2 30ߍxpP @@ @;(@$T<O-PpC 0C,0P(   /"b!!A0,0 W0 00 000XW 0  O0 SP( 0 0 0GWv 0>P(0PW%S(Pg6 ,0 6,-,0 v>C 0CW0P(V 00 0!0W0ML6 0 0P( 0, ,0<!/A!b!b0C 0P( 0 0 B0 S:P(P-W&p 50 ,P(W 0 0 0W =0 P( W\Wp ;0 P 0 0p S 00W((Ph 0 P(]c0 ,0SP( 0$0?2c1, 11,0 02 0 0 000 0 ,, ,0 0C0P(H 00 000 3 ,, m,0 0CW0P( 00 0b c0 ,\P(Z(P000uW 0\ 0 0. 0 DP(0 q  RQ 0s# @p 0 @00v0 `` K0` 0b!/A!b!b C  B00  P PEUS ZSP @  0 0$0 2P0(0 R0Y  R0O P,Z  /#b!!"A0 `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0*0 40N0 S0(0@0pQ_"pG@I  W@ 0 40N Q@(0P 0(P0 0)\P(\ ף@0 0 \/ Ql'$I,~}}n{f$ Qĥ(PP @ ACLC  \^JS S  00#3P0z z H(/o"PzXiwTQ(P8 pp@+CP("@0pt10 B0,Pp< (' Pp!/"b!C;R, a2ba124MP P(P @ @0C2c2c2P$00( (000 @ 0 @L,0@0S} 00@y0S 0@r r0p,0 0 0P , P(01(000C.$0Y3000c^\0M0c @$`Pf @$`P  0P , qP(00(000C.$00 0/# p  0P& #,   P b((0$ 00M 00Ѝ!1 A-@P0xMP0t00S 0S>@0 S<|a`\`ap!p 0 U4P0H! `p ,` 0H410UP@@ A 0 0 t0 30&xЍ0嬀 S``  BT 0 B0l l 0000 t0 30 xЍAsAY\ @ s sr@ dr{̚@-0M@ 0P q00Ѝ@-0M@0P d00Ѝ-4M0P W04Ѝ<p@-PL!L1 00Mp`@0,004 U<   P00Q Q Q B 0 0 0 ,0 30#0Ѝp r mp h`0` `0 :?UD0D D0 ;?0t,t,t,YX pc0 lpp@-@PP U 0DPp P @pD0D D0 7?U(0( (0 8?p p p| oG-pP`' X/ Y ~3V @P0PES  R  D(0PEV R  SS0@0D@ D0D D0 HK?X(0( (0 IA?(o 0o4ol oR@- 0BAs @Q 0CR @@O-PP┡ M pU WC 6@PI 7PI  7p`M 34101S Y7 Ѝ060P@6P- 0 0P 60 0 @=00 @l0l lD0 >t6@00808 80 C>7ꈴm lmcd (m@-RQM @PЍTT @@Ѝ@ 00O-`!p1- ଁ0M Mp@P050H 1PS pK @\DX0 ^00pt00E Ok00 T> 9qύˠ@,0  (v@P 3 P 0 0 5 30ݍ Ѝh0h h0 D1>Y@00@T@00:L40$LS@ 0k$$0 M000 Ѝyp--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-@P⌒M p` X X00?5[300P @ P 400 P ! !  81XP: 3VP W^ [[XPVppPp4W` D 0`f0` `ᬬpPR P00D!D1 005 Ѝ 1XPC0 P P005 Ѝ̰̀0 0 0v=W` 0 l=`|0| |0 ?b=rbpP[ [pP `ܯ\p xhhU h@-@ ML5(0S2 20 `(0` 1/qp0Pp)  0 0 PUR <0PU25 ЍPPTp 0S  0CP51?00Pp5@-P M5(0S: m20 "p(0p 1/qp0@`/  0 0 @ToR <0@To41`V ЍP@T` 0S  0C@o>T004>004p@-PPE 4A0S5 @Tp1 Rp0P00 P 0S P0 0c0( 0P0 0 Sܭ,P ح4P ԭ8P Эp@ͭT0T T0 Mk<0Sp000 00 K_<eEd< dPd  Xdp@-P$@@#"Xp@Mp@- @@X@M<p@-,PP 5Y@pMA-@PaM`[ 1 P0p00S   0 XR0@ @ SN `@<( \80CS50`H0 S0V^,*`N^(^& N0 0Q\   "V ^ #R.S @` 0A a 0Cb@0@ЍD0D D0 F; "^ #R`ꨨ$b $b4  R  *4 8/ᐈ 0X\S 040:8 R РS /`nxB@-Pp`=P@P@0@D尀 U     X@-P`@=0 CA-`PPp@P1 T&  0 SSS7 S300 S(=wbj{#g\*N7'0 %;7'0 ;h70000F00<00 V00#R00 00;R c\&V Pd\ 1P01 0S1000S0d\ Qt6 0100 R =R R 0 0 60000   `70B=<;:987543210/.-,+"!  [|%50#\W00S00%0G?o2300&0G?o24 00=pGor%t  00 |20100?Wp00 0 00BS0100C0w-W00s ^W00n00  00B0! 0W0C0 0 X00000X0 B0 0M00J\ 0 0K 0 0@ 0 0A 0 0<003 0 04 0 0/ 0 0* 0 0% 0 0 0 0 0 000B3|?|>>[{,>==A-@R`P 0So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@&00@10 03/P(!p0 $@0V0 p00 R (Ʀ00 0P3/P" Up   R  SVp 0S§P00 0U z|z<Hz<L<4Yy;;G-@P P+`P (rp^u F 00\c<!"#b!0CaqV; Y 4pPY` $00100S p 8&`1003/P00H 0 $0,100S100S& 3/!p 000``0S 000S( 3/000(P`0003/P 0 p 0000S\%P00}00tx/>3w:hw94wwl9(9v=G-@P P*`P $rp ^t F 00\c<!#b!b0CaqV; Y 4pPY` $00100S p %`1003/P00H 0 $0,100S100S& 3/!p 000``0S 000S( 3/000(〥P`0003/P 0 p 000$0S㇦P0 $0~00uTu7t@7tt66(tSR: G-P000pS` 3/0Y @IOP T0 0 0 0 Y @IOP | TT0 0 H H0 0p`P   /5hs4s$sr<5rSR; G-P000pS` 3/00 Y @IP G T0 0 0 0  Y @IP 4 TT0 0 H H0 0p` P $  /4Lrrrq4qO-PPM M Q@ \ /\C  Py )P8p/\ @ @. D\m `P /RR.\' B Rm/0 F 0P6 PE00 PpE 0: S 9S0/\0Sy@/\` FQ .PQZ 0t/S0W0OʨP ! fuPO U)  RB  n6(/\p @` @Ꮶލ Ѝ.00Z 0/ ލ Ѝ @G7 Z 0/ ?    P @X5700 @07>00 @+7?00 @&700 @!700700p@-@P Q Pp`\P[0@P P`V 60"S *p600p@p@- PHaM`=  (4QP00弣 P; 0^0% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P إ<0 0  6 0 @mllp@-@P`P3 V( 0Pp:P @P0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 44(0( (0 +4J J= J00/-p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 3U8 808 0 3p (<I| 8xIO-M M (0Px8  p00D40f 0So 0SV t4!S S$XPP `P  㵢pP 00S `D R!' 0 00 = Pg 0対0P0s` P `@V 0 S( [T :SZ \S S S 0T:H@DP V@p+ wP P0` S[1Z@#QQ ,P`600`S@0@VD0AX0 0p&6 0 D4 30bݍ Ѝ:SZ @@DV  00 0 Smm00@ pP: ~d5@00@S0 D5000040p$0(`,= Pv 0:RL PR0t4@00 0$< E0S00S\S00 RAP 0S7\S5 00S1 :S000 0 S4Sp A 00S :S|S@0@ A@0S'!1 0 8 30Z ލ Ѝ @P 0 0 Cd1 0 Y P "@P/ & @@(QP P  @1 0   0 04 f0V( 0 04 [00࠾P j0 0pP[ @XS8}}|_t_T_0_^4<^]z\\h\ ;;X ;T;1p@-PP@ T `` P 0 0x0 0p@   T T0T P0@ 0T8 808 0@ /[Z ,9 :9A-PP@` T V = v@P dPP 0:SS  pd \S @+ Q0P 0:SS ^S0S:S 0Q0@PP@d3P 0P:SSpdQ0@@A0]p0S:S 0C^7B C@2RIFB?5/A)&"! 0@ 0 BT1 0 BR0 0 0 0~0|:0z0xPŸpPᜠ( 0n 0 0L 6/M 0 0L ,/T@t t0t p0L !/6@ @sr@o?1 00 6 )6p 6l6A-PP@`I TR V[ = PPg d@Pi 0S:SpppdR0:SS   \0@@AdXPK @pd \D@ATp FPp@6 0 0X F. 0 0X .T 0 0X .V 0 0X .pP@@@0 00 454 ('4"| 4x4#P 8L4$p@-`PP@4 U= T& # P? 00S 00XS@<,00A  RaPAU70AA AW0AR^p| |0| x0d >.d d0d `0d 4.UH H0H D0d ).p X32s <%2q 22rO-p# 3AM M0@P`0(0 0 0SH "/044 !PPN \P0D 8T  0"000CS3%10/.-x+*)(&%$#"! ˸ Ǹ ¸0:S 84Sr/0S/00\"H2 0 (0 30 K0$P* 0B.KS:S B000$ 8T S% 440<4 0 S BKJ ; d$0I4$ /04I.<4 $0C 0$CxB>K0CP 04 8 0S:S XE H R0 0  Q!000AM P04@@0. း0:S y/ 00UOPK0 0 E>-10 S:S008$ 0S:S00@< `pL21nd1DL0L /x0 00 pl-H-M0 S0 00 0 0 @0  00^100M ^0@    RL00 @ 00 0 0 30KH Ѝ/8l lk4@-HL$@@00.M-O-P"2 @`0,M0$00]d20 R\ 00@`pR 0 |LP Z p ,P p J ^" 0J0PP0 S#: -% U10 r 1$4S1$!@00 PჹP0S "<100S (!0 0 $0 306 ,Ѝ U r FpP Р fP 5SX0(, VT00#    FPP  P0S)j\ML,,L`iTD @-;(@M@@00?PЍJ  { k{ {G[F { //=A z z k [k'kFKE{{ //=A  { k{ {G[F { //=A A{ k [k'kFKE{{ //=AQ@-@0M 0 0$0(00 0#  ,0T -P0 0# 00Ѝ -0Ѝ-$M0 00 0sP$Ѝ-$M0 00 0cP$Ѝ-M0 00 0 RЍ w ~0v/C-`@!<1 0sMPPp010/ V7 @X0^00pAtA0O04{0 >PPTA P{ +0  $@7 |0 0 1 30sߍ`0` `0 G+VD0D D0 H* eH`d t ''L &$$0 M000 ЍcO-M/0? 0pPP030] Ye 00!R !Z P   V&P0%%Z * 0S0 R 4/,? 0 3 30N ߍP0 4&P P0C S !000C 0 `0zS{NP~|{oyxwvus1jhc_^\ `ZEU000P0C `0'PE 0SF0 0C0000 000S0  IY 񏐻q;P0 o%P 0P0CS0000 @ 0D ST*=0r? R(0 ( 0I, $00 40A@Qbp#zx 0 S0 00 1YK @@0 (%P @T0C0@0@  0SP 0 0 0@0 @0 0CP2 0S0 000$0!$0S0D =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SkP P000- 0@C0 H9T@!@r?(0@0 + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0r000@T@0HS XRn    ( 0# 0     !   00 0@0( 0CP000&   (   S@ @& YʱY  P6P&P0 j(Y464&40 `(Pq `P @0d{P #P  0 S0 0C0 S #P 00CS0@K 0 S0  @$ 00S b#P40SZu 00CS0400R 0Yc $ @0 0ESZ #P 00CS0@T 0Y0 G @0ES$ PSZ R0 00CS0@  0 S000( @+ D   BR @ X2 @ "P 0 0CS0@R000 0XO $+D AQ@ 0 R0 @ NT? 0TiAQ@W 0 R0 $@ XQ[AQ@   R @0 00K0? 0r?(0Y D  " 00S0P0SY 00 00C@0@00<000WS0,`01 `00(00DH@0V: O P 0C =>J( rN(0  p P p p =>3PSu $0PS0000`FS%P Z,`XA $0S0 00 0000W0pcb `   X d4p \/| 0 d"P 0 0C P0 SP 0^Z``,40'Z`Iy 0&@0,(0=>0( #C0,`-Qj ]QP @0c Q8 ,`0;00<0000000900000 000:0090 00}0:0000t09000m 0  I  0 PC P?  +P7  P2000;000;0B00>jIT  B R, @ 0Z0 @$P 0 R0k @ X<0#  R @#  R2 XX B P R @$$PL 0 SI 0iT nT  B R, @ 0Z0K @ R񏐫D" AR>  BR @ 0X0@ NR-  BR @ 0X0U $@(T  BR @ 0 R0@ )T  BR @ 0 R0 $J$0 S$@5*Y$Y$ 00(0@T 0<030( @( 0p00 500S @0SU 00 0!Z]  P 00CS0@| 0 S0  @]0SHnP 0Z 0aeP 0Z 00 p0 00> 0#RP 0X 0@^@ =. #RRd @R  B   @ 00. @0=>03SS' 0@T0C0000@000 0SP @X A 00 000 P8 0 S5 0@@Q$P* 0 S' 0@ P 0 S 0( 0  _0T0P0S0 0CS0@ 0 S00000CS0400 0 S @0 ᫖ PU ,0C =>@H0J %r 0[p= P p ᢖP 0Y0CP  00S"0,0p `%  B R, @v 0 R0n00 ( @n00 dP Z 0@006,  $ ]R Z Pp80$0 080P, 4` rO, <`T  P$0 0P(0080<$X"P 0X 0$@>PG 0XD 0@! P< 0 S9 0@8PD 0 S@$P P; 9P 0 S1$1I.P 0Y $0 @0 P 0 S$P P P 0Y 0@0X,` @ t'TT) @tZ"( S C@ S 2P 0 S 0 @000>P @-P $j  B R, @ 0 R0. , $P2jP 0 S ,[^P 0 S 0$ @ 0S@!0@3ZZ 0㼰P 0P0 0UZ  (`0$0H0` 0  PQ => 0 BC$ $ 0 rϔp< P-ZP@D@ 0S*T`Z P) 0 S& 0 @1 @D00P0T0SJ0000xp0SP Y` 0@00XeZP@D`$0$ $0  "00C A-@P`p0 P@-` MHP@p~<P  0 P{ ЍAA-@Q(R`PY v 200S5 \0P1S010n L000P`! pW@0PI ᱒PPZ 0 [#0 0 C `C00070  Q  Q*RQ0 @<08 0  B`00 0 `!oP00P0 P ; B #A ?#@ 0# B0 `A4\ p@-@P Pp0@-P$L MT` 0S pW 0 7/@P  Ѝ808 80 8!0p#@ ЍD p0 00M 0ЍX>0A-P$LMT`p 0S $X 0 8/@P Ѝ< <0< 0 pe!0$#@ Ѝԧ 00M 00Ѝp=0A-P$LMT`p 0S (X 0 8/@P Ѝ< <0< 0, y,!0(R#@ Ѝ 00M 00Ѝ<0A-P$LMT`p 0S 4X 0 8/@P Ѝ< <0< 0D  04#@ Ѝ `00M 00Ѝ;O-MD@P@Z`p] UK 0TS$Z0 0S- [* 0 ;/0S5 $\U 0S H[ 0 ;/@PЍ 0 0  0H 0 0h J 0"@Ѝ0$\d d0d 0 [w 0D D0D \ 0}l ꤤ Xt 4(  x(@- @MvЍ90@-P$L MT` 0S 8pW 0 7/@P Ѝ< <0< 0 0 08pV"@ Ѝ H0 00M 0Ѝ8@-Pp`"t@t0@l@ ?U  @0 !Ւ$ ,$X8 ;0O-M`@0 0P040 0 0p0ʿP0! B0 b8<B p  UQPE @4B 0L3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b  P 00D0S0S0 S  \000!#300@ 00@00 @0`PUb*Ѝ@\ M00  P- R@ ^^? 0 `0  ᾐP 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `000C0S\000000 0``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`i7qA- Q@Pp` ^P=0D! D?o2]R0S h0$"0 !@1= 0 V V 0 P0 A T A-P@p`P .T Tl!0D1(0D,TS0 Ae_T (0$"0@ !1% I6 O-p'7WM 0PP0T10l7倁0,01 01<0 Y?o20S] 0Se Ym y @B0P 0 b`:0P$0 Z080y 9P00 P  T2 `P00@Tp`" U T 1 # 0̏P0?0Sq P|P P6&0 @Tp` 0`FFa V@1 @! 0L0`pP  0 (000S  V L0 G0CPa  \5* 0 0  R  85' 0 0  R 00 00 00 "00@\0000 Ȕ T( `$@T$ 0 p9/P00͎$ˎ Ɏ8ǎ\$84 0 T1 30 Wߍ<0SPPpO@@@P@T@O  [*03> @948@p0 ? 0, 2@0 D0R@ "(ZPpYa* ( $00S0Dp<00 SR00<0PA$? =t ȎPp^0 S2"0 4pP1!0  0S1!0 Y@ꨑ ((0 Lᩎp a0S 0S% &P Dp00㵌P+ 8}1!0 S~p200. 0=0 0 A 000 0 z40p80q 10h 4 | `-P<  ܕ    T@- M @(@   0 @ 80 0P@ 0 30 Ѝ'((@- M,(@ @0 0 @ 80 0P@ 0 30 Ѝ,('p@-@QM`P0 0 `PЍp0@-@RMP0 0( PwЍ0-M 000 gЍ-M $XЍ-M $(IЍ@- M@ @d0 /D 80 0P@ 0 30 Ѝy,&%@- M(@ @0 0 D <0 0P@ 0 30 ЍLl%(%0@-@QMP0 50$  PЍ00@-@RMP0 0$   Ѝ0Lp@-0@Q0MP`0 0$  `Ѝp-M00  Ѝ-M ( Ѝh-M ( $yЍ$-$M 0 0ӥ$ЍO-MMn)`< R 9C P p@0 @jp IBTIp`&pT `" P 0  ST U Ӌ ܍Ѝ  R U Ƌ mPP 00@-p@-PP@ D!!!!@Ɗ0P0 @p0 0 <lT pyA-`P@PG T* $0S:0@@T(0   0U> 0S@@! 00=( p50S$ 0 0 ?$0S%*!( p0S @ @0@ <0  $` x @-PPM@`h Tq ,0PXPI00EPn0: S Sr  SЍP P :'P 0p+`PV0` \0`.S0@D`H08< 0L R:0L R68< \P@D V^0 0U V:0Ѝ]0S \040. S 0 0 :\Th h0h d0 QЍvp $p( Ѝ  PA-pP`P& V/ ,0 `1@P0\X0/  S0 0P$05%0@P \0 00X0T T0T P0$ V8 808 40$ @ꄇ X h@-`QM@ Ⴅpp.  8<0RP@D0RP P00V Ѝpp apP0@@ЍPPЍO-`P0$0$0UC L0S,00Sa 00S05*0$0< O-`P MP U0@P} PV(,P pW P UP1QP UizP`|R PPV [L p PP Pp[#   RQ w[\ 5 , L PXU0 PP[pXW WPt NP , 0 P5; W և ЍPЇU ̇ʇȇ@Pr pUP1W00 0 0< TU`{00 0 0H KE]h]p,00,0 P P pD8| | ؛p@-PP5 0S %#L R6@T@pL 0Rj@T @dTP ^\,0 W@p(*0"p@ !T T0T P0X @ `6V `{  A-PP @Tg ,0,dQ Q%( R ` L0S 5S0T@`T@L0s ,0 `L0S,0 $0S005@ BQR@ @D Q\ 5`V `܆V`05`V   <,0`̆V`P@,0  @ mP@ 50 $ 5@T 0   0S004#3 0d >lQ,0cPf00\p ,0G/P Wp `,  800 00@SS  ,0 C/P0/0 \ @'^5 ,0( P\( K PJ,0 Gp(V 505<4,00X! P* ,0<,0b@{P (5 P 050S ,0 Ɵp( 505``6 0 0d d0(@@0 $ 50 $ 5hx t|UT |u Pp@-@P T UUp 0 pH H0H 0p "Y, ,0, (0p Ot tt A-PP`C L'pi@,0 $5 SB S@T @劅T V,0`<,0L0`S00/S , @ iB00 ,pp@ V3P34 404 00| $Hs TX1p@-@PPP 0P0S 0`0z0S2p@(~(~(~(&$0$ $0 Bts $1$0A-P (M\`@ @Ppp 00 0@̾ P& 00CS'  p0 0 0 4 5;1:(Ѝ 0<080"0 0(Ѝ0r Hr 0 00M 0Ѝ@-@P Q PP 0 0 *K0<Lq 4p@-@PP U p@yP0P P0 B4U404 4C0 *p@cꐾp p p@-@PP U p@SP0P P0 BU404 4C0 p@=`p `0p @O-PMp 0GW"S00` 0t@P-TPe +T@`0> ǿ 0  0 P !ʎ @00D \a0DSW0DA0DS"70DWUX: QP S \ P"000T@ W. 0 p 0U00S 0pS 0F0 Ѝ0S U 0@ 0` 0R00  Ѝ p夀夐 p0 0 ?[f XR A B0A PR W `@Wp ppꙙm 00M 00Ѝ52@-LMp`@$0 P 00P LЍ`0 LЍC-P!1 0MM`0p0<0x! @PV l1 0S P(1 |  P( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nSP0S  @PPP(|(꼺PHtnfsxuniop@-`HPᶜp  @Pp0@徜@p`@-@P @(0( (F0 x@خ j @@-M @p 0: S  ዜp  IЍ00ЍO-p-$M$@` @300;#;SP00W00S00 e00 P@pP0 U0*0@HPP@ p 0  Hp P@PE60S` PU|0 pH W*P0    U 1 T 0 @[UrPPu W#: 1 0 00 1[ 0f0 @0P @ 0 S0S[ @X9 0@D@0@ @`$0h$Ѝ0 000 00S0g 0P  0!ṛ㡛p`z pX0X X0 u p @0 (f Pp@-P 币 @T @岁T0 0pp@-@PP U  p@ D0D D0 :?U(0( (0 ;5\e 4e xO-`P MPp# W+ 0Y 0 eV 11* @ 7/P 0 T VK:0 0S0 ЍD0D DD0 W,0, ,,0 ȿTd ̿nп,d oO-PDMP@4X Xa TU' 40000~P} X\ 40Se 00U`00E40  000 `8/ PPPZg*0d 0儐 0p`  pQ`(p0 p$ ` Vp 8/PU `Z0$ (pW*`p `P@F 8/P00[ 4 0@F 0@[@ p0 `V: @ PU0 0[: K 8/ P 04  K P%Qp`00S 408p p 00[ P ` 0<  R B  `` F\  \ #R L $`(p,P0 08/0 P  P PQ`p08/ P`V PW 0 S R U E BU   30 Y  SY1: $`(p,P0 Q0S 0Q0A 0C 00000VP  0p 40 SW DЍ04 {0` 44VR p G U 0 Z 0 pp SZ00 `R`^p0P @@ UpQ` 8/ PPp @0T  5 105`1 *pP 8/ P`T: `0 S PORW U E BU   3 SN B U U PE P30 @ Y 80 @ PBU 0 8/ 0 PP  Up0 E a) 8/ P `p PU 0  B U U E  3 LS  S* R \L0L0 C 0Q0 A 00 B \L0 00<8 0pS 0 g0`0p`VU0E`d` pD S`V0) 0  0w~ X 0  0xs  0 0 i 40St t0t p 0]   s 00lZ ܵ@Z صZ "Y T#p@-@ PU 00S  RQ Qp-|0P{ P { 0pH0H 0 R@-@(w0(@wtp@-PPM`% @T@T T0 Q 0QP ``0`P 0 RЍp0 0 i 8W |p@-M@P`0S$007000 0  P( p$ PQ# 0 00CR 0 U S R 0S$0Ѝp00`$0P0P 0 R@-@(Mw0(@Fw$tA-p`@PP0 00S (0wP   ($wz0Sv sP   m i0S `( w`0S\`Xt0@-@PMP  0! PJ 0Pp@ @Ѝ090 S5P0 0 < T DX!X1p@- @0(MT0$00: 0PS` RT= 0ST@ 0 0 $0 303(Ѝp  (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@깴S S \0P@- D  R4 x  |h0P@-X  S H@ @[0( ( @   hA-`PpPp@ U! T 0 F0PU 000\ LL0L L0 ?6 U000 00 @, |@Q XlQ 0p@-@PP  (p@7 0 0 1 Q T00@-01@UT0P 0 !0,P00@-01@UT0P 0 !0X0@-@UTQP  0 0!0h P00@-01@UT0P 0 !0000//ᬇ000/ᘇ00 0/ᄇ0P /0-@PQ@0/0P /0P /000S |0| 00 9/X0  \\ $0 /0 mNAP A- `PV'Ep@0 Ï@hC12c` P@ R0d0d 00 1`(@@T0P10 `t_ Np@-PD@@ t0S,000P p@ tp@1A-@Q`pP`FR  t R%100 UNUd!d 0p000 <0 t?UU'U9? 00A0A100 0p0Pp0 0PW  B0B10< l0l ll0 X` ft| 긅TL4K XY41A-@PppG> `1#P #QCt PFR'000  0耟 0!,@UPP@P 0&&```00A @tl00A0A100H H0H 0 1 ăXJ P\I p@-$@@ @sPsp谁p@-@P PP P @p@p0 0 A܌H A-PPp` @P# P# uP  P@3* "00@ 004 404 0 V 00@4H HQ:// BQ://@G-04!00S(03 0p00Q= AQ@P`0`P  QЀ @P  P 0R@ yTl@0@S y000  B B!G@ `ph4p@-@P P8OPpU0 =Sp=Spp 0@Pz0!@-@!0!1100 000Q000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1   p@Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPG-P@U`pV1S @P@E 8/P/@P@@@ @ģYC 1Qp0000/ @0q  0W000 @0S@00 pPT1S1 S Do 00000q@@ @@@0@@p p00qQ0 @-@"P 0 PC^0  0 R ^P 0@/0p@-P`@T0h \ H RH  "   T0"g \ ` ``R```0000000000 0#0 0#0000`0`000T ^pp@[R4 /o"!T0#00#00!01 000T p`^`  T 0V0pp@,Q  `T \ !O-p`sP% Q@0@PpWQ@Jp `X 0Paao0Oo00pG.wTaX@Z_B8 h000 D.@-,@@0@P0S@vM-`@P@_}P(p0@aaHo0Oo00ZO.TTaXPB, ,0( 0  @T@0p@-05S PoP0SZ sX@ 0CR\op@T P VP@o갲ou\oo/p@-@P $PuP u$uP up@|u0 0 6 Mp@-PP@ T $0! 0p@/L L0L 0 T, ,0, 0 5 5 \p@-@PM$ $` P0.uP P pp(S00S 3/Ѝp003/( (0( 0( Z4 4 tA-@M$P0Sp 0(`0p 0@0p$p3^Pp0(0V,00S 3/@Ѝ ,0 0(p 3/?pP A-PPM@) T2 0S Ѝ$` 0P t00 @5pP fЍ00'pL L0L H0< >T0 000 ,0< 32 2 \O-pd"yM`\2 0(010p@EdH H0H 0 X , ,0, 0 W\& T4& ,p@-PP@' T Pp cP 0S SaP p@ap\ \0\ 0( x@ @0@ 0( w0p@/l% dD% ̀<p@-@PP U  p@cL L0L 0< gU, ,0, 0< h$ L$ ؀0@-PP M@ T# .aP Ѝ0cP 0Sp00 EdP P0P 0L hT0 000 0L ]ġ# `# p@-PP@! T*  0Q  p`P bP `P `P p@`L L0L 0\ &T, ,0, 0\ " X~~" ~G-PP@9 TB  R R  `V V  0 `00 0 `V00 0`V 0| 0FS73.*& 0  0 0l IT夀p pl  0 R Rt 0  ` 00 00 0000 0 `l! }d}} S" UV J=00 v J=00Xe O<  YP 60Sx 0SG0S  0S0s S0S J= UV 0  2b"!4b4#"R #< v<0I8 0J=000 P J- 0S.J=  0S) S LJ͍0 @1 0000:00G0 ,0 0A-@ 0P`p0 { 0P Np@-MP`P@@P@T 0S  R0S =P@PЍp5PPЍpp@-@P PuX%Xp0 0 @p8I (m0. AAS0C .S .R Q P-S.S S /Q P_S /0@-S0GSC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ S 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0Sd10@- $M#B 0# A S0 0S  R lQ  hQR 0S0T000$Ѝ0 0S S0S'  R  R R R/S /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PPe 0PH@]0S0S 0S  Ѝ0$0$ $0 nꌀ h@-PPM@p` T Q Q Ѝ0SS ЍS 0 0PP8#<48#8W R R | p000S SH0 P 0   gXghfIp@-PP`@ V T! 0pPpx x0x t0 V\ \0\ X0 T@ @0@ <0 8ffp feD @eO-M_00ꀠTKta FTa @-PXX!0 $MS@  ; S- {PU& p,0< S9*` Q 0S @ T S  S0S QRpPUl d0 0 0 30$Ѝ 4 019 눕G-`QPp W$  g@P   P  P!L L0L H0H W0 000 ,0H  \_^` 0C^O-M0`C @80:0 0]pP00  03/P 0@&< 00 SS&< 00  4 S R $ c$ pWpD`(`Օ(448X#8? Y=:$00P0 P@0H ,0$0C 0\]`P00  03/P @]]`]V `t40Se ZH &< 00 Sf&< 00SD @P0J?o2X  RXJoᩒS,0SDp0pY<0C80D\8 Z^4 <0 C00P0 0P00,00,0"S= @$4 04 0 30ݍ<Ѝ]00H0Sf&< 00 Sh 0J'ZS@[ TKd:@0,`S0PG Zp DXP0$8@xpp@ 0 fZ5 {$0 0{% % {  E {000000jP + "P!0P R R 0   `R fZVJ 80LE0S. ]00Zx ZZZ4 !Z Z4D;@P!JoᩒX00 S0J?o2/20 0@00S@f\00VD (0R _80  :X!X T0n0 0 00R" 0  0P  0 ` P4{0000000040 0{0PcY 0 Ro대oXod1SglXG]00S!Tm\ HMP001\//k,Lp@-@P PP@ Bc@cTp 0  0- KJrO-`4"P02 0MD00000 0 @pP0S A@\ ST P-  LP @!x1 0 0 30UЍ0 SRB P> 0 o@P30* 00S  Pe X0 SR dP 0 I@P 0 00S @P _@@ @P XPj~DJO-S-Mp/ 0? 0020E 08 x@0嘀  0 0` W& 0S0S  ` 0 . "2 >ߍ0S0SP;0S`V>36 `h.h>h d.0 ` Q P .0 V 0S 0A\?o20 P00S0S  p [ m嘝`n0` P`  Cc 0c0P[ 0S  0?S, 0( 00기$` .0 RSS 000 Y`P <00@(0 `P`P$pY79 i2 I120Y0 0 S   S  R  R Q ^  ^ \Q/o" SR RSV 0 PsQp 4+0 0Si QRe 0S %0P,0 SP ,  B  0 `00PY ,00 X,8` RX R R ^ x0S  YYB@pTP0S} 0``,p$`(p@ S R  P  PU \8 @T( T 64 d2 D52 0S0 S P  ^%S㜐Q^-\*@`T,p5 W 000 P` 0`pVPUH S_0P$0B P0X0T0 0``P`PXP1$p`0S) 0S h` 0`@Q/o" SCR㜐  `h{PP'z0 PL RI 00SB RQ> 00  P 0 P0 R㜐  00SS㜐RpmRo \;R P @0 XP 00[0 0[*x0e/0 d5d%0Y X @ a0@S 56p$`(PX0000XP X@T0 4p0$`(P`Pp 000 JPu@T 0S S00S0000  0 `qP @`! T/ K,RSQ #3 {/0,[⫽ pyP1x00x0 ^ו`P@PP `0V 00` ^T0`^O-PLMa Zj  븱Q P@  u `P00 (PG p0p R R R0 T@0P p R ((0(  .P00 V pW Y 00  YppWV$@LЍTT T0T P0/<Z8 808 40/1   5x4h 4L4i G-XM`@:|P pP @00   0D|P 40S0- XЍ OP R]  0'|P A]8<8 .P 4PPS 0 54O-MV0: lA0hV@Hp` 70S@@:p`F ASH H0H 0 , ,0, 0  ## t|#$!$1 p@-PP0M@0 00( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 T@ @0@ 0 Տ8T< S pd" 48"\ŸG-T L2MH"0 P00  `p0 0\ @ 0 XS@@ ,B,R0C# T/ .0N ,B,R0.\'^V*00D!41 0 0 30DЍT   Aa B8 LR\P 0FS0 S S X0n(."4n4#0RP0@^*0^0 8< 4^*0 8<2RRQ- M\P ЍH!H1p@- @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0Dώ@POH  A-P!1 0rM`Pp010: UB @X0^00pAtAaP0OP0,1TA Ό 00 LTP5  0 zpP& 0@UP 0 0 1 30 rߍ0 0 <eUh0h h0 =[P V00} 0P0bNBMl| T $$0 M000 ЍM -- M0 0y ЍЍ/-4 -M, 0 0 iЍ Ѝ/L@-$M@ | |P|0p  P  @p @X@ S`V $ЍTPL XX1 @- 0M`!000Tqp P@   rqp p@ 0 0 0 30*ЍoPpW @@T PU 0SP@PT00@G00ꮍKiDK 0p@-P@0 0p0U(0PU(P,PU 0\0PP 0P 00,,rP 00pl 0@-@ 0 0 0 0 0 0 0 00@-P M @0U 00P 0 bC?o2 c0 Ѝ04 00 0p@-@P 0U0 0pp@-@PsU0PPoU(0PlU(P,PpG-P0Pm `Pf 0@00 S S0 S S tpPU 000 pZ8#<48#808 (u@P q0p00S S S@ 0A S  A]0 !@P 0S 0000/TP   SP0@~@PO-P Mp@,0(Sz: (T^  0 T0U 00SQ 0 RK@D@T0`F 00SB000 @D@DS `+ T0W  0!0J@0`H 00S#0AS00i  1b0S000 X  Q0S& Mp0@vT0pprT(0poT(p,p<@ ЍSP  (,@2(}0  Ѝ0 00@- M@P  0s P  Ѝ0 0$  0$0 P Ѝ0:p 0$0$ . Ѝ0O-PLMK E`@ @$P0 ``kPR$QpPN 0 ``^PC$PPW* @0`Q QD QR Q1 0S:00S| QbP  `00Y0 @ p R  R/ RY R 0 @T: pS 0J[0J 0 LЍ   @QA@ 0S`:   (⼐띀0 0  ,0V0p   04`0JW G   ``` @`= `@T: 0aS00\S `^ \LQ  QA@ \W ^ Q\ @ , p0  S QAR^  R  PP@T( Q  A X " X. X= p X@  P@T):<X X X 0` `pn  `  Q@` ``  \0\ \0 ]k`p`R 3ܴ t  x @-@P @R( (0( 0$ H@R   /m'QO- Mnp P`ϨPe<2P00 00@`S N  I $$DZ0 X(0,3(``-`P pZ # 3X(00, "(`` -0P p`:QK`a!`Q0#03U0S Q:PQ Y7X ЍX103!0# 0 )R@ Ѝ000X; S81`3 `#S41`F2s2`Fs1`FS`FP0h `F`04:0;`0Y S81`3 `#S41`F2s2`Fs1`FS`FP0i t`F`00809``` @-pMkp& @mp) `0v0 0 0 @Pku `00 P Ѝlky00|kt / p@-\ ,@\ \ Q :\ :ApO00pJ00A-@$MPI P0( S 42 p|:pB8@87 N8nj;p$`137<Ǡ  B-0@ NQ  Q  000<8 A90><à 0 (0 AЍ00 01 0 0 0@-S@ 3/@QO-M@Y Qs 0`  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \᧗" 00\ 3 L0 1 00p0` 0`Ff& G B$"II࢖)0F 0C)6# B B("IA!0C0C1# B B%"AA!0 Ѝ ZTr ` ~ Py 0 ps 0 J 0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧗# 0Z  Z Z 0 00  0> 0 p9 0`Z$Z7 Z3 Z5 0 p( 0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[Pp`@p`D0|0x0t0l0h0dy78 Х @-@P  @`M0 0 / 1p@- 0@P0 00D@1011.T 0@\0 S@ 9 P p0  00C1000L   00LDL2p ʚ;أ @-M@ !0$!l!L1 !1AL Pp0SMP >K0P80[ 0 U#3 0 |4 30ݍЍ_3P0 ` _E0S 40ST<0`1   65N` 9jP#2 0 |4 308ݍЍOPMp$P00!?0"(  jU]" P "\` `T X@`  j@F`DV?xT 04  S)D#$$ D(H"($H1 Y P i pI  Ii T 0 T2L p0 I00  .I*, T@F 0 `DVX@P꘡ 0   Yx 0  0 L10d``0 ppG  pGiT  0 d`0L p0 J00  .J+ Tʳx%N |iAYT,, 24P `0(`(@|P\<4*p$O-tM@@ `VPPh0P 0 p j 0 0 _`14,Sἴᾤ0   (6< 0 V 1806< 0B>PPU  0R4008 0i`1S   ;`1S0 0 0 PJ0 0  P7P P P$0 0 P0 0 P0 0 P0 0 P0 0 P`1SxYz < P p0pW  0R  0}hpW 0pW  0Rx  0jhpWf 0pWa  0R0 ,0WhpWGpWD 0 PS00 Eh`1S   10 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 001p0 001p0 001p0 xx1p0 [LL gtЍ tЍ 0 10 0  0 0  00 x0 h$H<hx(, |P(`@  @-`0 AM0M@p 0 40 0 W@PP0S D 80 0 4 30AލЍ.E.0,@- M@ pp P,@`PP 0S@ ( Ѝ00S.S 0S ЍĦp@-Px AM p00 ` $ 0 @P 78 ,0 0 4 30Aލp߁h0p@-S@` P0 @S cPV 00pV00p@-@ M`pWPU 0PU  0\W 00 Ѝ_00P0 `~W00 Ѝp@-@MP`.0S 0 @S 0S@V00ЍpO00@0 PVV00Ѝp0@- MP0@0@0@T  0U Ѝ0l00 P3U:H@@ Ѝ08800 P@# Ѝ0 x0Qp@-`M x00<@P 0PU  0VЍp_40P0 `Ѝp @@$0@- MP0@0@=@T  0U Ѝ0p00 PU:L@@ Ѝ0<00@00 0P Ѝ0 0@-@ Mu T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P0( @pT" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP H@p\l0@- MP O@P Ѝ0 0( 0P Ѝ0t0@- MPh0h@0@B>@T  0U Ѝ0O,0@0 P Ѝ0Mp@-@ML ` 0 Q0PP@0<00 00. T @D C000T H0 0 <0 30 @Ѝp@Ѝ/.0 T 3lO-PM@PP  pb`^0 Q ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'<&( 0'4 0'(0 ` p0R0`a 0 T @ P  S#3@ P 0RQ  S # 3!# 0T4 0 T @ \  S#3@ \ 0RP  S # 3 # 0T0 0N 0L0 000J 00  0;tO-Q dM0 R 8 $ Č(Ȍ , 0̌ 0 0    $  aPS ЍpC-`@P@ MPpOP @U H_P@ W @ Ѝ @P@p0 0000 [ P#T0S0Y@OoB@# h TC-`@P@ MPpx@P @U _P@ W @ Ѝ @P@p0 0000  P"0S0Y@OoB@# $THp@-@P00CS0 S  P 0` Ppb`0 0CS0S P 0 /pb0@-M@0 000 !R !PЍ0p@-&  0S0@0Q R  004S <Ppl@0QR Q    R nQ Lp@-@@P@0P`0pp 00,p@X0L D D0 p@-@`P0pp0,p@LHH0 A-@pP0`p0 ApLC-P0 M0`pqp@ HD@ <80  @Ѝ :LxC-Pp0  M0`pGp@ (0  @ Ѝ :hL0 0 /L0 0 /L 0 0 M ЍLXA-pP0 M0@P` p 0 puЍpL0 00M0ЍLxC-Pp0  M0`pp@ (0  e@ Ѝ -:LC-Px0 M0`pp@ 400  k@Ѝ :TL<@- @  $M0 ЍLH0H 0p@-@0pP p@-O9pL,,0 ( M00 0Ѝ(L R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp M@` 0T 0C0 ЍL0L 0p0<0<0 7/0 0  O-pM`@PPMWC*00V>:Y ` <1<0 p pL `0 P P-0  0P%Z p `0 P0V0`FV0S0 0 AЍl0 oP _0`00000Ѝ`xXLo \8O-M 8<0-0 00=0=> 0 >͍0,0= 000=00 0P8 L@ H $0 PJ 0S@ P =04 PH 0 M` /P000 0Hk=P0= <<0@PU *, > 000<0 ;/ 0`Hk=0PE(PxP p0D0=<;:9876543210/.-,+*)('&%$#"! >Pw R 0S .S 0S 0S00S.S-7@ 0- R' 7d 0 @w0  PI 0D$0 SbD0C\74.800400000$08w 0CSPJ(00p`@0 =Y@`p @D0  P(0S0 |P0 0`P 6000#80p6, 000.0   .00Q0 A SP0$0Z 0D: 0@H+B 0?R0S %5 0  0 30  ݍЍ5Y =00SW-l5 0@Z-X5 0@T=00P040H00,0 P@000 ;0P00$ =4000#80P =04 H 0 P5@5P5 00@D;P42 00 Pf00004 0<8 BmPZ 0H@ 0R0JZ0Sx#3 0T yn=00SO5 @0d D;3 0\P`0  P,4 0<8 BP`5P"H40<8pP`@C 0P`#P0 sP 0 P`P%=00S05d 0X00X0 0 DP200  LP=00P@CD2 A `Ps V qVp$ P@0 -P0T00 E$P00d0V0@DVt0 PX10d  0 PAp`$P0 0@P 0D0 PYX' 0 $P{=00@C00 (4Dd$, |t@zXx` @%\dPZ *t|V T T T ======|VUUU HX P h\x@0@d 0 0A`0  |P0 P00d D; 0.0  kP40d  0  \PpWD Q@P0d 0 0 0  FP 0DK0S3Yy 0 7P D{PUD  $bp`0W@G1 0ES C\=00S3P@3 `@DK z2d 0 `P  0 P P:3 @DK 4 Sd P0 p  0  Px3@DK 0d  0  Pft30d D; 3 00  PT4 0<8 Bp]PJ$0D P@C 4 P`3 P 040$0 $@ 0ZD\: T0  P($0 @C40+YZ =00SD0@d 0 09`P0  tP  0 d )0  fP$0@T 0DK*@U$` pPTDK 0d 0 0 0  HP +@0W 10"3% 00;@0==0;@020!200;@000300;@0<=0;@010 0;@=0;@0  P 0D$0SFvp@`T1 Pd0 U`'  R @ Y$ ]0d  0  Py@T0 +A0W 10"3X' 00;A0==0;A020 0;A7; +@0W 10"3' 00;@0==0;@020!200;@000 0;@(>@ C=0;@ +A0W<(1 000P(;A>A C\8;u4 0<8 B+P 0DK$0SxPp\6 `(PP 0V)  R @0 Y$ 0d   0  TP@T0- l9!?C0 S 0 =PwP`1 0)@DK1p09Y 0 $P^=00S -: 0@M4 0<8 BP 0Dk$0PCUQ?p@p@U51 W2 a0d  0  P|=00S -: 0@40<8pP`@C 0P`tPaL 0 PY 0 P`cPP 0 PH 0DK$00CS @;04 p0<8 BpEP2 0 P* lDK`<1PD[ 0d  B 0  P*1PD[ 0d  0 0  mP1P 1` 1<@0d ` DK  0  TPH=@ 0r 0 BP|=00S 00|=d 0 0  -P`V D 4 $ 1R@p`P PPPP =H0 02% ܼY@ *, D>D0PPP>P0 5/=0I 0VHD- $0S&@P0 Py@P(00>d 0 0  P f=00So0@l0 0?@@02 D w `p0 PG$0 @P? _@P0 DK P30 P, @0 DK P"0 P0P? 0D; 0 zP4 0<8 BPpP0@0@4@( 0X0 0D4=0 `P0 SP- <@B!?C0 S 0 @Pz=00SM-< 0@i=00S0SOA=00S@ PL0@d 0 0 `P0  P0 p00d D; 0 0  P 0 d 0  P0PD[S9qJ'0 $Pu-D; 0@=00Sw/ p0d D;; 0 P`0  PT40<8@C 0 P`YPF 0 P> 0 P`HP5H=00Sl=@0 0H[0 #^T` *, ; 0p0090 7/=P@D `@00H[09d 0 * 0  gP$0YD2*lylp`0p@ DPY V 0  GP `0d  @ 0  9P`F@P$ 0Y0 'Pa4 @P0<8 B@PPX0 P PDK. 0@.H. 5 Ѻ=00P@ 8,  0P070 5/'@=00S=0|'@x7 0=00Sv. 0d D47 0 0  P9T4 0<8 B[PH 0D[$0S&C100 Sڨ0 P2=@0 0H[0 "bT` *, 7D0p00060 7/ 0P-@DH[P D[@=@0 0H[0 "<T` *, x60xp0050 7/ 0P-@DH[P D[@h0 IP-D5 0@w(P$0 PU 0D[:r-5 0@g-4 0@a-4 0@[=0$@4 0Z-4 0@M-4 0@G-4 0@A|4d 0 ` 0  PU ` LEx |,Ģ`0xlԡ|\d,l4ȞtdXXđllL8@؜ؐ؜L2 E,a 0`pD{ 0PPL1d 0P > 0 P zP 0 P 0 jP, 0 P `D]P=0H{` PPV *, 1,000@20 9/ p=H{ `Fp``00 `hP0 +P+ 0 D PP=H{` 0PPV *, 2000,30 9/ p=H{ `Fp``00 `)P0 P+0 D PPt=H{` 0PPjV *, 300040 9/=`F` `pP0H{ 0 PPJl0 PBX+@DK 0 @P5=HkP 0J@P+U *, 40p0050 7/ p=`PEPHkP`400 vP 0 PPt0 fP0 ]P=P0 0H0 w !U@_*5,  0P060 5/Q0 7P=00D&@CH6 0i-X6 0@\=00t&@Cx6 0Z0 PvpP @ `PVVB vpP@Ӷ 0 P0T0 0 EP00d0V0@DV#L0 Pul0 Pmwp;@$0@X 0D:7'0 $0'@C7 0$0'@C7 0-7 0@700 P= xp@-,8 0@ @xpP@i 0 P$0T0 0 EP00d0V0@DVڸ0 wP 0 nPxp=00)@C 9 0=0 )@$9 0$0@C890@ 0 MP\ypCd9d)0 k$0x)@C|9 0y=0)@9 0q+I W0W! ##9 0  +I W-- +I WW" !"  +I WW  #  +I W,- +I WW! "  +I W 00;I 0PPUD{ p@- R MA L  ,@@0(@;@ Ĝ0` ЍIM- (040 1 2Ѝ/DjA-PS`1p@@W0 V:0 $"448#80@PU (PP(00TPD0?T0S,0, ,0 lVPP꬛H0 G-0pW :0P 4#$4 W0: 04#$$0W : `  SSSČ,$ $  0W*P(00@0S X T0 $( ,0 }P @QA-Mp$0PS@` 0(010$,0v(`V}0Sy(0S! 0, $P(0, V3100'Pi,0 \, d0U4#4 00,004#40,(0T0PT(0 S0P$0Q0 ( ,0Ѝ0F P6,  (`, Q/:048㩽, , " U! ܍A-p`@LWP, T @00V 0Px0PV0*G.`^` P0070 200p0 S037#0W0 ^00( (0(  0ga / o////ᐺ@-DM` @ 0p0 < 2 *0 RP* 0 0C 0< 00 0 <0 30DЍ,f T O- MDr 0<婒'`r$B( 0 rgqC0ሀB"RP C@$A i!dP @@C3B*TJXRW/Y  @0 SP7[0S  `  0T0000000S @B0?R0S2  Ѝ @0 MiP Y 0 W ^P@ 0 DTPX @ 0 HHPWY @0@ @0 eゼ Ѝ艈%I$: @ A-`pPz0S-@ ᕽT 0D0@D0C .R T  S\RT  S0C\R@D @0. 0 @@h( 0 0p@- M0P @0 80P k`d PGo4 (0 0 8 30ލp"e p 0-@- M0@R0  IPP * Ѝ@Ѝ/ + Ѝ@Ѝ/ ePRp@- `@$P~PSP0 ?p@3HA00pPRp@- `@P\P1P0 ?p@Hڽ00pp@-@Q `P<PP0 ?p@G꺽00pp@-P@GP  p@ p@p@-@P 0PS <0S P 00p莽00pQP@- 0R R  {00p@-PP Q@ @Q Q QT0 D32c00pP T0DS@pP p@-PP @P  T 40,D0S 200p T@pp@-@PTp (0":k0cSp: A pO-0 -lM`80@pX,P40S @P0 0040-P-+*)('&%$ 000P00o 00@ S@ 1\00C10\0@C 4 00@ SY EP"0 A 4`4+Q -Q0$00$040PA UP4` 0Q440Q 1PAUPR>000ZiQ IQ NQ<4@pP 400(S x  201 0ZnQ q W `lЍ 00XS 40P P00] W4000S @ lЍ z\ 0gkR0E Rk0 PJRg{[{{0S, 0xS0%bP) 0BS@Qf S0 0 {k{'{i@00 01oP 0 S? B P 0,pv@?A |4 @ N0?L\ @, $ Xp pQ0QKpGHSE[S0SsWiXqPPM 8/rPH 0 p 0r 0Sc P o J @T D 10jS*k&0B: @IW  L1D R@0s {{7{8(p&p$p "po`P   ! c TLrP8 pPP LTQ00pC0 A0,pAR Q6`v $  z 0BS@Q S0 0T(3 @d [k{{DB' T'{`8j`k{'@P{V@ D$ k@aT T74T@Ka@@@7Dj@{@{ 0Q $0@0"00 P@ P 0SAPK \4  0PA U U440PA U(00040Pj 000Q P 4 0Q `1 AR`400A 00100s_0{S4 0PB1G{kW400 >0PA400A SGQP40PE00A SIYXU:$0SPel4@nP pPP 8oP( 8o([88 pP8,p 0S55  Y$\ 8oon n nQwp`P,p`o`PP  m RWD ۟4ğ [ 0T0j[0S {۴ {:S03:Wg۸M{M{ Qk6 C A@{{ {*30 ST{@0$&0{0G={۴}Z8,pnnn n nßL! $ 긻O{@{7{d۟WD M{M{ Qkf{G > 0W:0:G{G6 @0$01xŸ0 0T@T0 0480` < j0@ SW PP@0S46Skm{ r۟]s{M ^o۟MM{^MQzQ!#{`@k`@{'QV{D儁5AD{TdAk{' Q{XFDQ@5́Di A5&B@D '{0 { *0S{~0*R:s 0 $0 0~ 0Co0 0UP0{S0 0G{1W 400 '\?A5??? ||N P ` {۴J{۴SR 0,p8$ P `8 LPR 5l8m< 0@\0kS30 bA!Fk{1W 40{'05&D [  0A$R 0R@R$ 0 0P 0 0RA@40@0C40Nl P40040h,pPK 0Co0 0 0S,p0S 0SA [8Am?m=m ;m 9mT  1V{ *0S 8PT  hPX0T 46$ (@D0[ $ ,pw Q R@0 @'{{7{[@0#S[D 46SV00jS  T R*k&0B:@{8{{5?55?P9q @00,pD 46S400kS0S0S{ =nPY xnPrD0 T8 D kRB7R$lll l ljoT D 10jSQ@Q R# L @{@{7@{8 0$@@R @04T@.p! R  d*'6B#::D00@0!W,p0 8$W mP nP"ݯ S |08D@0\jQ pH S80 8$3!knP?0 00M 0ЍV, SA-@PU `?0Sp @ J^P 0S U@Dp@-P@}PyP0 S :pSSp 0R:pp808 80 e˴$0$ $0 fôk kk kA-P`H@ET,AP: =P- pPW 0P P B $$P W 0 P d d0d 0 C~L L0L 0 Eu4 404 0 Dl jj ktj` jPj00 v@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-0r0-w-x000$ 00000S wS -S rS  0S /xS /  @-P@20 0 0 P P//0S/ S S/0S/0S/@-@ᶧ0@0T S R RT/ ?/PP/ ?PQ/?SQ $0$ $0 p@-O/f f ??SS $0$ $0 p@-;/Hf `fP P P`/AQ/Q/Q Q/?0 H0H H0 p@-Q/?S0?/0?/e, eQP00 / /@-U 0  p@-&"P 0P(0@`D P [=0Sp70@c$2@`pp@-@PM` P0ES  aЍp  PZ0S   0 0 ZزHd Hdp@-@PpP Q 0S P $0PS$p@$A-@Pp X P@PEX `@P`( (0( 0 ` TcTcO- M` V" p@IV P @P0SV F!`F0 `1 Ѝ Ѝ #` \  t 010/C. *      RA-P(M`p |@ 0 @0@0 P0 0PC] P@ 0 (Ѝ h  X00 5CS  A/0cS#:'3R31 3:0CS!2# 0p@-PP@ T Pp S 0\\0 0NpD0D D0 LѱT(0( (0 MDZ@9 P`L9l (`O-PM`pw 0FV"S00 0] PD@P-UO +UP0+ Xp߮"<,@P00E Qa0ESW0EA0ES70EVT\SQ @0U; V+ @q ` 0T00S0 Sl 0J0 ЍS T 0P 0{ 0R00   Ѝr `0 0 ?9~00XS 0A0C0A PSVr `Pr `ꙙ\!< d!00M 00ЍRt| OO-PMp 0GW"S`@ᘬP-TP0{ +T S 0T W  p Su?0 0ͬ 0  Ƭ p P P8Q PS \/ !Ȏ\ @00D ^a0DSW0DA0DS)70D S&| Y[Q PS \ !Ȏ 꾲"00귲"00 0S \0F0 ЍS@ `! ?0 0[0b 0 0ꐲ 0R00  ЍS@`a k0T0_ XR" A B0A PR W p R ppNP0P P0 ?4) `@p >W8pp8H8 Z00M 00Ѝ x  r  Q0?0S @-$Y-- Mu ЍЍ/G-PP`O VW 00PE! R !U5  ὥG 0SP PU pWU@@jPp X2 00ۧ 0 @CpG 0p00ͧ ߱0 @0 0§T0T T0 B㣯V808 80 C㙯ᪧ* X WA-P`ᓱL@L@0 @@p =U  Q A0v (p@-@Pw00CS0 S  P 0` Pnp$>`@-@P U 0`00@T0 0 67T\ V- M? Ѝ 0 0@-PP0 M@000 T$  P D 0 0 0 9| t0 0 0 30 Ѝ0T0T TT0 T<0< <<0 Xt 8t h/h UML/@ UNA-pP@`& V/ 0S 0S0P00 00S0 00000 R` F`Q000L L0L 0 6㭮V, ,0, (0 ࢮD T|T TLTbO-p#P3 0OM⌳0410@P`1 dh`0 V V 00婰/00 Z.` QP 30 00 [ !!.PQP\.Q Q :0 + 0PH [ 00:[.[<##=[0Q.S7 Y_0IS00X0 0IZ 00 0O / 0 P00J ` `0 0C S:: 90  ` :[ 000(0,$P0$$1!0  `@$d P00 0 0 41 30)Oߍ Z[0000<4 XP@Sx x0x t( 0཭5 T.R  :ᑡP uVdr @r b Q|<o o PBO-PPM@p 0W0p W0 @ߍ0( 0P 3000 00 ` @ pP 0 p0 0 "} P? R R R#[ 0 R@ 0PUI:PE0S [PE h @po p[PEW R 0 0 Y00 R R0 S S `ගPP   JoPp OP !Tj*0p@ZU q p0PP`p R R Rp RZ T3*pၜpP  R` pp  R  PEX( Hq  PE  W  ˠ  U *(4@D `P@% 0 @ 0ਬ  00(@D Pc @`0P`- `V`TP$N@"0 t7dL^@-@l!l1 0LM`P0D00G Lp0PS- @.0 P( U( qp0 0k 0 <P  0  0 0 D0 30LЍ\<Ptpp  @ T@ @0@ <0L '9Uj ,{Kz@i K, J`JA-PPM@7 q`p@T) X pp00  09<P S 0  Ѝpp I@CT Ѝ;P @, ,0, (0\ ԫy54 II O-M M * 0: 0z0D50t50`P5ppxU@$0 0S 0 R0 R R 0$ 0d*X: 0 D5 30ݍ Ѝ8:0(0(0P,0 0@ T S#XP ,|50 0pP0 (03/P  T: 0CoTSQt nP0XPHP(t, t0xᤐX'x 00 T|<0 0L0`= `@ D8040PXP0C 0UP0 (03/P Y `ZV `W VpG:,000@0,0<Q  0d0D P0ST Q  RM h <p `B PZO[P0 0 00Pi ! RȠ LȠQo \ V\pp0XP 70(03W <0S B@Gq 0P!^P" SPSP@Qp`0S 0 0X@@ @PC0@P0CSX@ :@p` @D0 C0 0CSX: 岫04 R  R Q9 0B'RS] tP  `H 0`%oJ 0 SRe\5080 z`PC0  `Z8WX00 S58  -X P(0550P R R < R00P20P `VX *P D Q* A<0X`0<0D $ 4  0l  0SO#3 l 0E 0S{ S 0H0300  `P0 9 `ZL @0,1Q:*,PޝP PXPם0 CR00 SY@0,008|PiHp0XP CR00@S&@PX@(03/P X,0@(C 0L00P , @00,0,뵫0   0x%d  0塪0!40 >8!r;S,R0 PXK Z4P 0 z`PC0 / 0Z0<0S0,P@0,0N`VD`,'H 0x%A@0,00!L @0,1Q *,@0P,0sP ,0@(`C 0L00P  , @0#R@0,0}$g f f  - ,At +A ` A-@PMPD 0 S`05 S Ѝ0p 0PP> %P9 80 0PP   00P"U 00S S 0p 8 808 40 ੨ 0 4 <h<G-@"2 0BMPP040 0 000S. SA~ ` @ p0v #0G5P @T *X\\" $P2P 0 8" 2 0 4 30Bލ 0    ! m5O@PR pPM 8 0 0@圶PJp 000 0000 0 0d`VA 0 @ @IP* I00S 0  0@T0   0 0] 0  0 0 fQ 0 KD 0 = 00S Sz x3PxZ h<<Y |;x $:9G-M0`p @P0P0 V 0   0 pPЍ 0 PP 0   0 p<8A-M`pPө@P ,  ( 0  P0@שЍ, 00ЍA-@P M@`PpQ UV'0S9 0S0S9 P`8818<  ! PP0 0pP 00 ЍU U, k/ 0 0 Ѝ0S ` 0 00S000s S 04 @P`8 808 4 00H 7T " H6O-DM @$0<4 @Ph00<00 (0P tPp`I0 `PP {P ,0  0P0ß RR RR 0 Q Q 0 R R < $0U$0@P s p`  0S S S@ 1Y g*@<@P 000S 0 R0 ?0I@B Z 0 6 @DQ  1 峧  @D T!:  @Dpࢧ0 Sr CF P`0  ᔧ@D q [p?`gPT* P`} 0  0h!T1 0 <0 30IDЍ(I P ` BP@r P2 0 0 0{0 J` P`0 0pn  0 b 0000+00 ` O`P$T  <   ᴊP @Qa ᩊP @Q` ដP @`VT* P ``V{ R\Vt .V DA y XwP Q.Pp  P@] t Pk  0J`S`P0xSM3000 D P XZ0``/Qi ]QPP 00S1   0 ]R(S  0" P XZnP   R0 F b" R` V` `A ` @R^ .RP @e@ P  0D0C   X0W(00$ЍQ00P  L`  V 0S000PZ X \0Q PS0 T 4*@DT[@ XZ(@ X000…  Q  T 4*@DT[@Z X `  0G-TAQ@L*0pS% RC @R`P000 0X:  000ܠ   \ 0 S00@NT00W0Sx x0x t0G/―AS 0SPQP!00P0X@(00 @ $O-`VP3P# M0 VP3U0p\ @W @RH R R4 p(00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[Q[ 0 0K/  Y*@T*0P20 A\ Rɑ!" 40S 4 00؃ p- M| ЍO-S4M@ p00Sh 0S 0S0^P @^Z \S 0( X S B `$ ,PU P0S @Sf   [@͕U `PU00 S 0W*0 B>^A Z`P 00  K Z0T?\P0` RP SAS"`!0PU`0\0VP`႖(00X0S $0 Q*0F S(0S 0 `(  0AU0S ! "  [)@_Z0 p w(  ABQ APAU QpF  p   0B>SE0A S0A`P0S 00/(00@4Ѝ R p0S  P\`B0[,? 0,$ @C /Q R!1 0R/Փp000  0R5 P`00j,@J0? Q0S 0 |0R/Ⱃ sX \Q\ @ @0@ <-0D~ xJL~ Dj} p@-P0 0M0 10 `00p !@vp < 40 0 1 30ލp@{<<  A- `0 0M P0 10@0 (q]p 0 pi0 (0 0 1 30ލR< 0 Q:/R/0S/S:00/@-\@3#* 0^ @R R R E(000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R00C(00/C/G-`@pTY( V W TdP@TY 0P?S  ڔ00Ք(00 QSp@-`P@ 5P`VP@  0R p/pA-APUQ?UU@A`pP W ځ1AP蒔(00荔00ꉔ?00Q A@-?SSRB 0@S An00i(00/-- M/ ЍЍ/@-M@ p TЍR/0-S0 \ S ^000O-P M@P 0DT"S ` ውP-Y` +Y Q0Yb T@ @Q R;`paYPH;`pYP" [-SQ& K0I P0aIQW0IAIQ70IS| V[SQ;+ ʓœ0S \0J0 Ѝ`Q0YXP$ A@0L ^P @ꞓ 0R00   ЍQ{ ,0, ,0 ?\^T@@rLv 00M 00ЍHX EA-`,!(1 0rMPPp010, V4 @X0^00pAtA0O00 TAΌ`p0`L PP %0 @t0 0 1 30rߍX0X X0 FV<0< <0 G: l u $t $$0 M000 Ѝ  -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/\ O-@SM _ YXe 0S000p!R !3  倆PP E`#3`9P*Q30A 0#1#2#4#8   P;   ೑0 A 0U0 pQKP 0@pQ 0S  Ѝ葒T 0 @00Ѝ808 80 @W 0 0ԠTr A-@P`pO0 xPP$0$ 0 M Ѝ TLJ0 0p@-00St@@@pdPddP@P@P 0000 0 tJIФ p@-P@& p@A-Pp`t@t@l0@ U  1<0   A th,@-@P0S  3/000S@  A-P p@` F  x000 @P p@-@PЌPpp@!1@- BMM0P@040PPPPP8|10PV l!`D0S \!p0 P P8A0@ P< 10 B!0 0 4 300BލЍទP PP  5/P Q Q 0 0p0 00P 0 0 { PV088 (G0d \ O-MqQpP A@pf a@0` RD 00]I=1PI 0SP p Z [ @@P 50[0pP +0PU :Y "`P`PS@P TP 0@U:W  @0@00<PIQ|00p@@pЍPjЍ<00 y~ ( EDTD(D\ 8 0@-@P$MP U" 0 P' 00 0 P $Ѝ0`0` ``0 ZUH0H HH0 PTC|hj ~Ĭ@j dG-@PS  RL `10\0SA HaHHq`pP #)/0PS-00兑 000S 0 000 00 0 00 y0 00 hqG +P00H H0H D0 ꠥ(TtdXh A-pP8 0S@P$0 @S 0`PP0S PU @@P 0U00 v\@ 0@ P 0 000 ,0 ⌍@@d > = |= c c hahc b ;̘ C-@"`<2 8Ÿ0M000P/"b1?2cQ 11QAQ@PϠl R QE00å?8@0F. "x@V,h @P^Q  -R 0hDl -R P0R 0R R0q O-`H#D3M 0@P020 0S0 0Ŝ 0 000 00S   勄  0020230ߍ0 0 0 P 0SV  R00Qy]Pp". rLBU q"."\RF. "V,h  -X 0X0X R ^N GPp `VE 0 Fl RpprF|l R0 ?o2hh 0000 B00 0 30S  0 0x00 0  0Sh0h  B00C0 0?o2 0X 0pVT00 Wރ00* | O-@SM@ 8 ˄ h R2@J`P0RRP=[0”` T4\#O 0CXdPReReCHDSL0P000$0m}p4nϠNl@ l lGLˌS(##H#802c2c3L 0? P}D@>?7c ƒ c l N0?C?d` `aG`0da2@B#&>b`. c 0"}4#+:60 0($0(>! 0#‚+a!!!0C0"[oÏ(" ?00 #2>[?G'PE@@GPD2#"P*"Pr D20,W#10 ?015: 2 0 #"".2Q 1 30 #1`0T!2? B4sppp0/SX0 p c 0|!+:60 0($0(>! 0+Qd!_P!!!0C0D![Ï(" ?00 #2>PVXi`v c 0| &: 600*$0 *>!!!0C0V&) !"2 >n:E.€Qk9_u"mn5 Sc$IųQ\(\ףp= ף80 / Q)\(\/ sc 0 G|8 +:60 0($0T (>+Q!!!0Cl 0[_("Y0%R^PP0 0 cQ@ R0!V BqgqgXpC)1? c 00 |0,!):60 0($0!(>X! 0‚!!!0C0t!YÏ1(" ?00 #2>r?D0C00!/A!b!b  S2 B ("502c2c2A" "b1C @S/  0P08P2X!:#0R ό! UZ: 0"#2>"Q0030#0000T @D 0 S0@ 0 0 @$0ЍDv)1?c 0 0x{0x#):60 0($0#(>!!!0C Y38#,"0.s<0P0@<00000@<0P0@ꃁT 0 0@- MlP0P0@P T0S VSp@0GSHe`P [ 0S0ƒ! ⃑10hh "0_|0Z WX!   \!! !Z <Z8 `R R >R@7S*S0S -S0 C Rp@0GH9VL lh@hƃlp崠x| ဦ崠 ||Ѝ*ZZ -Z0 J R@ KR  R,R;R \HLLv ;R,Ru RgH\,-  Q 02F0fΌy 0HS|0Ű1s`,p0 {02t )\(\ ף{ P3 p@-@@0S p@PP @P x0 lr0@ TH0 0 8 >z@lJ LJ [02X `A-PQ@ 0ST)V 00 01ph6l6hp6 0y`{pP9 0 0`VUV ` V|FPWV hgl0PPT`0:S P VDPVLg@P`_plPpVez` 02A-`PQP pO 9lP@@WduPqpQUP P>TB |QJ l1l!0 t0`000V0 m``P vK=E0C0C P S\P0e/PE2  :PE0P0U0S0  1 @W@ࣷ@T,lPPX XX p 0 000#D G Dpt[ lF @-\F  > XvC-@P `h0 Rd0SZh0rP P0SŽZ0\";h0p  W\ Z^ VRpW͌ ” W R0hpP 0 W0\ 2Z0 RV R   ͌ 2W?=02P?=0p@-Pp@vd00 0S T00P  0tP@0dpk; <(; sp@-@P`P` U 0 D0Pp000\ LpL0L L0 AtU000 00 Bt @LE LsTEd $sD0@-00@S $000S 3/j4p@-TP@Tp 0 3/P w @Tpp0A-0`pP@P UP }w, 0p `@xG-P p@+ T?o20SZ +`v% :/@DP p@@TP`P0`P0 GWtZh0 0HOtP0P P0 FFt808 80 H=tt pqqqq$ qDq pA-PP`@! ppT (P `L2 @0L€00#S €^"R808 80 t lp  tpp@-@R`P  p@ 0  0 s $pop@-@RP`  p@ 0  0 sP ooO-`Q MP倱xP2 LB0/p P2T- P R; S P@T" V0S !Q L/`3/L2 S1P2S?T030# T03S 0 p0p@T@@P20CP2PP2SW pW ЍS @  L3/L2 S @|  &A-p0Q0P0X!ST1 0M@P0101W9 T@``0 80xa|a8O9T8@D@@@΀TA `pP1`LPP0@ 0 0 1 30ލp0p p0 P sWT0T T0 Qs*uT 0 L  lllq 0kЍs0000@Ѝ~ 0@gP gp@-@P fiP%SPjip0 0 ;Kq$pfp@-P`@Ke R T0U:T0T:p@]rHp@-@QPJ 00!R ! 00! 0S P A0Q0R0S`' 0S 00C000P0S 0 U00SpfP#0fP `fP  \0\ \ W0p  A808 80 <ps 00ed"dA- R` P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ ^110L00 0A pW \00W00S PA0ASP0@# 80p@#1! L0  A 0AGC-@p0T@1W MP` r Rr0S D!2q00@ Ѝ00qr 9jr0S   fqar0 @\r@O-4Mp@ P q 0` 00SgSe %S0 0BZSZXWUTSQPM'J?>=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK0 V & a0 Q S  T 4ЍPP؀PP؀010 00C0B Q$ROLbP00 x8 0S0V `1!(  x 0SM0V `1!  x 0S60V `1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p 0V `1! xO 0S 0V `1!xX 0S0V `1!0 *RS 0B Q@ 00B S@@@ x: 0S0V `1! x  0S0V `1!    x 0S  pD 0V `1!ex) 0S0V `1!X V  x 0S]0V `1!G +  x 0S p (  x 0S px. 0S0V `1!x0 0S0V `1! x 0S0V `1!xs 0S px 0S p 0V `1! py p p xp& qp jp cp"s R 0V0py V@ `1 | x 0S0V `1! | xr 0S 0pT 0V `1!u ; x 0S90V `1!f ; x] 0S  p/ T- * p# p$ p7 p#l x 0S0V `1!(P x 0S p[ x 0S0V `1!  xn 0S p 0V `1!$R 0@C p7 x 0S p 0V `1!x 0S0V `1!x 0S ppx& 0S dp@ x  0S Vpz 0V `1!  x 0S Ape 0V `1! PZ X PU S PP N $pG PD B P? = P: 8 0B Q@ 0 B  0B Q$Rm x R 00p @0V `1!C P p P p pJ p P  P  P  P z P u P p P k P f P a P \0s 0 S p 0V `1@! P A$Rt@00 P 6 P 1 P , P ' P "~ P{ y Pv t Pq o Pl j Pg e Pb ` P] [ PX Vx 0S 'pK 0V `1!l P@ > P; 9 P6 4 P1 / P, *O-nM M@ @/0P0? LH@0060 @0S~ 0L00!R !0k00`00  0S   R @0 Ԡx00000( d0 X00 E?|@ 儠D \0@T `%T @TPFU0pJ0P0S00PP pT 0Pj010$0 0EZS-+*('&$# #   q3>+;wQr,-kCw;<P`P    R\00sX @0S P^?P1RRZPOP>TQ.CkkJ8Q<,LDd. 0`G 0(4@ L@P@`P@@0@ 0@00v00E@`PA@00E S$U $@DVQ U4 $T;( x0,  | S ! 0R q0- j  R @TP@@d 0R00S j^?@40,0(040`ğdP@T`P`8`4`UP `^000P  V^000PK 00S 0Q0x0@0S0000XX C)9 0 6 30 nލ ЍUa xQ^_j `@TP841$ S0 R0 0S<000,00 BRyQ 0Qj0Q \ Q00 0, R @DT L& 0 RP`0   $ BYS<00@0T 0E0Sx ]t0400S@@x0S ( 1 0(040Sp0t 0l0 h7t R1t0P` p 0R0 BR0SD  00S 0P00 l0S-0j0t080s@ PP `gL 0pa 0 0P(@000H0( x , : R 10 ( 0x  ,0 : R 1P0    RQ, J 0Pk0X0\4 Rt R0 D8 @KT``Vڈ 0 R`0 8@V@DTy8 PX R   ` R ^/ 0  x06 K[[ ڈ 0 RP0 p[ pGWWdU `PP@pGW 0RP0 S0$ B[c[5%   pK[ 0R0 SZK[ 0h& 0 \  05S0r 0/Tڴp @DT 0R0 S@DT 0$'0 P @ 0S0 Y000P 0Y000P Y000P  R %x`P^yD00Q@P0 S Y000PX 0DpLWd0PF08 R̸p  K[ 0Q0SK[ 0 P0^ 08jTbY000P S0 VY000P 0KS0 HY000P 0N40jd0U 0TT0SY 2Y@@P00 $ 0 BY MYڈZ `P@IY 0RP0 SIY0* 0 P0 $S<00#X000P P X000PD0 0CP0 40X000Pu ~ 0 R +0       ` 0 R   0]t@Tl D  0 @P0P0Sn X@@P@d F?00 00 RH0(0 H00S  0j0,0(S R@D``0`@`-0  Pp0 S ZX000P& U -=   0c000NSi `Ujm]P0@@ `0T@P@8@.> 0cv4.4>4 8 0ciWT^ `PP@pGW 0\P0SpGW0 0Pp0  RW000P 7@ 3 R6 (0P3  P 00N0@0 H RH0(0 H0F00@0  RH0(0 H04T@PQTo`8kPT`4,TXPڈT4 @DIH0Q 0G, pBWpW ڈ0Q0FWA[[ڄpK[ 0R`0 SK[ 08 0^0MW000P S0 AW000P 0S40 VSj 0Tڰmp``@DT{ 0R`0 S 0W000P V0P x180 S cB+0S-0C R1ں̟N2cR10B00P 0`0 0NEQ @u*`NF_0 c0S0 )H000 H0(00(0 SH ( 01H S-0`j0͵0SD R (0P  0RH0(0H0 +0 P @ 0S0 V000P7 0001Ɵ0P@T0P040+;  0  bp00CD0S0` 00 |k0(00(Xwo ^4p2,0(0P`F v0 , RH0(0 H0 ?? _ n  j S ( m0   RH0(0 H0 ?? CS0y 0Y   SC (! 0}S( H0! H0? s  R (P'+$Y(@PX0SN 8  B0S0S S0`8 XPT@Ɵ0P4@z`U;ʘXPjXPS0P 0!k S| ( Y S '^wo4X<8P`"# . ARK $\ ,\0WPFF \ R000\00Si0 08XTP, U P!d d0d 0l 3_p00CD0VH0HSH0(H000( D 8@BOjS 0P .>P `3`L 0pP7  0@00p!p1p 8 0^J!1 D 0^-Rl (P10TYd F? 00 R: (:R? ()SUt@ 0bPH0H4 H0PH0 #V` 0  00|@x x0qpY` 0  0"2 0^p @B0?V0D@0|@x x0Rp x0SqH0 $ H0nJ@R S(H0H000( 4R 0Pet@ H@P H@?H0PH00T0P00 Lx0S P(@2P00E S5@A@00A S$Qx0S- 10P 0@00*P` 0  07  S(H0H000( S(H01 0(( H0@0|@x x0p[ x0SH0  H0 Ȑ@-` MHP@pU<P  0 kPU Ѝ/ A-@P`pU0 VPUO-p-@0`ᐊ/ Php` T  O{(0:ʱ [ 44 ?aCoc?`(?yPD?@<+ '0  DЍO R   R8C6h0P0U TZ T0 0 DH@J$Q 0S  B0P0@ 0P$0; :$0`0P$02 U ,0W   `R`0@0 0 Rul1 01{HK""0 1 0k0KR k0{' [[( R {[OJ:[k{{+S 5A; 0+C 0S31Kd +{0k{*0  G{5Ck6kʫ+K P'{'k&[;*0  C{7{JG[2[Z SPS0:k{k+S 5A{+CG{5{0Fk{J0H[0 2 0 c01k""k(F[k 10{0[% PF[[ P 0@XCZG(0S[ 0SSp$@ `Pd  0PP0S0S. XYV Y `PK $ PH0W'  W9RpG   t$5`P3`P-$ 0P$0&?@?$@@ TU 0p C 0, 040$@p 0P@P 0Sh(0  PQP 40S(0YXQQ0 R Y Y S@ P`P $P9U@ 1PP$Z 0SZ  pPp0U 00 G08[ $$`PP01 00 0 0 0$0S0P$0 ,0W  aP$0 ! `Q;${0KC[0k*0 F{7@{ k[3{Ck6{4J<0 0R?0S0u0 00\ {'{0; Q {'kkKE{{{7N*N BB*N@{*0   P0y< `  s0R 00P 0mXw,0[P   k`P 0Z  b0P0 [P0P00W0SpG .@PP   ! 4ZgP P0CSg  s9R  0   00P0 070b@(u$PO 00C  0`P 0S40SD G0 4?0000Q[ 4Q0K: 0[%0Ck{00[{ +S 5@X0SY 9UP p9 0 :$@?@0P$000  1 0Q Y7 Y {7{E{.+ P0x PS EX10S 000* Q%ں0S$&R !**R UP0 P 0wPt$(0SkPpl0S0r 01 0 00 M0IDF [0P0 40S G044Q p9Uo X1P, 4   9@- M@P`,Z p *YUT 0S*pP  Y@Zp Ѝ$S ZT@p8 @@YZp ЍY@P :#46*0/Q46*0//P@-@00 R@>P@Rp@-@`0P0RP*-0PpP  R 0 R VpP !0@a0O- M@SX@DPqap&TVq!`$:0  &^ ^ W0 * 0S  BX:X@D*0S @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ0- UM0,@P.0L10:X  0 0  T 0       YXx @-@-@- RC/A 0\R#R! R/p@-`P@ TP 0FP R @P  W00pT P,0, ,0 ?V0Pꔹ,\p@-@P J`PP  Wp0 0 :V-M Ѝp@-@ P` !LNS !@Ap- Mt ЍP/L -2M")2b3c1@2`1  0wЍC0@-@PMP 0 00 0 PCp`Ѝ00 0 ;4VT0p@-@Q r  P p0 S 1P p PP   ! 2W @0O-M`pDC@0D0Q0P95X! @0S S[ @   b 0P1;  P T@@  0  "W @TQ 0P02@0  0 W` ЍQf@ 0R AX00@P00  s 0`00R.@0QLW 00000`VBQTQCp0 0"!` b  V0 =T@P@00W"000@000I @ 0Se0T0 2a PPl"! 0#000 0 ' 0 @ 0~`@P !R/0S 0C0/ 0RA-@P)p`B @1V@ * C BQ   `U0 pg3701V@ * C BQ   Ub k PPO-p -|M0480@0 CH0d0p00`l0-P-+*)('&%$ dk000P0 0 00@ S 00(00mP@!T 0PB!T00@l@0 @ R \ $, EQ    lp l  +RS -R l  0B ^0Rl}l 0R 1B\t0X  $d0 AR 5 R/ /o"4 ZT@gkXpp XFڐ: 5g01[5[X 0S 0S %0hSpHp tpH hQ Pp t0h0 pLWt03 t0 0ht0  A R8 , Q!pCW/ pWp hpw60h000(0, St  800S{,080000 00- ۟ 0$ S0˟? B @0p$  0HL0H@@ P|  L ! Tp05 @Pq p   !ThPt` E Pb R$0@0P, C0E$@ PP0C PEP`PU00 S 0SPE`FK$0SmEQ=? 0S{Vs[  P4  PP/ 0S0S< ` 40 pSp Pp W 0Sp# V980, S0d0 p [z0[`v KQ 0Z00SaM<00P00000h 0#Z00St0D0I `\e `P \QY[00pS  !o p Pp 0 S B\P80, S h 00 B0h  WD0h t00<0CQ?o20S )K{8Ik{'Zɋ,0S    ?@V瞯<?P 8N$?0Sp|Ѝ 00XS `l`0P P0 0p Ql000Sd00d0R tpu d|Ѝ 0,0SiR IR NRl@IP 000l00(S0d0 0p 00nR 0p d0lpP*  ^P  BTl j 0B Q$ Ql l  0B Q, 0pHpWt)W,  @P ylp0000l0Pj `00W'"2r0{:#:?C0C0  AQ' r!zGpGp4656R: HkH @30{0  QF 0R l 0R l 1BQ<l0B `$ QP0Bl 0B Y/l 0N0B YL\#0Z0a0rp Pp} h00h0\l@qP9 l0x0Cl0h Pl00l0 00000p d0sX 0pHptpg  4Hk01{pt W'" 5u0${(:#:?C0C0  AQ' lu!zGpGp4656R:L HkH 50{0  ]400d00H  0<PtpHW 601{'$PbB  OV 0c  3004 $  B1kd00 {0G GP xpu 84 04  h{  A1{'kd00 {'0G GP [,A7"0R10 ,05 `l A%SVpp 0S ph0 |Q0,0 00C  t0!0h d0(Vpf!0Zd008 ,R0PP VPt0p 0Ct0 0hd0Ppt0000,P0d0ES!00pd0 @ 0 00p d0Sd 0S` p 0p000,0t0P0d0Z!07 d000# [00Sp 0 VZ @0d000p 3Sz 00d0 Pp  h`1`f`Ph00h0!0d080, pSd 0S!0d00S(00(0t0h 0Ct0q@-00`mO-@ 0Q@P MP`PV pL@ 0P  "(%(!( Z"8J@ ZpI3q WG N@ "8!8P0LL#8S 0Y  0  0 ЍU@P   ! N``3ß0O-M 00@Sp 21`C`0 00 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WJ:Q0 Y \ 6 Q0R T0#03\0SuWa* G0V*0F@S3 FQ   N0WN 06S ЍW*@DPD@ Q0; Q0Q l l@@ 4 Q:@00XS Q0n MR)AoᨂX " 0^0 n120 00 QP0Q0l1 c 0R:|00Q )Q 0 O-M<0 -XHX8@`00Sp 00Pu0P0P0  EB0SG^E@0= PPb @0 Q ES ZH P 0S S SD `Pb@00@0 00Vp@ !FMT 0 PeS5 q00@00S Z 0 @\Pc R  BPPb S@0D0CSڣ0SPX 0Sa 3@0 0TX 0p 0 Q T @ T TD^ @LT 0CC10BgP0DSy`0 S0 S C U 0S S S NP@"00ЍRq  BPP+\~ -\  L^ ?L NZ P\ #LPNU PPl '@Ѝ \ 0PP0Q 0S00 LS S80S #000 0 b@0M"00@C |`P D21 `2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf w0 S_ _M@"00ЍP@0M@E PL K`"VpK`W  `21 p7  ` PEF@Q@!80Sj80S 000i U U E P 80S800c8080S `T0)  RP!@L#80ST80S P 0 0  B @\ \vj 0`e  BR "@` P3 `2 c"1P 5  /A-@0P R#`pn3 ^P 0 W@00 0p `UPEPU 0 BP @p `W`  0 BP0Up980@-@- M Pe@a 0 B 0C2S6cА* Q*KUZKE A@{ Ѝ0@-@0AC^ 0S R0A  S@-A *@\0L0C00T D B @ J0"S1 1  !2R / 3RS/00 0 c R\0\0 a c R8080 A c R/54h4A-^0000PbA1 !0T2, l!p(  T2,0N10C#10R! T TNNN1^0R P@-@M: Q @ 0R Q ~@ЍA-P a 1`pM0S3 U10AT !0S 000& R@T0  0S00 0Ѝ@0!0D1S<000S 000 t3` 0p@-@P0p R pPQ`00App@bD `׳0 S,00App@˳x t2`t20  0#10/ P#8 R#4#2#10 0// /A-`P@  1,0@Up00p 0S1pP@P:pP   ! I`}P081#3S412s2sS/1J //@-@P0@0O-0Z  @SMpPA PaU* F B  ;I  ^'* 0H0C X000300 ZP@T  ` d` X`Z P` @T@T 06S @ЍG-0܁@pR$A0 QPiV'10SP`P\ 10i1000000S l1˲ zPP4 @p PU `@00SaPP# 000S 0⡲0✲PU 0C  pPph0⊲iV0S <0 ,0R0i | .t.q`T-G-`P0R@Tᡢڃ0TP$ Zp !pdH0  a !  \2)0L0C\0003R @@GpG  \-0P!1^$23\ *G-P@0p@DTD !1PD*32^ ::P  @aP @0 0S 0SQ 0PAPE%Qp Q!! 3 V@ 0 0S3#V0`F `F` 02NS @0@PpP 0 0QQ!P3 p@- @APD0D ` PR @ *\ l1 0DR56 501 P56 +Cp0R `5<5#11<?@-P- M@@;`P  46!z60:S  W  0 C.G B 50c 0 Ѝ  0P c2# R   W C>C0C012`00S/0 R /@-p`aM@`P> L1P5PP3 zpP-0S  Q6 p 0: S/AP  8#80 @0 $ 0, ( 0 0ЍMH00Ѝd0d d0 EF<0:H006HO00 0@rtNqp@-@P >00CS00 P>pP0 0 =EvMȺ@-@P 00CS00 @ 0  0 IE0M|vXA-@PpS 0rSL wS aS_` G 0 \`0S! e C+S ^R)# `0S``0[S0\S0TS0USP`0 0 >]EKp@-@P7 0S= [=P00 P! !& 0S 3/PP೼000P @ P 00 匶00`aa@=d0`` 0p}:P404 40 8E>G 0P0sJ@-@P 00!R !.P 0C 0 0 ;D@sJ@-@P 0 0 S 404 40 ;D0 0 S@O:rIXp@-@PQPD 100S3 0  US >000SB 0"$0 3/0:0P6p00P @ P 00< R 800p?0PJݯ 0 0 JD9P 00; 0 @0 0pF0 @0 0P 4x`Hxq-Ѝ/@-@QS S S vF00H0@X,0@/f0@a6@000 0 0000/@P 0p/@-IF/41So O-@ MM Q 5/` t  j*p+4\ ājd% p  0 T  `h, \0`PPt` 4x @ 0 Xpl!$%P 8-,1)p `0(` Tt8 d954 ċ<=  <" # &$ '* +p. x/`2| h3P6l X7:\ ; >, ? ̋ a!*a*b"0*b$*a!4 *$a*8j(*",j"a(!<", a"j(*@",c#j"!$$Da(!c4*"H0i()PQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ  V C0@BC@SSO-P M. Sw$AT`p$a a(qp A`TS XX`D( [ʋ Q `0(qS 0 P@  Ѝ0C$!o?P" (Pr ^{ \ `VH$8 S zpVpGp@(V: ($  AT$$( [ `( A^ \ :0  h @PcC@@,A R$!H(1s V( T  0 A 0 A0 A갰 [(! 0Q0($1@$ (AM` 0 `qPe Qp$\:~:lx~:HO-,M R0  1 rp3/,0 (Q0 Ps @`P@P^$$P 0BZ@ PU @pWW 0 `PK @R㲀( PUJ[J ,Ѝ 0 oPPu.  $`@pPA $ 0 `P" @R㲀@!  P^ ^4 ^ 0⃠Q" [ 0N `PP  gP0  jPp@@,Ѝ$`0  pP   gP(q@GT !R(Q0@-@ 0! \ @-/B 0 ,1(B0S@-@0 @ B00,1R@-@1  0@B ,!A0 0O-`ḙ0S ]MB pPw@P Uq  @{ A[ 0 . p 0( 48 D y@@ u@ PXP iV PX4^ Q!3Z@ \Tȟ Z Z@4%<pP3F 5D H  0$phP'2KJ,<0(!) QPVpKM P  0p pt 0~ Vm 0Sj A/ 1:*$ <)$p++ *<(),<('4 '<.0<.,4,<0!4<!< 0!4<!$0 #<$!<($0!4<!(,!4<!,0!4<!400#<4!<840!4<!8<0#<<!< <08 8 8 4  4  | pp ̀ 4 (  ( $4 |($  p, p0 ,0p4$( ,, 0484 48 x< @ < +4  8| + ̂@ i>?a0pW pڤ? ?@P?P?P0a}??@ XaHlL`O-@(P`P5f10pSp(P6 R ؑbP. ( ,0 [ D`D` S`1005,`5Ohꂡ  P ر 2& J= kؑ@-@ 13/, (Q0@-@Q 000 2? 0 O-S⼆M `p& 0 Z0 PU E Q[ [ R Y DDYYY  >00 Ѝ6& P 0 蕟 0 ̬@P 0 10$!12埫P- 0%S0 25@  t%00l5 0 0\5V00P500H5000 S S >00P ȭp ­ 20 2 80p" 0 0cUP U\3UX# 2Z 00 20120ESQ  000 1S 08 pE8`@V*("(R!3w0 .P0 "  8/P 1S0S1S /0 29 20 29 20S 28 2@R/S # * P{P s R < "4 " 8(P0<S 0%4,<%<00.4$`<.,,4<&,| 4& 80<$0480< (0480<,0 4480 <*$,00 4*,80 < 40Y$0SV(P$ @Pc 20,0 Q Y &$QU`H $Q0XM `0E 1#P> UR  BH!$H@V `F!) 010Q0P0 @D1H$Hp@v01 @1 0p # ]#`FP 10CS@: 0b20  #  G#Plmjjiiiih ihh`hxlhfe@-@PM 0 0P Ѝ0 0 5/dO-p"P2 0JM M@P`040g VW00?470S 0SNIPIT/ #P 100L"D2 0 4 30Jލ Ѝ >X 00 0UXS 00 I;v0. T:+[) P0K/S  0 00P0: S 1000S0I S1?00$1$!$0 ?q/ QP PV# 4- Ⴚp!10S X  \0 RK [ *#Pt100W ûp x»P b1@omFw w ctR Q0P:Q0Q:J0@-40$ @-@@ $ @$ p@-@P#+P$ p@t0@- @$M0@ PU 0000P 00 0 p 0S$Ѝ0$Ѝ0XP0 0p 0S00000 0[00`" O-lM@d0P X$0/ d(/dp Dp/d0  ,0/d` H`/d 0/d 4/ d@L@/d 8/ d ء `PF 0 0 Q 00 岡1 P. 0 0<0 00!Vpp(%@PЍl l0l 0b'000100p@P p QCCO-`0dMS0B⌀p4D H0∐@(804 0V pPUn XS*1 $0C8 #  #ȅ 0 0(0D0HPS! a,ZO ll)l  0  0$ 000F 1opP& `V 0`h0&h0CdS9V65432 0/.-,+*DHp   P  dЍ0 0封10CSN*04 S0000080d `V 0(p,0 000CS@1!0 0 0R0 0  00"0VS00 HX㨀*(ሀ 0 0 0 T\XP0XP2/ 00R 00 00!0 00 0 겄DX- 010<0qpGWpF*< x'xp0qሀpGx0'x0qqᰁpHX㨀(*0(0,0HpSc (0S  2 0 pP=   aZL P 겄DX 010<0qpGpWx'x*W 0 08#8S:1 <0C8 #8ሀ 11qpGWp*x'xW 0 08#8W00,0HpS P   dЍ0!S0 B("8 110 p Z"       0D0g  L'L P 0 0 0V 4@ 00 D E#(@SHX㨀)*8#8V *("( B``F 1`010,0(p0M`"      828 0b% " 2  0bx%'xS!1 0by%'qpGWpY*x'xp10<0qpGWpC*x'xp10<0!1 0bW%d!d1d 0bM%00 / 2( 01fp00S P 0 $ 0q.% 0$ b'% 0!R 0 0b% 0 0b%p00WB::::x::9:99\::@9 8988O-M  @pPPd 0SC 2 K4200(2 0 02 @0*  t봀X)0Q] S  e `PS A`@DT@%*8#8@0C 0 P3 0RX 00`10CS@*8#8V 0Ѝ0 b $@ (T Ѝ0 0 bt$Q  0崀 Q xP 00 77h6x6O-p`,MP  00 YY 09J  (0IY 񏐖gc0ISF&00@,Ѝ(0YR 7ȷȧ0, P!pU 0pP1 0P1 pGp0 1 @P QPEUP: 0 b # 0QPEUP:X%X 0 Pb #1q0pGP1 W p: 0 b #1ꈦ刖V,0 P1R  101 01J  @P ! BR : 0 b# @R @P 0 00(0Q00(0Pr?@ ( = 2 @^ 00,Ѝ0SN 0SK 0 t@TF @R 0 fp@7 0S 2  1 a@P& YG !YD Y(0&QUYp  Y$  E@P 10CSP*PEX%XY P @R  Q0 (0 @Ry@ p @PEX%X Rg(0Q1P0CXS%Xᣠ!* 8#8UY< P U @PQpPEU 0P @: b" @2"0 b",R @ 1_ P 0TSAA T0D OD2D00<2 0,R @0 1? @Pw PU1P0CXS㣐%X * 8#8UIQ U0E $u  0bw"1!0 bn"L0CX 0@%XLXX  0PEX%XA0!1  P0 1 g@P, 10CSP: 0 b<"1PP!0 P 1 GPP @@ @ R44l3|3//P / /P.`..H-p@-@`PP ]0 00(0`00Q(0pO-,$M`@  弱 pPM 1p0C0XS%X3*U9 X+U @H$H @ 0E 8PP 0&0!01@0 @] [ @KH$H$ 0b! v0@ 0p0$Ѝ 2 @ TQm10CSP:d4d$d0 b!8#8TQ 00@p P P  ἑj 0P0 뼡 0 [0 30 0300300X%XPEY 0弡0 [0 0J 1VpP QᴐZPEUP: 0 b+! " @QP@ :Pm 10CS@j*0D@ 1 PP[ 뼑 0 [0 뼑0 [ P0I 1pPx @YT @D1H $H @U0PE1> Աԡ @D1H$H@U0PE1- @10 m pPJ 10CS@:P 0 b  W5 R@ 1 ! 0 b p C%0PppW0:1 01P01.  0P0Z!08#80 !L,p@+*ؽ*))'4''\,'/000/ @-@P , ~!@ (/! 0" O-$M 2p  (@0\0$pp 0 P`0 pP`@  M!Ÿ%f#"," 0` ! `! %   X! , pd!d!  0! \ p p P`@ 0 !b!!    !`.  . "  @X!)!   $Ơ c,c,.    000 00 0 0 00 000000 00$ЍĸC-@P MP' $q`{?pW($7 )e 0(0 ` 2`p` b8"#4b4# 0 V@h G  Ѝ 08R(@R )@ b7  8 0 )8 b* 0A-1?`@Pp @f(X( Pc 0刁0 0$0@pG0($0p ?W6@`G?`@`` 0$ <@P U 0$ ?pW (< 0$ q0 0$ ?W@`G?`@`(`@ )  0$ <@P U 0$ `R @-/ L@-@P 0  @ ( 0"LR @-/ /@-@P 4@  P 0$$ز O-LM(6,Bp0`0,$ 4<8 P P(^_8~?00H@040<`p0 `pP , $,p `pP`( 00 400X%'%ɠ0nj) "&&ɠnj .,@0 ˠČ,+$ "$0 !'( ( 0! 0( Ϡ' . $̠Ì @ !  ,  , @( 0$0 [3 `0~?00<`p04P0    @ ,  @ 0p0 01!  Q!声#$ ,኿+* / 3< ( +1牑 0媃(३1p>ဦ*1砹 1ᅶ>%S 0#] P% #$7$ ᇑ90# ..YW([T0#P P[T(P  P%0 P P P%P 0!$pP00(p/!~,! rp', /!!,(,#p'\ )S   ( "P p P% p PP%0pP4p p0 0PR4P$(P]8` 000 0 00 00 000 000 00000 00 0$0P(0$P0(0,000,0008 40 0 408 <0 0<0LЍlp@-@@DQPP` U  0pRPQp bo Q0P0H 1@ -p@HR Q b>p @0A-1`@Pp fPX; @0D 0 #@0D  H00H0L00L0pGPpP3WR`G```@0D ;  SP@0D *H0L 0 H0L UpW P@0D q0 #@0D H0L 0 H0L W`G``P` @0D ;  SP@0D *H0L 0 H0L U`R @-|/G-@PM 6PH8 I `p ` U@ .Ѝ@-@P 4@ n P 0$$R @-D/yG-@PM PH(  `p `G U@ Ѝ 0` a!, a c,/@-0M@Ġ  00  00Ѝ0@-M0<P0AP@;P񏐾>5>  KGC?;7 UQMIqla]YUQMI 3/whYzP;DPoE@5Pz}|ytsrqponmlkjizjRQfeNm^]\[ZYXWVUTSRQPONMLKJIHGFYs 7P 7P 0P:0@ 00P%0H  p Hߍ0?CP 0P 0@! 0`ߍ0= @02S, DP,෧R00   0  00 0H p mD ?0/00 0H p h 0 0@!0H p HP ߍ0 0d 0 F0 G00@ 00UP 0p 0 C0H:PZ uH4PT o 0[ 0 0U 0R 0O 0L 0I E0 D0 0 0 0 0 +0 *0 )0 (0 &0( %0 @RPA@  | 0v 00@ 00P 0@ 00P |0@ 00P H0@ 00P  B08 01P 0H 10pH <0 ,00@ 00P6 X0@ 00~P $0@ 00pP  0 0 0 0 0 00@ 00PP[ t0@ 00BPM rp il8t4Ht  $G- MPp`  @SUY xB@0S z@P_ WP^ L 0S8 nP Vp5 20 R b0PX U`d  R! @ W@ ! V ! 00@  Ѝ VpU0W L1P0 W@V ! 0S1 0P` @V0  0S  0P`00TT W00XX PW0`t  Q @@0` TT : ~}} | ` @  |P| || p@-00@T 03/@T4,PP 0|0@T 03/@T\p"H00@T 03/@T$bpL \  @-M@@P Ѝ  0 :p P(0( (0 AuЍlz  O-@Rp M ഁУP `B80 S" 0SK: p0  0Z 0!80S7  0Q?0 Z 00 Ѝ 2  Z  0  00 0 P 00  P00 2  ᅈP   ~P  000 0@-P RM@P Q' ! 0 0 Q   0 013/Ѝ0s/ r? ;P100@-P U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpC- MP `@( ``0V#pؑI@ T`1 `! @D  T@ p  PU Ѝ ЍχpP p`O-Mq  PpG  0 PU  @P U`1`!  B[  0PU0  ЍЍ@- M` @: 6 # P 0 q@pG @DP @PPT  Ѝ Ѝ P/0@ 0A0S *Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-@R"2 0|M`P0t00[ 00S80S pd"\2 0 t0 30|Ѝ4P  uP8 01 0#\ H40`0P 8 0 0 Xp: P8#[> !1ȁ0!` 04 04PU 08  R88P@P`0X A@ ᆆ 1248 Q080!:J0 S 8C08Po>P8P 8 ` 0pP 8(00$08PPP8l00pgh  @ O-M$ ) 09 @,0p020D2(0S PU 0H"4S4S2d90U 400P0h00Q P0.0Rd00e0 0h@00S d0P02 0CX 0 ?01H0 00{p 0S000S1!R00:X Y 0c/d0*0c/%0  00S 0 Yp 0 SRPU b00$ R 00{"00't7 0 2 30ߍH2SP708 R4004 4P\ P0R4040P0눐4`0) 0 @ p 0`U:` 86(06_V04ࠓࠃ8 X00Sr  0\ Y``VP `PP$XY0”2  \8Q(( Q %P`00S 0 SRPU 00$0S00s8Qr 4Zx ` Z``q XPF 0SU 0 RP ZaY0MX  R*c/P0 0' Y1 0 SRd@T 00$0S ,0S  !$0(0S (0@TP # Y P 0 SR@T l00$0S?00 ZY0 0c/d00 p 8Q 0 SRPU C00$0S]00c/dpw@ X P2 `0 R(SYPR`VY`P2 08@04^tRP>YP&0 S (0(X PC_oRPU``  0S0S@\40 0 48 8 \R \P0` P u` 0 SR@T` h00[@ @ hM`㯁(0P`2 ` 8@P@,@ bY$0S00A 0X0 0 SRPU 00$0S.@ d@ ]ꃻ h H@ H \ p X A-P`@M@`@`p,}000,00(0 00hP}Ѝ̱ O-M8C8@@^&SppQ`Pwpm p' r20Q`0  PB@2B f 0S SZ0`|lŸ <@ЍO蜞T 04SD:`XB(p~> pP  T0  RX 0Q(0P0 P  PY   T`XT/o" RpP@ T 04S`X# @@@0V@ 0 W 1@U V W(: 0 0 0 30"Ѝ-@@@~`@ T X _Y`@`  T`I`~U  00ꉺ 8 P | 0 ! ƒ1p@-S@P  t0P ! "0 2pp@Np@-@P` VP(p0-P@  P 0S RP0/P*0    PP0/0/R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/8!81@- 0MQ020' 0S0. /!PR*/ "RR /@ 1@0BQ R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ - QRO-P00P00$MS` U  "1000@b000pRppP0@࠰P㒛+`  (P   5/ P  5/ P/W00X& 0 0H AQQ0 @A`JQ!Q0Sr*R*0RF: 0C e 0000  5/ PE 00`X* 5/PW W 0 S 0  0S X W 00`F W0 [W00}00S0R*R:  =W 0SW  0\OWH 0\0 0`J CAQ!QU 0CP 5/ P- 5/ P]% 0 05/  删 P  5/ P0K  05/ P   5/ Pڈ0F  5/ Pn 5/ P 5/ Pm 0WC?0[000S0W5/ P`0`Zp$Ѝ O  0 @z N! 0Q0 0`J CAQ!Q 0C!0Q00 0S 0 L 5/ Pq 5/ P i  5/ Pr 5/ PGj 5/ PS  5/ P0J0@ᐔ$ T `c⃀Y*`  V@ `5/PxW W  0 T0  5/ P 5/ P " 0 R0@0@ @0 l (0( (0 k 꼷stsR Q0P:Q0Q:z@- 4C-S MP@  $3/t`  0  QP `^x4P4S  $3/000 Ѝ00A-pd 4V:@T@T 0P0S  00 S  0}@P0`0dp@ B ! A-`M p@P0: Sxu}PP ˅P@ P 0 - tdЍd00PЍ( $$4/p@-P$0r0" @`Pp$U04 0B0   0R 1  00 0p  0% 0 ?  0SL@-   00AS 0=~4O-SM{@Ap⇁0PS`*0S'  TP [ P0 00!Q    0    Ѝ P@ $ 0   QP1Cw$R P0)k 000000S@p 0 q 0p4 S   $3/Ѝ 0000O000Q 0A00/0@-S@  R   0 }0S}p@-P@T @T 0 `pp@TLP`p  0S S/P/$(0#   @// / ////  0S RP/0    P/@-@ RM`P:Q !S@Ѝ0 0p P Gq@Ѝ 0T @0 0O-PP X 0S ' & 0S# p@# ,0aT T 1 !3/PT0p0CS@D0 T,0p@VP ?0T` BB \|  i V`!  0 0C 0`@ 0p0CS0 0T `p@QQ   D R !,03/`PIʼ0@00 "R(  0Y `1`!0PVQgRJ,03/`PY M 0p0CS@D0 T@ 0T p P@0S*V*  000P@DS*`A 0`V:W{0P 00``F0 ``i  0Y0C00 00oP   0 0C 0Z ` 000YP sd0d d0 G XH0H H0 H 00_ 00[ffp@-PP& 0 `V @@D00T`0@T` ,0 3/Pʼ0@00pD0Spp@/0 0 VT Ȉe0p@-@P0 T0 PUpg 0P0, @u PupD R0  R/ S/p@-@PQP9 100S 0  R 0   p0 0c 0p&   0R0Y0 P @P B{0 0 $0 ,0, ,0 < px 4Іc@-PP4qMp`@( V0 T8 p   UP0 :CoR/  S L 0( 0R Ѝ ; 0 Ѝ0 0  Vd0d d0  TH0H H0  ;04 ȅbb`bp#p3 @-@PdS0lM0d00PB 0 C 00   #3 0 d0 30lЍ }0`0S6 pDx0P " W000pS0```p gP0 ```H"H2H 0 | ,",2, 0  0S"$p @#Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00 *{ 0 0{&{{ 0SP `l 0M pp p 00 p\P꫱ p `؃$`$p@-@0MPPs00TaPtV( Vt0T1S Os0T1SHt0`;t00 UTX!\!R Ѝp@+s\!5t00Ѝp@"s00UX\! X\!0 000S/ t0 0p@- PUp@0s00TQt0`U TQUP rpX1P0X1s0T0`X1 th0h 0 R/@-@0r0 X10CSX1 @rOT1-s0 @rP t0 000S/g t0 0 R/p@-@0PrU00 \AQ\ X! BRX! p@r`s00OT!r00p@r t\ \0 -4M0 0,008 00 0 ,0 304Ѝ仰 p@-@QP  (p@9 0 0 9t,@HZlO-M8@0qp::PT0Ѝp, ,0,  0i0U\U@-@P 0S \ \0\ 0 |@p F, ,0, 0 { UT㣒O-PMp 0GW"S`@P-TP0{ +T S 0T W  p Su?0 0 0   p P P8Q PS \/ !Ȏ\ @00D ^a0DSW0DA0DS)70D S&| Y[Q PS \ !Ȏ "00"00 0S \0F0 ЍS@ `! ?0 0M0b 0 0 0R00  ЍS@`a k0T0_ XR" A B0A PR W p R ppNP0P P0 ?&) `@p >W8pp8qTQ00M 00Ѝ \ 0 0 00/0 0<0/0 0 00/ 0<0/0 0 00 / 0<0 /0 0 00/d 0<0/0 0 00/ 0<0/0 0 00/ 0<0/0 0 00/ 0<0/0 0 00 /T 0<0 /0 0 00 / 0<0 /0 0 00@/ 0<0@/0 0 00/ 0<0/0 0 00 /D 0<0 /0 0 00/ 0<0/0 0 00/ @0<0/ @/ /H-M4 0ЍH-M 0ЍA-`p@P 0@T0@7#0PP@-/"O R ?#0!PMO$ P!ЍG-Q `P@ S V " RpSR Pa 0Cj ?o/o0CS 00c8ÁVS& /o?o BR 0 0b8Ápp?0ϠT\ S?? RpᡏVP0B V0 0T0d0?o c001/o?o0Cs! p R10 0bÁpV Ve0o`1000@bq<àQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /| 0@-@ P  000@u / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/0///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 0000@-Q @P' ST0 C0 ^@DP \T^0L Q^ PPP 00QPS@R S Q0 S 00 /U/ S R0Q0 / 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@0@-Q @P TS Q@DP  ST PUPQ P00S @Q RU // Q#/  //s R RS0  0/U/0 00/SR  Q 0/ 0U0/ 00/0/R  -/p@-@RP` R V  U  R 0 p0 0 \XGRQp@-`@P 0S0 000 000S0 0p 0   0F0R S 0Q0 0S00/ 00/0 // Q#/Q- S  BP0C S P QP 0U0-Q S Q P 0S 00P 00 @-M0| @000+0000 4 ,0 0 0 30ЍEd -BM MRč dd  X @ 3 P2  길 Ą<0@- @-`@# s M Mp $( PrN TG "  r" @$@p `P0 "l2 0 $8 30ލ ЍB^T"P @0p 㰊0 B^P.!0 r100A@  0 0 P \ AL+\ -L+*)B'&%$#"   \P  h\\\\\K2 : 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A @@-00M>R@ 0 000P001 200 :P0ЍM000@@- 0M@>S   "0!,03,0 P0Ѝ)00@-@ᦊ@覊0 00/ ((0(0-M 0 0囊Ѝ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/\ t@-@p@-0@ ,pepP}e0Pp$//////` //1O-0p,MWP` - m1 00 (05/,ЍZ@PK 0S PPP S0S3*0! 00S S( #S1 0 0S  0S S * Rp C 0QW000 0 S0000t0t t0 .0X0X X0 $@L<(9\9l/O-M00Q0P08-S4= 0000Z Y:= 0 0 0< 00 $0 0%SS  ESx 0`  0HZSZXWUTSRQPMJ2~}|?>=<;:987643210/.-,+?)('&%#" ZU {wFnX  ,0p 0@ ,0p\  P [: Q Q0 [4R BW Y ӄ ˄@T*a 0 PCUPE[ 0 [04PU*U00H ! 00H S[    ) 000Sq- 0 ( b0`@ *XU 00H S800H S1l-l*@ 0S  Pu  00 P  BU pb @ @G y ` 00`$0x 00sc 0SRk00[p0 00@0 R R  BQ \ $! [U* QSAQAM0 [4Q*GJ  0 0 000lX ``k0  , 0`@``  000000 r 0SRk00p0 0@0` <  000s 0SRk00~ P0 ΁0  c0RP pE BWS@G kW 6 030``  0  0 +00@0 R09`60S 000x5 00< 00 0 `0 rkS P0 !    c  d< 0 r0f Q0P0 %P% :D$p $!L Q phD`$P)@ dW0c* P0C0Cm H 0000F0  C 0A \ [  04AQA Y˄Q*Q Y'# Y! 0Y˅00 A  0000g0 [0K0"2 0 0 30Ѝ0 0 /  1   ,   0@0L0 ` p @@02 000'  ) P 0 @! p 0 @ Ƞ,Ƞ m i@g 0 0 f 007@5 0A410,!,1, 0Z ! 1  0p@g @G f0 000X 0 @!000ҢT0  0O$ $9901̨ (.-ܢ,bȢA-P@@ x0`pP@PU J0SPE 8/`uX@pW$0$ $0 :ꔞ x+ 0SS S 0R / 0R0@o/ @-oG-` !p1 0CMM@P0440v @ o 0 @0 44 30*CލЍ  00p 0XpP lt 0 p\TP+  f  0e/#h 4   8QG-`0S+ S'QU$ pW!@0 S00#S0S 0S0S0S% zP" YP@ Q@ 0S1S00#S0S S \ O-0 BMMH!dQd2 hԀ&h Pp0 `V' 0 _P@P Ui`f`0 ZPG<PH <0 0 4 30BލЍꂡԚ  O-H!D1 0AM @ MT0402 0Y/:0`x0(SP05 R%S3 #ttx0'x 0@T `` 0 }P pW t 0 M_PP D0 0 4 30Aލ Ѝ x (R(뤙  O-M Mp /? t0060 @?T000 1S 6 S`1  0 ?|@X@0 0p t  @0H0 ^0S3 S70PuP`p@ R HP% p ]0 0}P R!R㇓ 2P PpU`@P0STu `ppp0S`V@ 9 S  R= @0L0=0T0<0d0p0P0 0 @Tc040v?D0 0<0\4 ` 0S1S < 300S S00X01< 021帑YZ0H0St0(0p080400SrATo <0CPn D0PPPyl 0;X8@( ᵠP R@P0PKPw 4 <0 @4 D 0 T<0D \  R c H0S @0S -<00p0^ S00H00ST *pt`P|@P 0@9/P: |T+<; 0 6 30ݍ ЍpW 4@PD0Py !3D0P0 w  0 ; X0 D0y4000SJ0X0K<0`S\0c  r`@pV0G  00P`?<0 $ ,   000 0,000F000 0|PP0 U0A(  QO `1  0 9L0X0 @0vZ@0  *0@0J$0 0 0 SNb0!刐?A9c!@00FP R0S N@L0P h0(@H(H 0G ,@0@0PD Q  (8 0 P0`1  0 8T0X0 @00 00  1013 0@08`(0 0ՀP( 0 Pj `1 q 0 070X0 @0_000 M 006X ,PY0&0<  X҃NP 00 @q @1W㲐@D0 `Tv?P 0WP G  2‹U 0 0W    ‹v@01粐0u 0 x5H0@X0 i0@0$ oP 0D a@_0P h0$@$ 0Zy (0d00@0g0$@`$` 0D0 AQR\ `1S% 0   O 0H0@0`Tjʌ |P@ A`!!! Q=   30 @| X0Q  0H RC A& aV v*P|@p t 0@p6/P񏐰0+S .0CS)@0P PPU a0 2@X0 0`!02 @\XÂj S0(\01S< 3`0`00S S000`P1E`0 ؀P0 `0P10180@PD D\hP p08 00 3800Pb00 P 㸠D TP B("(R0D DI >PN0d0KPI0@D@pd06S0V. i`4  h$\ CLl`,`(D8̊؊4`x T H$t|@T \d 0[6Sp[06("(H0 D0 P TP B("(R0D D ~P0d0@0P f0 @$!$ 0߁ RV 0R  0`1 d 0 X1x0XP0 &0R iRaf0!@! 0ⳁ 0 P 0 1 X@0Z0  D_ H0Sa=00Z3f0`"0x"x ⅁3& G("( 0R00 P T B("(R D  R,#N~Pʍ]0 P @0 0P`Ps1011S1900  b0 30X0 "'<0d0%d000 3@X@0" &0R 0 3 X040000]0d0@0P e0p$@$ 00d000`0 W 0+S .0CSB@0P ye0%@4%4 0ˀWt 0|p0(0d0iP0@ @p05 @XੀJe0%0% ✀P0@ 4e0,&04&4 ↀc/ /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@G~P$Ѝ0 O~P0͡"c1010$Ѝ00@-$MP@(~P$Ѝ0 0~P0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-#3 BM M0Pd0$40@1$p000 S00- 0p  P@QP0| T0^ PN0P0A !< S A 0 ~T40 ;" P0 0000 ; PPl P0. Y x`10$430OBލ ЍS  X 0S0Q4 Q. Q( X      "448#8 $$,  h("(h~XXX~ $@ @4I| PC-PH AMM 04@`p" R3 7~ 0@ `} P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R` @@L }D D ~QXꍙ<{ /z FtHO-!1 夡0AMM  0 40P|pPLpCPG `~PPB @ t+01@P7 0S4 `  0S+ 00@ p3P00@S 0S0S 00@ K@ @ \ @縪 ᴪD ,0 0 4 30AލЍy y 1Ls=lsslrsr<<xrd rqqq@-@HMxxx{` |  0 %  { 00 xxxHЍ@p@-MAT ex P00( ``"00 0x 0 0Ѝp@@ 0@- Q0|MU0t00& 5x 0p`0# @0O h @ 80 0 t0 30|ЍPP꾔g f A-@Pv1 0!1n0SuOPpPp vp0Sp@-@QU x3s|p \01P \01000pvcxVxvP //GP //mG-p`@>W`PW00V0S@ 0PS1S ` a ] `*: O-M0MP@050R0*  OT: 0Z`@(,d!0  d! . 0`1111A05<0[Pw  0ʏI @yp d10 d1 P `@ W`0SH _D@G S`\  S S00 Q`@0S SP C0SQ0 0CQS000008xP @0PP 0+ 0s:P 1#S;S 0t(S 0h(Sv 0\(S: 0P(S 0D(S 88R0sS2 S S(  7R2 S S0S0 S S SS@@ ` `00W_A`P@Q"0A'A+S? `7R2 S S 00R00S @0 S S00 0S S 50 06Hw0 @-0K Pj< Rf0P 0< 0R@o0@PP0d!S 0 0 2d1 O At| v1 |gvAp 0τ`0S V `0`SH@DH` .S`0SV Pp.`FV00W0S  00P $ *0$00p4 0 5 30܍Ѝ4 RB T T Z|40p00$0l4p0004PP(`, T T@ TT  ;T RO@T $0 ` ;T 0000@@T P 0 0P  @0劁$ h1P @@T;T P3P0 0000@@T;T   \P @ Zl@(`,0p4Pu 2R2 S S0Sj0 S S SS@@`  ``U _AP@`0H SD` \R?* S S00 Q`0S00`07<OnP.P `-V1=C` lDQ XaD@`$vQ<0 SQP@* P  @0劁h1P0- qA`>`Pa0 2 FPꃑd d Ekk domasearnamesortoptionjinCerhh+T8g,g<^ listpchPchc@c!1 p@-Phl@HMP ^  T 000HЍpp Qx#r ctV p 1 xT000000tPT $000HЍpd(A-p RP@0`P  R P  @R0P\ R 0  0 O-0PQM0  T4T0v0P0 V0P0 ` (0P $` `   @pP rPZ @& TO0 @ 0- !H#Z0@0 0@P P rP0S Z @P0 0 R"H`0 P[) $@ P@  a Q `U H #Z e[  0 Xv00pQߍ P$@ ` 0CQ* 0 0`$ @ 01!0 ,W` `͡Z Y 0p  S` :@CT0:@D`Hⴠ0R 5 `V@D$` R @D` U+ ( [ 0 @DaU ` 0  2X 0  ` `r 0  Xy0f 0 q ]@0@ 0@-@P @\7 0 0tR 0 (0( 0@-@P>00R 00/ @-@P @6700t P @-@P00p@-@PP  P 0  p 0  0 |\P3tZp@-@PMP( `0 0tPP#0 ܭP .?P۠ 0  ЍpӠЍp@ @0@ <0$ ! 0  Ѝp h d2Y@-`PtA M@J h!h1 dQ0 Pp 0 RpGS< `xWp> ЍA@pP 0pP 0S@ R p@P  A0X Ѝ   0X Ѝh0h h0 PP P PP D|X6 YX5XX(5|X X$XX4lX0A-0PU" 0U"0PUP!q@@``FVP $VP 0!E`1$(`P 02~Pذ''O- Ff@0S` M, 0 4 &V F$0( P@RB 1ؖqY\0i(1<0 BRS %+38< 5 0(< 䅟 1 c0Aş0 p8'(p4< 0P(0 P| t hup40Sf0S L 4 0SlX6S ,% 4 0Sup00S S504 RS 4 ,00,000S4 0ğ0  ( XA3*0210S P10q S^P40( D40 0Sp (4041%40(8(JgP0440^30( p ЍqR 0Q*# 04|3!0(08Q(%401Rw4# 30<!^ ^ ćrp S:p 0(" <!0(0% P^4)|20( p2 0(< \2 0(< H2 0(< 42 0(< 2 0(0 2 0  8 ( 쁟00(0(1 0( 긁(0(10(0 R 00! 0t1t00`10Vp (4p Ѝ8p N3p 0o^4nqpy2  Z 00K VM دXT0d@( tUĭHL<\l(H4Ԫt`D D,QQHP,01O-0 MX A* 1 a001Q0,`P0 ^/^_?+~ 0 0@S@ 00T 00}O R :R,000P R 0Y$00 Ѝ质(0(0 @-_qWnD |HA-@@`V 0 CQPqSP pG P,SP 00`(N@-@00 R \\  !$00D0 0@ ($ T|,@-@PL  0S  T0S@TT@TԥP/0d 00 0Q,0/01P/0(00$ 0/\p@-@P0`L  0PS(  1T  0 $000`pؤp@-`0PyQ@P  PtQP 00p/K A- 0@S  P p00   ($ 8PP(p`P0 *O- ,0ZSP4M| 0 *  +~   /` *p@0||ZP^/^_ @   Y@ }@pQ0 :Q , @T  :R^@e 90 pY尉P<``P@0 00 J4 S  !$RK`SATSRYe0Q0,080( RD 800 RC ( 0S  Q (0 0($0 `tHd@(p` 0D80 p4 R B$ȟ  B QR70 `0C' ( ' X 0 G @004`q0 -'列  0A0J,0CQ, 01$( $   (,  ^0s* Ri(0B\$0PS6000C?00S4Ѝ60f`P4 P 6@p0 00  t& 00D0DS:P6B0`@60006@0 `  p AS$0S@  00 Q(,0A,Q  AQ", (`P  -QP @  AQQ`B$iP(`,0 Q@1J#S  P@ P 0$ @UL (p(P$@o$ P0$  1\@ [3D@ ( 0$1 [/  T #0 $) T`  000`00@0 # $# 0$@1,$0P$0 Pb A `C@@p99 P (nP6 . R>*P( 01 (0 mPP$  0P@1@$@P@1@0$P 1@p 0P$1Y,Q$Z  `'10<0Sx1 0^O }σ P +>  P(1(0?:Q@ Q10 p0@`@0fFl@ @<,hD0ĠX 8 t@tX@EHE0؛t`КAAA8ܘ8A@-@P00Q  P     $00<0 0@ ($ ꜗ@p@-l@@`VpPPp;0U1pPE1PSp  (0$ 0pQA-pA@PT`QV0M@P  0 pPP``p`"@>A-p`@MPP T  0 000P   >>@-@@0/4 00(/8000/$004/00/00/ 00(/Ԕ000/008/ᬔ008/ᘔA-``PU 0AP ppR0APO<0< 0 ,(0耔( TMNO/< <0 44 -0 M0 JQ Ѝȓ <@-@P =0`00@@0 0 5#<@-@Q 00 2 9 0 G-PtsM@p 0~pD T 0S00{000 00 000 0$00-{PP 0` 2) "Z &= " 2> 0 000 0qp X X 000@+ h@PЍ <R 2"00@X 2: 2( ;jP0 0Z 2< 21!001 001 0 0100100|1 00P 0 R00   0T 0 2 13/pTd00-0pPP ` 02 2u{00x@Zt@q0S{X} 2: 2p ՖPv 2 @0 2D001800 0 8<,hC-`@ MpPP  000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH P (0$( p, 2 P;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p : ЍR @-`@ MpPP  &00U,0`V( 2S * 2 P13/PPF  `P 0 p 2 P00 Ѝ  Ѝw00P2!O-RPM1: 000 X2*q`I`[ /p@ p W   0 P tZ 2< 2ЍЍLP 21O-MrX>*0`0Q̡J0P@p@ W Ẕ PE`LP0# ̱100ES 0 Y 2< 2Ѝ10PE P 0< Pt YЍЍ"1C-S` M2:rBW R"*T$* RU  R00U00SR x0  PpX U"B Ѝ 2< 2 ЍKP"! ЍG-Z RbMp'*Q* U@0U @ RD0  P X U 2< 2Ѝ@EЍЍG-`഑p 0@M PP IPC!X%( 0!0x! 0CSa%Xà @N 8#8S0C!  0S001P@10CS㣐.* 8#8 0 BR ("(R B("(  0V8#80R!2 B0C!2pl0l l0 T T0T 0b808 80 //t/X/Hl/p@- @XP ` qPP  MpPp@-`P@0S  >00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-@P4M0`S  00 Vv 2+ RJ 13/p* 0 00@" "00  0$04 p`0 9/P 9/P !e0  ^ 4Ѝp$  0qp 0  P 2: 24Ѝ?(0p0`,0 09/P  0ഐS0FI S)0 0 B 0V F B 0 0\ Ƞ.,ȠCC0P0000 0@ @@T*80`F0C@J`80000 Y 4), ,0,  0)G,%p%G-`M( yPXPpL P;S<03%R @@zz0 L l3< 0Bp P4,0SJ 2 R ,  0#, ##$\A A0AW@T00X0:(0H8#80ᴀЍP008hS <0 PM,0S0S ,!Q #$ 000#$ P0A 0S/ S!8#8 C("( 0 0 0 X0倀f@0@z`@0@d d0d 0\ s 0S0 0O00\#"#8""51Sp@-@M PWFaP8 0P,000$P8ЍpH/G-P0"M(2 M0` p0 002Wpx @^ 1 R2Y< *5S0@ZZZ 0/, L. l3.<  0ApE WO\!L1 0  0 30H؍ЍU8 0`J8 ὧ8000S   "4<Ġ"< ̌Q0Z0 "Q CtYpꜞ@0▞@0O00  P O-P  `E@P H1嫲p0q1 u Jq08 10000N`ⴜA40O-Sp M@`0S0040000 PD $ 0B;110C0 X0M ^ X @[ 0 PX!B! 0SR|   R 0S  "  0!2#$ S C$ U@  UX SRRS5X%XqUa 0 8PY 000@@℠0ᄐ000ಀXNH0PIᲀ0@ ЍXD  $ U D V RP1 PD D00CD0 0 10CRO Š B Q"P 8#8 0X%XP!@ 0C 0$ 10C0S  "0fUPW Ѝ ! 1   01 `00 { Z@0B YPUڬ0S Š0P!D PD 8#8TPU PHDŠAD$dlO-M@`0VP 4pQ3⾐ Yj*WkPP @`V Q0p  V\Q  Y 0KPPЍ0S `0@ 00S#@P 0S 00 000S_ 0P00080080ЍO蘗 0008(8峜40PЍ0 L0000[ 0p 02 0 0C8#80  0ؽ [8: 00C0+ᰰ ̽00 0`` Y000:0 I0ಐ00ര | |0| 00 70X X0X 0 0< <0< 0 0x ꤤtL 0A-% !@ ::`0$0CQ @3A@D$0@N0qPW T002!@$!A賝pP 0  < 0:TVO-` P6UP0tM @T0P(0s 0 L P0 k (X0%X 000 00`0 00SZHp@0@@$0p관WP px'x E0 0G0 0pP@  Rڴ RpH ED @Җ0x 'xP @LH $ *P(0<@0P@X%XP` 0,0040X0$0800CSPX%XP0S,<0@0@8#88 PQpUP0:80P@P0, 00Ἓ0P,0 \j 40 S)i 48,0400<0 \  )PfP0P0Q0 00 R P ` 000PX%XPE08#80 ᳐Y;00S pB CX TpP\40S$0Q0 00 R 0P 0[ 0 $0L 00040少S,04008<0 $P9PX40S 48,00`00 00 0 P)d0 0S% `0[$0 h0`S,0 40i 0B8#8 X@0:0 H 0( `ഀ0000 000tЍ( 0d d0d 0\L 0!H H0H 0X 0pSDO- @T1T@0 pS0P`@D%P C BP( [  8#8R40 0 S(!$10$10 10 0S0㗚P 0 P0S 0ᇚP  00S 1$10$1z00O-M@YP0 00X00 ``FV*hY&hz |$  t$ l$  @0ಠ0`0p00PP Y#```0S S 1 !* `p0 pGx'x0H00pF0F000 B 00p0@000 ``FV&*hY&h/ 0 Vp 1 !pGx'x I0`h&h08#8አG0Zp01`:0 y02"0 hY0&h0``FV*hX&hZ 儲2 0 00ಐ0X0p`00G00000``FVG*hX&h7 V 1 !8#8Q0C8#8 Hp pGx'x`0`h&h8#8ቐG0Yp01`: 0 `000SL`00F`ЍЍ00PP @0 0 ?0 0 k60`0 0 b+0 0 e!00 0 hX&hc t@   d L ȗ (   x  P $d G-0p`@PR"  0S00 0U@ rT; 0PX BPR RQ00S00ô0000 0A8#8R0 BY001 *("(00 000<UU800C80h 剐BY001*P '< <0<  00 0R0ಐx4O- @`0 T @@DH( $HR(P.X` 0S %ዘJPP# @0T @@DH( $HTpW  TP  ܗPPPA-`P@ T0@ Tp Q Q\EPTG-@P `R  R  Q0$@PR#  00 SᲀR; 0@S \> R0 P  0 0(!S$! 10$1\0 P 0 㼐ᲀ@p 0p 0 S ͸10@Rx ἐҗ'xP $10 $1(!00O- @1T@0 p0CS0 M@DP`!P @ ?P' 0 0 cP 8#8R0  Ѝ0 0S0㆗P 0 0Px000@- M@ Pp10 Ѝ0O-@MP 00 PH`pl  PX P0S "2  0D0Z0 0 @@  0 pWP0 @ pGW 04*0@p 0@000S  p0C8p#8W㲀Ḱ04*0p00ᴀPPP D0ZPPЍ0 P P 0  0 0 00 pT T0T 0L 0Pf}x @tG-`"2 0(M0$00w?0 @Rp2S:0JS P P崀2S &p 8 P ZP崀9 Zp1!pp BRK:0CS㣠:* 8#8X*:1!0C8# ∀! #(@F” 20 „ 2!1 0 $0 30<(Ѝ( 8#80C 00C!0 0 b 8#8X*0 pIP202 ᘶp    0  ` 0cv A-p@MPP`  m00 2   Q `:1QѶ0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E0 EP VP V$P 2: 2 0Ѝ00Ѝ0PU Q:(0 $P0PU`PA<P  =P 21 s>@--M0  @  Xhh 0 ST000S 3/  XYLh 8 80 $0Q/$$0S/x d<<0 0R/( 0S/( lA-@T 0SXp`/(XP0P@QD D0@ZP0 A/PDs O6&O-@$M`dK?T Bpܴ4$$0Rab    WpVBP b0@SFSC 4HXhx4  ;33 $$3 $ $3  3 $$3 $3 ($3 $,$\Dd3 $>d `fZ$Ѝ $  ( ,  C # PU! TpP "PXZ@P9`  R妆PxB `  p  BR pPG Q]($R0 U tWS UX,$R$ ^Xp4 IXp0 W$RD $pR $R !Y&@ $R $|Xp P$R& U Q R  T$Y&@ @ $c9  ` &@ T `   2p Up$R UMAXp -=Xp P  ^3Xp U@? PzW^W\>&/&L-p6&|6&6&t=&"bۮ5O-pMPc@=봳3#`@ @~>#|3pB RP!GP P( Xf@(hPF  H@ P$L`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X DX` `Z`r`T dPP   ̳`Pd 0)̱0V!Xq``p/Wp @P *% B R,HHHةHHةH$$ 0S U X ic0S X  R 7/ P  R A8$ N=  d$ E=  \ᑴP0S P~X UW%2L-/&Cxw,5O-PyM$I` vb<p000 00 5@p8 PEU( 0Ra S 00 0 ~vPePRP&GPʰYf0@S<DDLDD\DDDdDlDDDtH0@ SDDDDD$D4aP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0S 0ppSppUU PE0\U4ZU& ♸ P Q岽6P/[  0001V0SV0Sppp C C0S S/R <Vp0SDUa(0S0S 0 0 Up !} 0: S UH/[0%} U0: S0( 0 00J0PU   D0P0 $0P 0)=0P @/P050CS"L,,,$ `;   `005PP00S \~}0Sr 00 $  B R0\ L` V, `Q& /0 J 00 P@` 0P` J/R  S/R/   C  R:  ` 6 3 0S S/R$ 0RS & 5U0sX/ HL!R\0X\!R\ X00: S h C C `U0: S P1: S ,T : S!  Sn  Sf V S_ S L0S !WPL,0SK  UF0(尥 0Z =Z80 S80p1p!pp Q TP!P1: S V00Z0S 80 0CS!800 CUPR X0|S 0S !W0S !\Wӱ(SB&W/&œ%;$%05MwcÝtB&=|u 6Peu ?pO-P@ `T}:D&=p8464f@(F)XP60` V X0S0 '| `RP 9Y4P080540H`XP0%.(0@XP7|P0X T5T%H`RP8P H04 0, %43/00000P84 {X4a 0V0!XP (XP 000 000 Z@0D 0 ZP0; S @,0(D 2#!H8 01/,dP0`$S2`` `0Ss0 CS 01#S#XP0 0( ,S* B"!0 0 X8PH0U 03/p!0SDfH0803/p(^P`؂G0 d P`0 0 S * X 0 $03/0  0-Q3  R L4lY0 0 -1/ v4P0 0 0 0 `0d 0 `0d P0$ ,!2X 0,ؠܐPYZ0     00h0 l 0 h0l   00 R0X0 0013/t SvW S>{WXP\`0O ( /(0, PU`00 XP\`> ;lQWU/&v R'"b(%S'mR'5S'pS'  TS'0O-M MpM^,8$$H$ <p 0 Q 0  s0(0G@-P񟗙ꤼ      $      <         \h|  ȼ Լ  0  H0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S $zPU RnR oRP0<0,W`P  5P8y`P,CPPPPjt pSPR8S;T5PqaP<4 1S}H @0R. P`V@0S0H0S 0  [P P 4R㓥'F M TP3mY`, 0| ,0Sl 8 RS P0SPqP4PD0S $V<+0P43X(D`娠pXV 0PUc40S0040D0S Yލ Ѝ ℙZ mP <3 ,H4P(T 0`F40P 6QP ZPPT0Sw20P: SZPPP401!NP4L  R p P T0STH R 0 T0S$" rpZP4T0S1 bYT 8SQ # oWpVF   <# 0+ <# 0+ $ <# 0,(, <# 0,00 40 0 08 <0 0 0@ D0 0 0 H L0 0 3]P# P$ .XPWS'L- 1A[6&/&; 7 j5s@-0DTdP00000Sr0C?o21 9p0 1000C00S8 000-S3 0R2(0pP EP SP , (QNsP xP4 3"3 "3 "3 !00000C0aӻP=LI|FtCY@P4 Pd`mT$32S D#DQSQ\`PBa1S bVRmុPL2S$ 2"Q[h2 0S 000S 0gP 0^PvPN000!S 0  0S 000S ZPmP:Ua`0:E100S S tm!0`0001b Pg P a P{r r r&@2S.[P@`a;JmPW2SwP0"lP XPL@pP= 2S <0"D\U';/&v 6&&L-UdDV'7BX'58LcLxW'+5p6&6&A-P@M`/P@˿@P2 xxBp 8p=X2Q0=q E  -P f Ri Rk R3 0!BSQg NPb0: S^00 v!W8p10 ER!MpSvwPePLP PPp FP rf@P080HPXp000p0 0p0p0pp pQ |q3M yN@P0: SpGP q@2Z'/&5WT ,vO-M`Z|4MlrlPp@ 7pH20!1S U``$ ?NPj/ `[A PmP pPP {AZP !v~Z@ 2` |pᖵl000 00S NP"0 0MP 00 =/[` MP/  Q  T: Lp [L0S T* `[`Lp/ `W| /&5L-x!O O-JM MPeY 3rb@ '7p1 PEU[ A0S U  {=LiP fP hP f{vP00@000 00 0@E mMpP0: S(! ӯ P` ! Xu0P 0Y/S J>00/ `$CȰPE@Dִ0p/SP/&Pƴ0 S: p  ɩr{PPUWqZ'/&vA-`@MP$DX 4 0. MP  >L MP  4L  MP  *L MP  LpSl30h3PPP P$P( @30gP+( aP3( [P7( UP;( OP?P(  PGP( AP LP8$@Ѝ(P (3PIT"b(0S ($P(0S (P(0S (P(0S (Pq0S KP!0S0S 6p XŶ`PPa D1R`۳PU 0E /R .P(㲭PU  00,0/00-l00CSDLЅP0$0u00S ttE0s00҇?(6&QP(WY%T y-['h['A-@PW!2p` q5p 00S VtPsLP PP ڭ``߭P 7$ 0@yJW2/&p6&6&O-GMP`qWp1` `  35p 6Y.0S ЍfP WP! PP p `RP dP ׭vP iP00p `rPxPpp0p0 p$pq 0S!R  ,VGeЅPU iK$0P  S0S, 0ܲ0@0S* /R! /0)0P0 .R R .R0S[   00 0Q@  0P0S$0P`S0S@ 㔧pP X`᳨PP0S <8r50C SV<0$S P P>1 U00$ @41 0r0S $ ?RR00R0SV3 $ 1  @0SX  P Ῡ 0!0 0C0 IP 0S'  +0S 5S 0S 0SJP 0 0~ zX ͬPtAI%0Sm/P h0S 0Sa 0?S] 0SṧI0S 0?S 0SS 0 d 000: S0S@ 0S 0: SHP1 0S! S /o" R  lP SgI 0S JɬP 굿0S 0?S 0S 0S _(fW/&5pwA-P@U0`p a3p 0 R1 0CP@P~HpPp IP +PW` /᡾P 0S 0S0PHP*0W#/&5p@-PM ھ 7 $ 0HHPH@IUKITD0 00+HP00C/3P RP 30S S! S 3 Ih3 ! l3 00T30S  R 4#6 R #!SR33 3 20S (2 20S 0S'002@T$ 0"PA@}AB00CS00  0 D 0S60016 R0S 10S<,p 0PT<[001 10SQ 10SM('x1d1POT10S P10S l1 `1 0S  160S 8 Z@$1 H01(  x0S0F0S 00q0SH0S 00K@P`@Toe(W% ( (( ( ( (Cny %%(@%X (Tx G-PM T.b2r@@@0 S ݯX" 1pC 0 L1 0P|7x [HPd)`x SHPLy)H8 KHP4q)T; 0DS 00S8 0xL@yQ0D0@0 0Q)@0SZ L {PUpa0@S񟗷hhh@|FP `o@@L YP AP P 0@0 00 @L'L'0@0 00 0 ^dPL) D0S hx GPT(VFW/&/&-39Bt @Cht@Nt@Yt=&jL-5dOgtt@-FSF Z``: LoRPGPP! BH@ PXXXXXXX`hP dP fPvP$@``j1 0T0 00; R4 : lP @6A0S #S! d2 00 0 `PXL 0Pp#>. һ P , ނ p ւp  Fp n0S<0 0@0050C SR[ ὥ\@PW0S? 0n$ p,p  0 R qX  Pp P    3/P00 S '$ p, t pZh000S EW(%/&#L- (w5 O-M MP6^J^n ^50 0 5>^5005]<:00( 堰P  困pP  pVPQ nA@6P񟗹(8     ,t x                    $  ,8D   L T `p0WS }055050p Q/pQ Q 0X(tȟS SSy `m050505484 iP  cPG 7bط p;0"S mꐷ p '0"S hL p0"S P 06mp+0z0500~00v01w 00 0s0g0e0c ^ ^  ^ QS00 00055e46V0 oCWPE2%R U%RpUQp0%0;aP%5S 0EP80: S0550GSx0dl8,U%R 2' WUz05sUr74$04P0bE5p`&`qPP C\$iB#%dR%rTD0000 00CKPP#2 CC`CCCc0P` 0S #Pkp@*S0#S B%bD* M0E?o2? B `V4 FPP%f/學`lrV `P6Dh`Pn!>@p X:x\10  X*>X |R!>>!14h(S`>̂037  7037hp V7037p7 P 0 S 0"R S2S S 2S 2Sl 0s\, R>p@ P/ gP$4 f/RH70L7 ?STP'\@<"820,"(2 V&PPN0 0P UY"P`T {gd2S+ ?p\ ">00dX!\1 $\1X! 0 \&02T7,2P74P@0+ ^0 \  ` v $!p  ZY0d2S*'0\ l jP[ሱPL008 <04s$P 40 S8 *"<02#L SXD0 U[#0R,b(H"L2R0;\2QP 0A(h%l*/&+D(+uL-w)( ))D()) D())7 D(#5**@K(U6*H*T****+H(D(+%+/+rdAb+edAt+A(xJ(C('+>++0D(h%-0-1 SR Q  RQ!R!RS !14!8!ӋXs0 0?N%@,\&P 3!` V!0T2<<23S &2BS``2S .8$)0 2&P 3)1)/#$p'&P ``0`0"%,00!0`,"$? 0,! 0 `0("$(#%P isgS@ T  @ET   @@8谝l ? R%TZ! pZQ0 +0sGP s=A.pw= d'P=TT =P"20"0^(Px(Pldi\-,A(xJ(--A.,D,^,t,!,,6&0D(7F,m-f..O-MxU M-0@ 0h0@`0p0@@0 0@%%p0C000005 `V1 0CpP jR/P PZ4$04P`CQښ. .a0C 2 0c@k(L-=/&edA=/ 5Е =6&Xk({=Pk( 1%v<WHk(===`k(zd@l(=>>>g>O-`؁ؑQ@p _$p%W㰑 0S 0S Dp10`VA P h0S PH`V.Z ЍyPmPPP fP =2n0@ S$Th<00000000000000p?W 0 @P 2P|2P #9X@L-p(@/&@O-M4$` m:P! 9DP㔔唴8p000PPPt$#p3W00S 0S 0S 4Pp(4 a X' 0S00fP a0S [XPY30S ЍzPOPBP4 FPo VP@*Ptttttt tttttttt4|$t@ttttttLttttttt 00 ᎪP2  ሪP20{00 0bVp:o0` 0qP00e D jP00^ , 0 cgVPV Q000M00J00G 0mPV1 P :|a000001000-00*000&000"p 00000000P0Scl1VP2lW00S 0 (P`I%FlVZ 7 VZ ({(L-~(WW/&, ( ݞQWxWuW{WWH%WWX@O-@MP8@D딮`(ũPUPE10Ŵ}vPlP,HP8 TP3@ ` 8p@-  4Jqp@!0 S < 4<0Z@y `m@ P#$!!$$$!!P$`@" >"p,2 R Q!  R 1,0Q _,0P0S  (  0@P@GD00-SF 800$0@ p0@P?Ѝ$0pw1 4?$040P ?000R0Sp c```8mpW0S0S } 00 0@@`p @$@ P@\ m 0 3/p T7A L-҅/&L ` Ȝ%@-,@,ᰱ@⵱宱@(% O-@M -,@lF8 0gf`P8p^ (p #p _6 R0 8 l,/0P0T 4PP\80DpHP88F U1 vXF0G(G0``0 `IPHPU0 ;!pp 5pO005S 0(0,00(00 0HeP PPx%x_PzW`WNWU 3AWF CW4eP p  aWe CWe LWf aG Qk)(t)(t)t)t)(t)t)t)(t)t)t)t)t)t)(t)(((t)t)D)WWht$  $ RD -(K L J ~dO {05xN 3Vt V``C `pM nH l$0%c0!0 0  㒣$0S@* x _I 0 V 0`P p 00JpP kW {m0G S=H)&&&&&(&&&)b/b-[mϰPH0SI0SO005S* L㿰PO0S U5S5 ( йp0 (0S 0C !P ᐫ@P!@i+p``ۺp! ᢫P|! ኰPd! 0S1H!ߩ3/ 0`@  PL`Pᡬ'5,P1!\  HR #0 ዻpB PP 0 C  00 tpS%(%n%H(%0%/& ΙН%x%L-ž%Ӟ%z !*=G iHX) iui zm@-P ^嫯@ů꘵ (tp@-D@DᚯP៯@(嗯 喯ᨯp@讯ꠋ(D%p@-D@DႯPᇯ@( ~ᐯp@薯꼋(%` A-|@|p `(Pg,dj0`g8P@_@@4Y0ZlaApԋ(8%' 'G-`M4P~VP5P0 Tp) P5\5@P L5HH2<"0@<2P 44{ 5 Hp HQ j5P  a@1  p00 @ pw0 @q m080<0@0D00 0000P0 0 80$@0P  83 HL@P@T@X@\@HP H㼪333 0400,0( ,00@@0PQpPPUPh0PP 0/`Ѝ聭2 8jt9˭ԥ%8@>>==(O-0Mp㬖F(00P6`p0 dpt6Z0PE `V0S\PvPP@`@0V|P 0SЍuPfPFP RPg hg@P,32222232222T4223k0P0 \0#S P00 $$00S $ $$00S HApP p\0#S (apP $$0(0Sy  $$0(0Sl00i0P PF5q A5q <5 4` @fE[w aW3CT30 @ RI0cS pS< bSBJJPEU ]0P 0U8U U,P 8 80,3/8 RP cW Z@@!3Zg 2P R00C?o20S^ qXUJ "[넩0 $0 07,0$00S XU 0H 'o0S 0P0 00010S=1 0S 0h0 P 0 0 Q0s  1000,0 0283P7Z @0 $  u3S2&SR @0 #  g3 02  @0 R T c2Pq(00s  V2pt0 @0 ?3Z .L-D/&$(5N:x^~t=&ǯO-P'Mv M@`$P&p6 @D 1T0 T( TZ|(6SPPhfd[AP? a@PP񟗙:;;9;9;;;;;;;;:;;$:;,:X:`:t:5P50S $PX ZupPp%000PpP|P @wP 0rP3P.  P)p bP vP( Z}p q%IPq/Z00 00+0 00$000 P @jU`P'ݍ Ѝ (PP(Z@X  "p2 P /P( !(P( (}Up@P `P0 0Pp(`Ȑ` qHP 00 00$00 0i@P nU@P  0U@PfU@P (U@P pҢP ͢P ȢP !jpHP Z  P( (p}p` P( !qzH@PT XC Pq=y0p`)0S B +9 /⮦Pm``N 0V@ Sr0 0O0p` p, 1PX00Spp0 0 000$00 0e( 1p>0<00Pa0SJ+S'- 29S!S 1qWx 7/&D e0(L-=" O5fL'=zd@edAp@-P@=Ap@-P@=p@-P@=@- p@-P@<p@-P@<p@p@-P@<p@[O-mMR~p> 0 p@7p>p?a0S@>D$RL$r R  $t Gl00<4A @0<4x00 <$0*0p M <4 D!@ 1x/`PEB@D4TGlCCCCpICC|ICCCCCCCCCHDDCDCCC`CCCCCCCDECTEEEEFFCCCF4GlGXHHCHCHI00<@BPl< $y9Pt xx U8< l(< $$r $d0L@"P; $0 00 0 <M0K0(0 0,;0@= 6X; T;$40l0 0 | 0 ;&040!0 H 0 : 00(0  0*:$ 00!0 0 t:(00!0 0 <:,0T0(0 x 0 :0 :@90S  P0: 000  !00 0 n:00!0 0 `p:0T0!0 0 R9400c 0 X 0 D: 00!0 $ 0 6888儈@0S C.0 EPwWEq1P0@4j *P@d 8(\W8@臟PD40 lPD40D4LL G u0P 0A 000 1 1 7C0`7@ P00(|7 000   7F:PwP/rP dW0ST 0T40000PEU UZ RZ V0pPQ 4S<4Z H4L$0 R.p4j?HL4P4SH$L4R0hd& i-pTP B R.p< < 4S@00TS $EH?!HHLX00 $?4XLH ++EP+> V k@LPl%;PsKPPP%PVR.p P1: S$%(6 $R -@P$,NP$  Kܔ0IPXZs4S04>080$p!t$ ,p = h$0JP$0 r04 P  P $(03}p,p40S0X44S@04Sp2S 2"0# )ўrP 0T40S ƞP 3P#0S 8s?T4S\ᵞP L3 2"Gp2ŸS H$L4P*pU0 L4H/0#! 0N[pD2 C  U0+ up㼞t   0P0P, !L4HϠ0# 4S 0.?X q뼀04$$ST RQ  X  0+0p XR001R04Qf ;R040 Q$ Qq8*mH(+ֽ*/&ɿۿL- 6&/WJ!nt=&F¾Ц%ƴӾ`  "(0@pwP()Na=U(X p|d  , > :Nh%Day!O +HL4 Q} QQ040SVR0V 4S$HhP 44崐S04144 0S @4S 0 R0@4,4S $4R#1ѣ1,400 0hUu x+t t+0S jp@% P' 0!dlP->]ItP;.X R04ʃ1$4Q :$4(+ T4S% , "d0l'-+7+5+3+L,\4$@1H4`<$D1x00@ 0+pl&P>0Z IP>0P  4p  T4 | (.04 .O-IM⤹iM0p4, pP_h9`4pGs04WZ `  {Ya) 4S<44S $$4R0(*p  `,p  4 SP,0S x$0Z $tZ0 0q $0N P$H 1Sh  $$4Pa*`SZUCU9DPEU\WxVYxVxVYxVxVxVxVWWxVxVxV XxVxVTXxVxVxVVvbPEUUXxVxVxVXxVxVXxVxVxVYLYxVxVxVxV|YxVxVY6 ( '8#80( R&0C RI ("(nS044s04=0t0 0 0 Hp6/00!.0u 028PZP ̌p ZPUȌp 刀ppPt +@ ]NUpeA2X/&W\)D)t=&)J/Ш)D)<])~)p%%\ )0) 0@ x0@  0PUhPj 0C Sg0400000,00(00$00 0000000000 000000 00y[ 0p4RE PPH&<PWE &cm(8; 00 L0%p,8; 00|L0 %p8; 00L0 %p 8; 00L0 %p@ pHR  |0 x; E0 y;z+Z0;0; ; '0cy;0z;(0x;+2(bPAPL0 Y%PU;"0#10@00 0`K`QH  `   `0 5%P|1K0S PPK0 (%P$ 0  003 %Pd x 0Ss D&``0 %P4$`$$nP0d!2 (100`[[[[,Q0Q4QPPPP嬚Ud<;SʜT$>@ SQz䛟{ k A::˟c$@ 3AQVz{ k A9I:`"2RgdD' p{ @`30S 0 ' `@MHIN2 X0弅I#pU00 @+0@W0 00D%PT2 KppW O P(2 c$PG^AQKW[$Ppjc1{CA{7ZA (H{G@8HINST{X({*#@BT7 0S3 r<%0T0xPT00P0p+t"P 0S ]s$t;<000[ Y0 0 F|\  ,%d2"SS% 0 " $@-C6?8~A@@`)))p6&)))!&6&/)p%< pI1 @S= 2R`" B8#<48#8Q``0!TR?LTXd%X0 0 0 d20ҋ "  5  `ₘ`W0l0hdR?phR{2{7@{{{{{ {  M 䂟 3P ŠU h2Y0Ph2d@ g P   hJh 0Y 3# |0H #$$<0(0"(002 0BS2 (S:; 4 0;v$U@P4P0đ#1!(0H0C8C8S ! 0H 8(#8L"(W$ 0 $1币;    0; B$ 0@0 0 U|`0H #$$<0(00"(@0P0W 0 l0 JD02^D0P#<0[^U )p%Tp6&)D)`)Oa:Vs4  QZU|0H #$$<0(00"(@0t 0 H0D #P崀崐0ZP#0  #0CSz |0|~~||$}H}}}}~$~H~l~0 Pz Q=L{X{`{h{p{{{{{{{{{{{{# 0#!#0닟P@0f|x0 P/ X0 P& Ql||||I#P<#0 P 0#$$0(#"(!(#0 ~P #0 tPh 0 kP Q Q 0,q(o0 YP s0 OP 0 FP 0 =P 0 4P 0 +Ph 0 "P D0 P  " 04 00Sk ES S U|0H #$$<0(00"(@0P."H5Kbrx ?a )MWg{)`)SIZ0KUI7PZ"DDD0J0ZD0 I)0K 9+ 0K2 @ QJY0KUD03 +Y H\P UD0 &"D0J C 4 ḛ ŕU)\"PDDC 0C0U U0@0 B "00 00A 1#P10C0 00A00C 1#P 0 00A00C 1#P0 00 B 00C2#0Q4qpy 0P 0PQT).@JZp3V t`(os`F P% 0SU030#:U %5P\u P L 2; 8sP&T6K/r0 3PvTS0 0R/# G@pRPE X9 Pp 0 0<6S"46S" 02Q" H201\pp16S `,d P W0`W  0&P  up!EK/r0V ,6S m/APP OXp<6S:46S: d1Q0@6D&Sx1 0 00Rh! H& RX! $&PRL! 8&R@! 0&@R0! Q(!   @]    @@|0P8(*/&%L-FNg#ex*D*8*t=&6& ? =G_bb/ A-PHMp`I p10PEU* HP h0@ S SĩlllԩܩllllHHIIl1嫫d1T1 P1 `q< z3P p 1 !  qqkPP > Lp$@@@(@ @s +JP PX0S PxV AP X>0 0000 /&L-%=/ *5jyt $Ct -8G-0HM`p01",S,C, p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2  a0@S\````````<``L\````l 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTvP =V ДY 000 0$HЍP PPp  =0S  30 k`PCPV qh V `F0P XP娔0Pl Sh 0 jP4:Ty P: h(q`P9 T(X(g< c0P9 h(e40GDS4ܽ`p 8( dHԾ,Xȿ(48 (V\Sl8 X(T(NX8 ,J8 8P 00S= 8 98, ,, ,07 ,,7 H((Y$8pY7, |7 L(7 P(w+t P :?@ 074wYpPP78 7 T( X(`7 6<(L7 6P 00S 70 7 6P 00S 6 X6 t(6@<6 ,p s68p`Y뜖08p0 P 0S<6d pW 8p(pJ'00p5 L(54Y`P5 `(d(<5 uU$5P հ@ y5?Q4IGލЍx5|t ,|D0\<<^{0P 0S X h1Py@PxdD8SQX@4 X t DP=s s7{ I1{ tI*{ tI#{ xtI{ I\{X$TIP{L$HID { 8I4{ ,D(IlT MDMMML 0S0SA  )9@288S2@P R<S P 0S sX pXH2 uN @+r P: B?\ 081<Skf+xr P*L㼅0:wP 0VP t8@PW|Lt LpJXL@PHL@ L0@`,riwPP0@P`p@+lr0(@0@000,`40 U0(P<P8EY,8U0C?o20SP ,R `0 ,0S W,8S= h,8S W+ J JJJ-J_8(K-K7K)H yK6&p6&WL/&~L[ " KpK~KL-h%K&+w6&KKlv<KKL-L(L>LCn!O L7L7777L21LI[L7L 7 @ LL*+$ LG-P`20E8h-P03cp2S l  P[7Uڛf{PH t处 9PB/PE0@ *  pd40pEWQU H4 000`vP$ L,qPE0S#34# 3 PWTQNBdP 7vP303 v`pp hdby`3P04jPg4S @SDgP  ,6[ P 4SqR2gPl l z PnRz,`p1<01 1> 11bG01/΅01$10f-+)4߃#(2R$$Iip`g Pd Q18C8S Pgq\q܁ܑ`eV00l  B/o" R +gP  \Tf=S` 0 0000l f18C8S+`#RS S=?o20 S Sl f18C8S 0 S ` S S Segx+"_/_V_C_/&t=&b_+_b R]a]p6&_%e%__++: "__5l=&W"V@-@`ᓃP~P1  q pt10SAPX1PH nD1CD~P 4~P1 nPbP9P0P 00@0c0@ S VP s l0 \0  L0  T TT`X lnn0S+\+4f/&&%% 56&fA-`Y  0S%   S`0S   Rڰ1\0 1 ,0,LL,9C-t=&8a/&_#3 %%%L-HPWH-ht@xL,x6&gtO-@LMPp`@ p1 UV Pp ^2gP uP GP000`0S@0T PUP   p !>2P0P 0S U'2. p U l p T p V I p|2PU sP TutP@P 0P@{1 L-/&5v<T =G9NO-0X@0P5P%@L5M@D5` <5bp@b,5b/$U$:~@T%05%U5%5002tP]塩oP P PlmPC DP3 fP5 CP6 tx兩pP7 rP p.;<( P00: S0S00/k`P' p{pP 00SW p3 3 C>@00ꌣ匃匳phW tt =`P \sWW0 @H]4P( vqP q^] t~q~n~#Ik, @p(@PWP,1@40(V,@q@P 5H b=00,2"| 2,qPE1QW @if:1 Ѝf%T5(40S6 4P(pUw@P |0 0U0 0 0 00 pP ,p~(z40S(syw`hꈧ,Ь,,,ج,,!^,4, ,,,)H 6& /   ,,,) u L-,}LC-4, l 4 ` ,Iiܬ,0,L,T Đ  O-pKM`E`T0 8`0 ` pPJ5 W_Y  pP :0(]Pu ` 0!0 04QX 000sX%X Jp2P0 0P` PPbPPD A sN ! 0pUaUbPEULzU" "!0  0( 00 0`3T 1 L 0u$300q`o p00: S) 0V0[0S3 Y   `P<  (-P (v  vPt( v(P\!Eb`PP ( (?,=JVG ,(1,/!0.P5 q/$ | P"  P}0S чt I|0S ȇT0 0/X0 @p 0SS RQ"$0p0|0S u@P0㙇 [| TP Pp``-D /&5p6&ht@-E E CE XE L-D D D D E E (E E 8xE jE O-0MPpP00@wP wPBߍ*.(8{1?X1|?@0/201 2211$B("T122hpTapMZpnE&kN d10. 0>cp40G 00 GR`18`1h0( G1!1pQlq姭0 (9@Pxd1k 0> G0R  >00.+( `18`1=0ZSVPMP 6PR ?PI 4P꼝N@P񟗬x(4@fP j@PP񟗛l,$=0X1h =#hf`}윟zd1f3d1kt0000n0d1i\ s@cꈜ`ꀜ]0 (PP d1~P Z0$P]( S0 GR(0 (⛪@P 0 (PΩ 98l&h(00`1(׊p Ι(1S(P 3 (O(0({:0P ~dA@ @0 Tp  p 垙( d `1 Q 0P819: `1d! @Й`1h* ` p@P |wP*$8 %`11`V lPPZ: )Z90) 0)0+(d1 (⯓yPzP NL |z(0 09ܖp@p  X () 0S` D PQ z0S (`!d10d1808"/0  ?`!2sH8"/0 12`!s"/ 'p= `1XҘ (3P%<崘`!d1 0d1(008  p 138᱘(MPlw`t(007 㫔pXz0S x峘`aa0HXJz0SLCz0S ?z0 S `1d!8 0d!'zp/z0S &t剘|p"z0S &@|( P q( rpzm|K`1 I 0 S;pL9 _p5 P 4d1$A>d1 0T1(00T6 8pwdEs$0 T1(00T5 'p 4[p  ^p P d10d1Kt$"嶕9\d1(@0d1c `P 8 ߺ`1 P40 (ۈpX `!d1$ $$ 43(ⲛp (܊Sp(004 ʓp8ח!R`14`11(|P+h(v!ʚ0P!  R!00!R00SRd14(O`1 ꈃ刓0 Q01X: (ⵚ(⭘`1 (/1PU3`1d!( ; V A? =((⑧1R@T 0S 0 @僔@ 0S  Ḍ 0S P`P P ( RV  R   (001S0 S   0凗PUQL|d1@0@e冕vhd1 #J J J 1!N N N h& iJ hJ 2!/&WN CH L-)H ;H SH N N 1!Q F @!O O #O jKT 1!22O HO O O O dO Q O O O O P P #P 8P ^P uP P 5F P P P P J J J P P :P PQ jQ %Q Q Q 0)Q  Q/0@-0t h P ^0`{/@ 0 0$010XWp@-MdPP@T ЍpL `0 0 0 @c 0 @cqHH0ƒ S"*0@- R P@ 0\ R^D00"@80 0 0^ 00"@0/pppp@-``A``1M@0``H! D1 0 0 0!  0 Jc QPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp3 @TdX2 \2 H,t2 @-M @+Ѝh  Q/X-M  0 p 0 S 0 0 Ѝ /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/):*/=7*/4*/1*/".*/+*/(*/%*/"*/////^*/*/*/<*/ */ */*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/, */*/ */*/*/*/K}*/Wz*/+/ju*/Or*/ho*/il*/vi*/f*/ c*/`*/]*/Z*/W*/T*/pP/< /!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*/*/6*/*///*//7 */>*/4T*/@-@lu@*/*/*/*/ps_strings missing %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)ctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230516NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:inN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.12xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32gamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.0.8--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.0.8 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.8 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLchangingaddingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenIPv6-Only Preferred received (%u seconds)reject invalid addressnot ACK or OFFERdeclined duplicate addressofferedignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d 'gXt0:` m(͌pvy8}3! H``+4X, , 7A D!D%.1  8@ƚ8@, X@Ӛx@@F'@@@@}! TS" ^axd́ ́ Ԏ$W| h .Y"(E \%\+\D2DN7<h* CO pushdnepopdneshP@@<<8@@,lUj H ¡Xȡ@@CR@@Ρ,unblock and -DNO_CONV? `<0|100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink9 E [mw--EZ"8#B B_T^TFT<T>i?|PATH= e t fdscml r O pn#v +b    EOF reading here (<<) documentd  %*.26;@rDIPW^cksy~<o |˫_ 0 }-+?=! @! @CgOFILabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'$(0|(1h(1(8(0&<(0U(0\(0c(0lLb]f Q ^GJrV!ufNg sA :* #  Rr - Ε%8  ! kg                  YT |ǯzO p5 !Б/LTD 20QxK~ 4 4[  + ``!D+ )5,5L0WX4-8в(w; # _ IJTB~I{O&=YWD4u} ŒR H + Ӯ * ~ mo:& x<dP>k< {<p <.;w<<$==i >;"8 >,=?]< <{> 0>>#3 # 3233#8? @@Gjr(z0 ?@F8M`SZa C$CC$C0"@@  @   0@@y@@@@@@@@@ @@@@@     Q# * 0 7 A I P W ] i @p @u z      r               +\m  +/Kc   k7      }    ~] g g% w~8   ( / > E K cR W 2_ 8d m x  }   g         qy  )2=FQV]birwc   k7      }    ~] g g% w~8   ( / > E K cR W 2_ 8d m x  }   g         c   k7      }    ~] g g% w~8   ( / > E K cR W 2_ 8d m x  }   g         &F$.../!/4/[// / / &0 B0 d0t00!0000 111E1Z1p111 1!#$1&1213451681929 2:%2;?2<]2=u2@2A2B2C3D'3E=3FR3GR3HR3Jh3L3M3N3O3P3Q3R3S3T4U4V'4WA4\K4af4cp4d4e4f4g4h4i4p4qstu5vw5x+5G5X55555556%6A6a6y6666667+7C7`7p777777778 8 78=8P8_8r8}88888:8899-9=9X9z9z9z999:999:3:Q:l::::::;,;b;;;;0D ;m;;<6<W<z<<<<<<[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]" , ' ! , ~8   ( / > E K cR W 2_ 8d m x  }   g         returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockl l l l         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-xˀҀ'PZU ~Sބ&:H%% %$%<%T%l%%%%ԛ%%%%$%<%\%|% ~8   ( / > E K cR W 2_ 8d m x  }   g         F$.../!/4/[// / / &0 B0 d0t00!0000 111E1Z1p111 1!#$1&1213451681929 2:%2;?2<]2=u2@2A2B2C3D'3E=3FR3GR3HR3Jh3L3M3N3O3P3Q3R3S3T4U4V'4WA4\K4af4cp4d4e4f4g4h4i4p4qstu5vw5x+5G5X55555556%6A6a6y6666667+7C7`7p777777778 8 78=8P8_8r8}88888:8899-9=9X9z9z9z999:999:3:Q:l::::::;,;b;;;;0D ;m;;<6<W<z<<<<<<SFH0eCޏ}8SFU0eC Hah!IdontNeedEFI(s*K>;\0 |nQn- q+|nQn- q+#-|nQn- q+:C|nQn- q+T_|nQn- q+m =rGy=iG}q|;Mt?mWC 3KOOyD<#*=(3Dh&ǐϐ\ M}-@Mjy֬-чH} &-чH;ZIчH, UIчH' hIчHs2IчH8L6 %?aS'@ )Ѹ*1@ )Ѹ͑ 1x )Ѹґܑbackupstore_gptstore_tblin_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapssetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatuscUG printallmaindo_setifpreferencedo_setifcapsgzi%yyiQQQ0%2l%mvQQ0%i` H%'c %*%=%%j0%ݝ%s0%}P%P%|0%0%ĠР ܠ@   )02@;DIY m%N Y_ e@UG init_current_mediasetmediamodesetmediaoptsetmediasetmediainst3G>3I[ cU>[ 3[ `PX@PX>[ Imedia_statusmedia_constructor '%, '%  %* *%) ܢ%H H(%paddr_match4t t8   tltsettunnelZ80%`p%print_link_addressessetvlansetvlanifN%S%Wsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchan'*-0sethidessidsetapbridgesetiffragsetifrtsV%U-0%]x%\]l-0%%<* 0%! %b%h%g,0%"] H%"] l=* 0%T %MȤ%~<;ۧۧp;ͥͥ#invalid major numberinvalid minor numbertoo many fields for formatffs@ ͲֲubH " " @" " " (  ߰2?Uf @dzճ@ " , ' &+! 4, 9k" =Amƴ"  ǯ" Ѵ߰  B2 װ@شߴ bnorripbgensbextattbnojolietbnocasetransbrrcaseinsƴ"  ǯ" Ѵ߰  ! @! B2 vװ@" @ƴ"  ǯ" Ѵ߰  Ͳ ֲ! @! B2 " @v bH װ@uƴ"  ǯ" Ѵ߰  װ@ƴ"  ǯ" Ѵ߰  ! @! B2 װ@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorƴ"  ǯ" Ѵ߰  vB2 װ@`eH[ o u@~g  8@=E *09CM X@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvB2 ƴ"  ǯ" Ѵ߰  װ@K-Cv$7XSz%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@BC'F3ILLVNcOSabcefh(i4k@mNn_onr}su@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp a` @  $1м|^t0 Non-system disk Press any key to reboot xdl`l\l|XlTlPlLlHlDlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYGZs 3SsAaUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_print!P!0!!0!!0 "0!"0'"9"0F"L"["i""0""0"""xx""0##0##0#,#0#>#0J#]#i#0J#v#0##0##0##0##0 $$0,$B$0`$h$0`$$0`$$0`$$0$$%0%%0*%1%B%||a%0l%0s%0x%0bitmask_scanaH W!^!c!j!hw.disknamesfetch_urlGH$HsendrequestrecvrequestWMNQNUNYN]NaN***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]aKs$ Os$ : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataW\   O X,  , W, W,,  , , ,= E ,b m ,  ,  , W˪, Wʫ, W2,  , ^,  @, W, , ,   , & ,2 ,? ,P  ,Y . ,g o ,  ,  , W', W&,  4, . 3, W2,  4,   1, WO,$ WN,collect"       ~8   ( / > E K cR W 2_ 8d m x  }   g         NAME=! ' 9" mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds~8   ( / > E K cR W 2_ 8d m x  }   g          edit_fs_type_ext_ ܎ H H H \ ] |k k 1LH d8I t(I edit_and_check_label ~8   ( / > E K cR W 2_ 8d m x  }   g         disklabel_freedisklabel_set_part_infodisklabel_write_to_diskhiyج  4 @  H 8 4 4 h ث l \ @ Ы ȫ x ` H disklabel_change_geom!!&!P-!outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default,,,, ,pm_from_pepm_whole_diskgpt_freegpt_create_new)!8(ĭ ``аܚT 8TPГh, 8ǐǐ\0 \0 ' qޏ} ͑ґ m!A xˀPU ~83kA pA uA , ' xA ~A 2&A +! 4} A |dg9k" =AA ͑A mgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eCޏ}8SFU0eC Hah!IdontNeedEFI(s*K>;\0 |nQn- q+|nQn- q+#-|nQn- q+:C|nQn- q+T_|nQn- q+m =rGy=iG}q|;Mt?mWC 3KOOyD<#*=(3Dh&ǐϐ\ M}-@Mjy֬-чH} &-чH;ZIчH, UIчH' hIчHs2IчH8L6 %?aS'@ )Ѹ*1@ )Ѹ͑ 1x )Ѹґܑ7 C C C 85C x AC 5):C C  D D -D mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new!!.!.!X(8\p` X@ `l0pP`|mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************WMNQNUNYN]NaNcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump233dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2023 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionH b`cm%dtueS fY g]T hT ihj kY li` mY noY pq|>rY sY `tT uy%vY wzO xY zyY AY BY CR DY EZ FZ GZ HU I2JZ K!Z L ;M*Z N0Z O9Z PFZ QL S# TNZ UXZ VbZ WlZ XvZ ZF 1Z 4Z 6LZ Y |ߪ~Z }Z Z Z Z Z Z Z Z Z Z Z [  [ [ [  " RW $[ -[ ` 6W 5[ =[ G[ T[ ^[ o[ m[ v[ t[ |[ [ k\ [ [ [ [ [ X [ Y [ [ [ [ \ default_configread_configrt_compare_protoxxrt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtPPrt_buildrt_deleteXXsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init0V` O ]` g` p` CT {` script_buftoenv2o[ #Z v[ N` make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osݧb b b b b b if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leaseread_leaselog_dhcpPl [l gl 3vl dhcp_bindl j l l Xb ,j l Qe l dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa u u u uttVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B!p y'p ș-p 3p (Up HMUh9p ƴ^p Ț?p BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Np |=&Rp M!U![p Q!U!!p y'p -p 3p Up MU9p ƴ@^p ?p l"h"d"!p ly'p -p 8|3p Up MUH9p ƴ^p ?p X !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstring_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_number_alloc_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_reset_locked_prop_dict_keysym_put_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equalsprop_dictionary_set_prop_dict_keysym_alloc_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_equalsABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_internalize_decodeprop_data_data_prop_data_internalize_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_remove_prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynameTLS allocation failed, terminating ;Zx0Nm<[y1On%s %s%3d %.2d:%.2d:%.2d %-4s %s %s%3d %.2d:%.2d:%.2d %s SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesortsetup_seekdir_unlocked_getdomainname @_strncasecmpcreat_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEX$%-X--.$  N `'h <        `         `                   $  ,  4  <  D   L   T   \   `   l   t   |    <M xB 4 < , hd H0 X # Xx@      L\  \@ # \V  ` d < l  0z  h l p tx <r x|   J ,, hh    XX X X&         Lp .    _     \       (  0   4   8   <  @  H  P X `  h  p x     0  0 0  0                $  0 8 < D H P X \ h p x |   8     DH P HLPTX`dhl`ptxt`X!\!9 D!!!$d!U| h hh h h h$$h$($8$D$X$h$h!!!!!Xgntsp0d*(rbmnH'&%T&&tcid;ABPED:994:$: yekdE,A8atad UV@UloobaLbayaragmkTfleh5t555555566,686X6d666 66 66 66 7U 7,7P7\7t777777h7@DDDD D(D0D8D@DHDxPDTDC\DC`DhDlDtDCC C,C4CDCLCTC@\CdC<lCtCxCCCCxCCCCCCCCCCDDDDDP!DDDDP!(G4G8G&D7&- ;&`;&8-Le%C-0L- 7&C-/& HZC-TpB<pb-hda:&@H-Dh0&P-"-t--T`-lC-dC--!x8-pl=&e% /&`C-tC-C-/&C-L-$-L--Pt(;&0/&8-0-YC-m- C-1&lt8-:&t=&pC-hC-C-d<&L0&<-C-tx-h=&8-`"H-|C-X "\8&c q%t,>&_!8&C-XC-6&\C-%z-L-xp=&pU(>&|$%R& @T'HjPX%.~ gbrjjgc fzhklmoopppqrB2 u! tv7_wwx.x(E z+z#BCNJ4O>PMSTToV V_XnZlZw~   <(t-dvLt-x@tltX u(|||\}Lt|@tltX G  N/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin (}-+?=###%%%}((aEVeFI7_iLlmC" n'f.4p;bBuJS^q"bskwhvVVx(@=%%d |9p4sDuo)rw]fr>|r`rڨjHqq= А&WWW8%/WXp> W$8AZak|.x%._ > ... ...PNbSb+F P%@wIwxlU %xgZ8%-yy ]P%@@yHh%W%@ςS%@[l%@W  ̛%@%@\%@؉!D%؋/E8%JIJtP%@z/Dp%Վ/;L%@% Ĝ%@i PH@$ 0%ȩ %AabCdhlNsuvW:w:zP%X%`%h%p% Ÿ% % %< << ]e< Te x%<< He ҟD%,% l%l% %|% %%$  %$ h X8  %$ C0% L%$ 0%R x%$%%%$ 0%U H(%$ %U H(ܟ% ߟ%%%$%%0%(%T%x%О%%ܠ%%%%%0%%X%4 ݝ0%ݝ T0%2=2 0%== .0%*$ Ɵ%U H(H%4 }0%} T0%2 8*0%=, =0% =, 0% , p'c 0% 'c , i` 0% i` $  %4 0%4 X*0%*4 )0%, '0% '4 ɡ0%ɡ$ `X h% % 0%$ N % 0%, 0% S$ 30%x \%$ E0 %4 &V0%V4 $h0%h, P$M0% M4 #T 0%T , <0%* , l="] 0%* "] , l-]0% ]$ n0%! @ ̥%8@K DFDFGE$GDF)DF5D40   '@@ƴ"  ǯ" Ѵ߰  ! @B2 װ@...... ...... lost+founddA.##. +F %  Z  mv+     .  2 6) ; 2W A 'c *J  S !Z "a #k\ $j %n &u 'x (E) *L + , - / 1 1 2 3 45<6%H6&! * o!v!|!!!!!!!!!. (prog_root)``  -7)-]fx+777771[77 ` P ` r 7` t[ ` 2 ` ` 1 #` @A -` P1 7` Z ` ^ ~ ` G 7` d g` X ` Z B` (^ m%` E mv` H  ` K 7` Z +` hA 7` b 7` a 7` a zO ` Z 7` p 8` > Y ` (2  ` * ` C .` ; )` pE + ` A *~` ( 8` Y ` P1 8` H ` l 8` k 8` T ͌` K !8` f (8` tI ~` uXR tXQ pXXS |XC $XH CX`J +X`J cY= .$Y> $Y> 2YN MYN sfYM ?sY\f #YpN *~+E`FP]c8al s]h]+ !"$'(+-.03569:0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ\%\%\%p%p%p%%\%""p%%%% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<Xs^scsgs is a directory is not a regular file (use -f to see it)%% (v$vvvvv"v>m%vvճv;w 47w w !w /w#x Lx+Zx,lx-{x.x*xx?xEӮx/x/x'xFux vJmvUճ `-v;v @v4!fGvEyvQvvG Yv hv tv~vWmkRkRkYcWbkCkc kG ky wb YMYrWcaP%",ҀbH%@H", 9YB@%L",xc8%",ȁd0%h",50%At",KgD(%( |e %p",f%@",ׂF%l", 5g%!,Yxh%\",Ճi%T", 1Ij%X qJ%!",k%HL %H K%",„L%",#m%|",;HVn%"P",byo%Ȍ O% p%H( P% q%",r%"D",(Isx%!d",׆Sp%!4",th%đ T`% uX%x",&PlVP% wH%" ",Շx@%( X8%A,",$Iy0%X",g~z(%<"," % ӈ~%!$",܈?%4 #% 1%A(",=M%",c% ",ɉ%",%(t O%!,c%!,l ׊%!, %!,?`%$!, {%$!, Ë%!,%!!,&%!!,L 0L%!!,b%( Œ%!!,ьx%!,p%!,Ach% `%!,P%",ݍX%!, 1H% U@%!0",k8%!,ˎ0%!,%N(%!,e %!,0<EThHqKzѐݐ &28DLZfn*~x~vuƑ֑%[` (4@MYftv*yKɒ֒n#, (press RETURN)!o!!%%%tags643{}abcdDgGhHilnNpPqrs tw xy !:#=tB,PB,-e^H-i^C-k^UKD&&$X t&j $ 4&W&I W&(l W &4I (&i ?i 9 K Q(K ZDK HN $N M Z lY k k J Ri O N N N $[ Y N T J SJ pJ àJ J 94J QHJ Z\J Xi hi Bxi hi i O O pO LO Li P O O |k k l @i

s}d)ہ 6K_\l{$1:I^)jv ]Y Z%().8DMb9NwC[,C=c;Qan\wJ~" 7du8'+5M (0CdxdIJ+ {ճ*''2bS[0D _p{Dn7K@ty5>+5A]y]v\C e/EPqXX;_T[@{ha[ 1F;d |  x$ F V l     u       & 3 ; E J T ] n      r   % + 2 = D K T ^ o            % 6 @ U f x            & 5 I U _ d i {       d 6     & : R c k v          Q  . ? M X e q v  ( M 6         . i     8 J @     % ( , 10 % % & % /@ t , <u , " - , , U; , -  - y0- - - - &- 10.- &U'5- (>- )E- *m%+J- ,R- .1/ftp30 @" h?, 9, , >' @ 8, , , , @'P 5=إ " >P 6? P @ A BM3 C  D  E  F  G  H@ WX0 W , ( 1t< 1d t< e8 s8 8 8 8 8 8 8 8 8 8 8 9 \x~[7\ [<9Q b 0v T WWWWWWWWWCp p p p p p Xb p+p p Jp A j  p p p p  p p m72p p p p ,j q q  q dq q iq  q ۓq vsq jƴ !q !2q "Aq #Mq $Yq %fq &pq '{q (q )q *q +q ,q -q -q .q .a/pr /0 1q 2q 3q 4q 56q 7q 8q 9r :r ; r <r =&r >8r ?Fr @Tr []\hr \xr ]r ^r ^r _r _r `r {r {r |r }s }x~s   -dd-ddTdd:dd:dd  @@`    # # # # # $( $0 $8 $< $D %L %T %%` %h &p &| & ' ' ' ( ( ( ) ) ) * **++ +(,4,@,D,L-X-d-h-p.|..///6;;00011<<$=0=<>H>T?\2d2p2x333978:44455  ! $" 0# <$ H% T& `' l( x) * . + , - / 0 1 2 3 4  5 6 $7 08 <9 H: T; `< l= x> ?  @!@"@#@$@%@&@'@)@*@+@&` '`0,@@-@P.@`/@p0@|(`1@2@3@)`4@5@6@7@8@9@$:@4*`D;@T<@d=@t>@?@ `!`+`,`"`#`-`$`.`$/`4%`DCTC`DhDtE|EFFccdde e##&&0 $(,4<DLT\dlt|   (0    @ @Z    ( 4  <  D  L @T @h @l @| @ @ ` `       @  @33333333hhp444443333BB B$B(BXBUTC33 u% v%rPtmnshmrPNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž0&1&0&p1& (w% 33UU33UU33UU6&1&p6&H3& 6&4&,7&6&t-dgggggPgCC$HgPgggx   @ 333333333333333333333333333333333333 33 33:& "" 0000000000000000 -3333L33 33;&;&;& (root)`33X%C\"\"\"\"\"\"\"I!Ј%Ĉ%%% %d"h"l"p"=&$48,< <l(Service unavailableXA,aeabi"5TE  SV7xگOAt9, $PCs/@Py J\Uuu%I&(P,A ;]B‘2yf杙=əe vFC x :ޏyoL]+S?ƙiKȵFu܇]aŻBԶGjj3xqiH!wgk/=բbL~GN5kZ4߯WZMw|fHw)3\]\3_Y=mƹr?6E]?ǟ{NK)sBN_Ƴ;}|{Ϗ*:/Pc:žRe~E)=?)ì:anXl4lƇ/EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+4ݏ0.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BHPe%5!Ve%5!$be%5!ge%5!%t%[!Hy%]!0(>&("(>&("Px-("p("-X"y"MSGTXTS626 5024 5049 5066 5088 5091 5096 5104 5111 5119 5127 5130 5133 5136 5140 5152 5161 5174 5203 5218 5762 5796 6479 6767 7475 7531 7605 7701 7748 7771 7794 7800 7809 7831 7835 7839 7842 7845 7950 8153 8392 8833 9271 9306 9321 9333 9339 9351 9370 9390 9430 9447 9464 9479 9526 9564 9612 9694 9818 9954 9995 10033 10070 10105 10115 10164 10314 10320 10325 10329 10349 10459 10479 10485 10499 10511 10522 10559 10593 10617 10719 10756 10778 10877 10932 10990 11001 11017 11069 11237 11444 11615 11679 11731 12003 12553 13082 13514 13852 14185 14298 14313 14322 14482 14653 14803 14967 14990 15014 15029 15104 15244 15421 15576 15588 15668 15769 15815 15841 15911 15922 15931 15944 15970 15985 16001 16014 16069 16080 16095 16299 16532 16561 16576 16645 16719 16792 16822 16860 16914 17368 17394 17423 17527 17633 17818 17930 18045 18149 18836 19095 19235 19271 19441 19482 19618 19641 19678 19723 19974 20070 20124 20223 20234 20271 20308 20335 20344 20378 20385 20410 20437 20472 20486 20500 20529 20543 20560 20569 20591 20609 20626 20637 20656 20682 20700 20723 20740 20755 20770 20788 20815 20842 20864 20903 20921 20953 21181 21255 21298 21344 21491 21647 21691 21970 21997 22356 22540 22692 22873 23020 23178 23199 23247 23257 23265 23276 23287 23297 23304 23319 23331 23369 23399 23438 23491 23549 23570 23577 23596 23617 23624 23647 23669 23689 23711 23742 23779 23801 23815 23861 23890 23924 23964 23999 24027 24075 24084 24093 24098 24107 24116 24133 24137 24142 24146 24184 24193 24220 24240 24263 24282 24309 24331 24363 24379 24384 24394 24417 24439 24456 24473 24486 24495 24504 24510 24537 24544 24568 24589 24613 24626 24645 24670 24693 24709 24715 24727 24757 24765 24805 24816 24827 24838 24855 24872 24886 24903 25119 25423 25871 26087 26351 26623 26675 26711 26747 26798 26815 26853 26867 26874 26891 26894 26899 26908 26920 26931 26940 26961 27003 27019 27035 27066 27083 27098 27113 27128 27149 27169 27210 27239 27287 27520 27555 27762 27781 27818 27879 27917 27956 28112 28127 28173 28200 28223 28259 28269 28279 28290 28295 28358 28406 28450 28511 28544 28591 28609 28748 28770 28893 28907 28917 28940 29045 29101 29217 29248 29253 29279 29318 29328 29371 29381 29397 29412 29430 29453 29483 29504 29530 29727 29770 29774 29780 29786 29791 29802 29816 29845 29877 29889 29936 29986 30026 30053 30069 30078 30121 30127 30135 30139 30159 30176 30188 30219 30475 30524 31100 31127 31159 31187 31239 31245 31251 31256 31277 31293 31315 31344 31485 31619 31632 31768 31770 31772 31774 31791 31804 31822 31849 31853 31859 31864 31872 31878 31918 31920 31930 31945 31962 31996 32028 32066 32095 32124 32146 32189 32215 32259 32395 32397 32477 32523 32571 32676 32778 32817 32884 32891 32952 33016 33020 33027 33149 33218 33506 33644 33785 33866 33913 33919 33942 33988 33991 34017 34060 34125 34187 34257 34325 34418 34637 34662 34666 34702 34720 34748 34790 34834 34898 34948 35024 35046 35098 35142 35181 35215 35245 35276 35301 35310 35322 35330 35341 35353 35372 35396 35445 35462 35486 35529 35851 35854 35868 35881 35893 35900 35911 35918 35925 35934 35944 35961 35977 36027 36035 36043 36053 36064 36082 36099 36120 36142 36151 36161 36188 36194 36204 36223 36239 36257 36277 36286 36297 36304 36321 36340 36361 36371 36388 36394 36410 36425 36440 36461 36483 36502 36512 36517 36522 36540 36559 36578 36584 36603 36623 36643 36661 36666 36672 36689 36705 36726 36739 36747 36767 36791 36808 36816 36827 36848 36854 36866 36888 36902 36911 36932 36950 36959 36993 37016 37043 37075 37098 37118 37129 37161 37177 37188 37201 37224 37246 37754 37784 37815 37843 37857 38058 38280 38447 38534 38551 38569 38586 38615 38662 38673 38692 38714 38793 38985 39013 39131 39153 39294 39313 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-10.99.12. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-10.99.12 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-10.99.12 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-10.99.12 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-10.99.12 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd aktivierenntpd aktivierenntpdate beim Starten ausfhrenmdnsd aktivierenxdm aktivierencgd aktivierenlvm aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte PartitionierungPartitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen?Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS626 5024 5062 5079 5094 5097 5100 5105 5113 5121 5129 5132 5135 5144 5156 5168 5177 5186 5212 5223 5759 5786 6352 6652 7293 7340 7453 7546 7580 7599 7617 7625 7634 7659 7663 7667 7670 7673 7795 7980 8208 8728 9079 9108 9121 9134 9139 9159 9178 9199 9258 9275 9289 9311 9356 9382 9423 9501 9619 9733 9787 9816 9848 9887 9893 9926 10049 10056 10060 10068 10092 10174 10180 10187 10199 10213 10222 10255 10274 10286 10396 10458 10477 10596 10647 10699 10711 10730 10782 10986 11194 11385 11445 11494 11761 12220 12886 13309 13631 14056 14188 14220 14232 14410 14607 14768 14902 14922 14955 14969 15038 15151 15323 15458 15478 15590 15682 15705 15728 15787 15802 15823 15838 15859 15879 15904 15918 15942 15954 15972 16182 16432 16453 16469 16522 16590 16663 16700 16726 16802 17297 17323 17345 17452 17559 17760 17833 17917 18017 18512 18750 18901 18935 19070 19114 19253 19294 19339 19386 19630 19763 19825 19919 19924 19958 19992 20007 20035 20068 20075 20100 20118 20144 20151 20166 20181 20201 20241 20258 20278 20299 20321 20336 20356 20378 20393 20406 20420 20432 20444 20458 20481 20504 20522 20565 20616 20653 20838 20901 20937 20986 21077 21207 21260 21520 21567 21928 22078 22247 22387 22507 22639 22679 22726 22736 22744 22754 22762 22773 22784 22798 22823 22865 22898 22931 22966 23020 23045 23064 23086 23091 23097 23127 23144 23171 23189 23210 23232 23251 23261 23291 23317 23344 23393 23421 23448 23501 23511 23521 23527 23537 23546 23566 23570 23575 23579 23614 23623 23654 23671 23698 23719 23739 23758 23784 23797 23805 23821 23852 23883 23904 23930 23943 23951 23962 23968 23992 24002 24014 24032 24043 24063 24079 24105 24127 24143 24155 24175 24201 24207 24237 24251 24265 24288 24307 24326 24344 24362 24585 24891 25309 25510 25750 25934 26012 26067 26134 26174 26197 26231 26242 26250 26273 26276 26279 26285 26296 26308 26321 26351 26395 26408 26421 26458 26472 26483 26494 26505 26522 26533 26580 26603 26652 26893 26926 27181 27202 27235 27288 27314 27341 27497 27503 27546 27566 27585 27614 27621 27628 27635 27640 27689 27727 27761 27818 27846 27891 27908 28009 28014 28091 28105 28115 28139 28262 28343 28453 28481 28486 28502 28531 28539 28580 28587 28601 28614 28622 28641 28674 28694 28714 28930 28961 28966 28973 28980 28984 28998 29010 29025 29058 29071 29126 29184 29220 29238 29256 29274 29311 29317 29325 29329 29350 29367 29378 29400 29578 29622 30324 30348 30382 30401 30446 30453 30460 30464 30488 30499 30504 30567 30688 30811 30824 30958 30960 30962 30964 30974 30983 30996 31023 31027 31033 31038 31047 31052 31079 31081 31094 31106 31121 31149 31193 31240 31256 31278 31289 31322 31342 31391 31491 31493 31558 31607 31656 31760 31858 31899 31990 31997 32058 32122 32127 32133 32242 32301 32552 32693 32820 32888 32925 32932 32959 33005 33008 33029 33074 33125 33184 33253 33300 33405 33548 33573 33577 33611 33628 33652 33704 33755 33827 33893 33991 34008 34039 34075 34109 34133 34157 34190 34210 34220 34228 34236 34246 34257 34271 34297 34345 34368 34388 34429 34728 34731 34745 34757 34764 34783 34797 34804 34811 34820 34830 34847 34863 34911 34919 34927 34937 34948 34966 34983 35002 35022 35029 35046 35063 35070 35083 35118 35135 35154 35174 35184 35200 35213 35231 35251 35272 35282 35302 35322 35335 35354 35367 35391 35414 35427 35438 35443 35450 35468 35487 35506 35514 35533 35553 35578 35596 35603 35610 35623 35632 35653 35666 35674 35694 35722 35739 35745 35756 35787 35795 35808 35830 35852 35861 35882 35900 35907 35930 35949 35976 35994 36014 36027 36042 36063 36077 36084 36098 36113 36132 36677 36710 36738 36767 36775 36812 37124 37301 37378 37395 37413 37428 37450 37500 37510 37527 37549 37608 37766 37790 37920 37945 38071 38089 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-10.99.12. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-10.99.12 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-10.99.12 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-10.99.12 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-10.99.12. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-10.99.12Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-10.99.12Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Set up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS626 5024 5060 5077 5092 5096 5100 5105 5116 5122 5128 5131 5134 5137 5141 5153 5165 5175 5205 5217 5647 5674 6250 6610 7295 7356 7434 7529 7569 7591 7609 7615 7624 7650 7654 7658 7661 7664 7786 7971 8199 8728 9146 9175 9188 9201 9208 9228 9247 9270 9313 9333 9352 9375 9419 9448 9489 9555 9667 9781 9835 9864 9896 9935 9941 9974 10052 10058 10062 10067 10108 10245 10255 10263 10282 10296 10305 10337 10378 10391 10516 10574 10593 10712 10768 10820 10831 10847 10886 11136 11308 11480 11535 11570 11820 12224 12523 12791 13152 13332 13651 13671 13684 13873 14017 14213 14347 14367 14400 14419 14520 14675 14863 15050 15070 15149 15247 15285 15308 15398 15419 15442 15461 15485 15515 15559 15592 15615 15627 15645 15913 16232 16263 16298 16362 16437 16507 16538 16568 16660 17151 17181 17198 17338 17479 17676 17795 17942 18109 18667 18963 19144 19189 19352 19406 19541 19577 19637 19687 19978 20087 20144 20241 20246 20281 20316 20331 20355 20388 20393 20418 20434 20457 20464 20481 20496 20515 20547 20551 20571 20589 20601 20614 20632 20656 20674 20693 20720 20747 20759 20780 20810 20840 20865 20898 20933 20971 21224 21293 21348 21409 21527 21686 21740 22001 22052 22428 22583 22727 22867 22975 23160 23190 23233 23243 23251 23261 23273 23294 23303 23309 23341 23382 23418 23456 23493 23541 23565 23577 23591 23599 23607 23635 23652 23681 23702 23725 23734 23753 23765 23809 23847 23874 23918 23946 23973 24026 24037 24048 24055 24065 24074 24108 24112 24117 24121 24156 24166 24196 24219 24248 24270 24292 24314 24341 24353 24365 24384 24418 24451 24472 24496 24509 24521 24534 24540 24566 24576 24587 24611 24621 24641 24661 24678 24704 24728 24741 24761 24795 24802 24831 24854 24877 24893 24908 24923 24938 24952 25140 25445 25876 26067 26302 26490 26532 26582 26636 26684 26706 26747 26758 26766 26790 26794 26798 26807 26818 26829 26844 26875 26921 26934 26947 26977 26991 27003 27015 27027 27045 27068 27113 27136 27196 27448 27475 27737 27755 27782 27831 27861 27892 28024 28031 28080 28103 28127 28156 28164 28174 28182 28187 28240 28289 28329 28395 28428 28472 28495 28596 28601 28678 28692 28702 28726 28849 28930 29040 29068 29073 29089 29118 29126 29167 29175 29189 29202 29210 29229 29262 29282 29302 29518 29549 29569 29575 29582 29586 29601 29620 29646 29655 29667 29721 29779 29814 29833 29850 29862 29897 29903 29911 29915 29936 29953 29964 29989 30167 30221 30912 30931 30966 30996 31042 31048 31055 31059 31083 31099 31105 31180 31330 31449 31462 31530 31532 31534 31536 31546 31559 31576 31603 31607 31613 31618 31627 31632 31659 31661 31674 31686 31701 31729 31773 31820 31836 31858 31869 31902 31922 31971 32071 32073 32149 32204 32254 32353 32448 32496 32586 32593 32654 32718 32723 32729 32832 32884 33130 33291 33446 33517 33570 33577 33604 33654 33657 33678 33724 33779 33838 33907 33954 34059 34202 34227 34231 34265 34282 34320 34373 34413 34489 34554 34648 34669 34707 34747 34783 34807 34830 34869 34899 34906 34915 34923 34931 34945 34961 34989 35041 35058 35079 35123 35465 35469 35484 35495 35503 35522 35534 35541 35548 35557 35567 35584 35600 35654 35662 35670 35680 35691 35709 35726 35742 35760 35767 35785 35802 35809 35819 35850 35869 35888 35908 35918 35937 35950 35970 35990 36011 36021 36040 36059 36069 36086 36100 36123 36147 36160 36170 36175 36179 36197 36216 36235 36240 36259 36279 36304 36319 36323 36330 36340 36349 36370 36384 36392 36412 36438 36455 36463 36474 36505 36510 36523 36545 36560 36569 36590 36608 36617 36661 36685 36712 36727 36744 36758 36789 36813 36844 36851 36865 36880 36899 37444 37477 37505 37534 37542 37579 37891 38068 38145 38162 38180 38195 38217 38267 38277 38294 38316 38375 38533 38557 38687 38712 38838 38856 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-10.99.12. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-10.99.12 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-10.99.12 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-10.99.12 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-10.99.12Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountMSGTXTS626 5024 5065 5081 5099 5103 5107 5117 5126 5132 5138 5141 5144 5153 5163 5176 5184 5195 5220 5232 5741 5773 6265 6554 7099 7145 7249 7335 7371 7386 7404 7412 7420 7447 7451 7455 7458 7461 7572 7757 7985 8461 8795 8824 8839 8854 8862 8876 8894 8915 8966 8982 8992 9012 9058 9088 9141 9198 9309 9430 9474 9507 9546 9580 9587 9620 9697 9703 9710 9717 9746 9858 9864 9875 9892 9909 9918 9947 9959 9969 10070 10132 10152 10272 10309 10365 10379 10400 10437 10647 10822 10971 11006 11058 11275 11589 12113 12475 12765 13158 13293 13306 13317 13463 13642 13773 13907 13927 13960 13979 14062 14177 14318 14443 14457 14565 14658 14687 14707 14783 14800 14818 14834 14853 14873 14890 14902 14928 14940 14958 15159 15398 15425 15442 15498 15560 15620 15651 15675 15734 16110 16140 16157 16265 16375 16515 16589 16665 16743 17235 17455 17566 17597 17724 17760 17888 17915 17955 18001 18217 18341 18409 18509 18514 18550 18586 18600 18623 18656 18660 18685 18704 18730 18735 18750 18765 18784 18809 18821 18843 18860 18873 18885 18903 18927 18942 18959 18972 18983 18994 19014 19043 19072 19096 19131 19166 19193 19380 19429 19461 19509 19606 19739 19785 19977 20007 20329 20458 20598 20738 20855 20990 21034 21077 21085 21095 21107 21119 21127 21138 21165 21199 21235 21266 21301 21337 21384 21404 21421 21439 21444 21451 21477 21493 21514 21531 21548 21566 21583 21596 21627 21652 21683 21714 21749 21776 21829 21839 21849 21855 21864 21872 21887 21891 21896 21900 21935 21945 21974 21990 22016 22033 22052 22073 22089 22102 22107 22115 22130 22156 22175 22203 22221 22232 22238 22244 22265 22275 22286 22304 22326 22343 22356 22377 22397 22417 22428 22441 22463 22470 22495 22510 22530 22542 22559 22576 22596 22615 22792 23076 23386 23566 23777 23965 24031 24078 24133 24177 24197 24226 24238 24244 24260 24264 24268 24276 24286 24298 24313 24332 24368 24379 24390 24429 24441 24451 24461 24471 24487 24505 24554 24575 24620 24864 24890 25144 25159 25185 25242 25276 25311 25453 25470 25519 25540 25556 25585 25590 25595 25601 25606 25645 25680 25710 25765 25798 25844 25858 25937 25942 25996 26010 26020 26044 26130 26178 26284 26318 26325 26340 26367 26376 26415 26422 26444 26463 26479 26497 26529 26548 26565 26722 26753 26760 26769 26777 26784 26798 26816 26835 26845 26857 26898 26943 26972 26993 27016 27035 27073 27079 27087 27091 27112 27129 27138 27157 27303 27345 27855 27863 27887 27905 27949 27954 27959 27963 27994 28007 28016 28062 28188 28279 28291 28355 28357 28359 28361 28371 28385 28400 28427 28431 28437 28442 28451 28456 28483 28485 28500 28511 28526 28554 28598 28645 28661 28683 28694 28727 28747 28796 28896 28898 28966 29006 29051 29126 29192 29227 29308 29315 29376 29440 29447 29453 29552 29608 29884 30008 30119 30181 30219 30227 30249 30298 30301 30322 30367 30422 30481 30550 30597 30702 30845 30870 30874 30908 30924 30949 30997 31033 31094 31148 31229 31251 31290 31327 31359 31383 31410 31436 31450 31458 31468 31476 31490 31503 31515 31539 31580 31606 31623 31652 31976 31979 31993 32005 32011 32027 32039 32046 32053 32062 32072 32089 32105 32148 32156 32164 32174 32185 32203 32220 32233 32259 32266 32274 32291 32299 32316 32340 32359 32378 32397 32407 32418 32432 32450 32470 32490 32499 32522 32542 32553 32568 32580 32599 32618 32629 32639 32644 32650 32668 32687 32706 32713 32732 32752 32777 32794 32800 32808 32818 32830 32851 32867 32875 32895 32915 32937 32945 32956 32979 32986 33000 33022 33039 33048 33069 33087 33096 33127 33143 33170 33189 33209 33227 33248 33262 33282 33289 33308 33323 33342 33887 33920 33948 33977 33985 34022 34334 34511 34588 34605 34623 34638 34660 34710 34720 34737 34759 34818 34976 35000 35130 35155 35281 35299 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-10.99.12. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-10.99.12 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-10.99.12 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-10.99.12 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-10.99.12 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-10.99.12Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-10.99.12Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # Rapid commit support. # Safe to enable by default because it requires the equivalent option set # on the server to actually work. option rapid_commit # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostname else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime [ -z "$rdnsstime" ] && return 1 ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers [ -n "$rdnss" ] && new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime [ -z "$dnssltime" ] && return 1 ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search [ -n "$dnssl" ] && new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf return $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" # Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..