08V?g<  V?g_Bt tV?g@@<@T 08V?g<  V?g_Bt tV?g@@<@TU V?gt`AV?gV?gV?g$h V?gV?gV?gAV?gV?gV?gA.V?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gmD$D"V?gV?gV?g (08@HPX`hpx0$V?gV?gV?gPX`hpxN$)V?gV?gV?gK$(V?gV?gV?g (0M$CV?gV?gV?g8@HPX`hpxFAV?gV?gV?gCV?gV?gV?gAV?gV?gV?gAV?gV?gV?g!V?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g4!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g B!V?gV?gV?g B!V?gV?gV?g!V?gV?gV?g"!V?gV?gV?g"!V?gV?gV?g"aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g?\!V?gV?gV?g>\!V?gV?gV?g=\!V?gV?gV?g<\!V?gV?gV?g;\!V?gV?gV?g:\!V?gV?gV?g9\!V?gV?gV?g8\!V?gV?gV?g?\!V?gV?gV?g>\!V?gV?gV?g=\!V?gV?gV?g<\!V?gV?gV?g;\!V?gV?gV?g:\!V?gV?gV?g9\!V?gV?gV?g8\!V?gV?gV?g:\!V?gV?gV?g7\!V?gV?gV?g6\!V?gV?gV?g5\!V?gV?gV?g4\!V?gV?gV?g3\!V?gV?gV?g2\!V?gV?gV?g1\!V?gV?gV?g0\!V?gV?gV?g7\!V?gV?gV?g6\!V?gV?gV?g5\!V?gV?gV?g4\!V?gV?gV?g3\!V?gV?gV?g2\!V?gV?gV?g1\!V?gV?gV?g0\!V?gV?gV?g2\!V?gV?gV?g/\!V?gV?gV?g.\!V?gV?gV?g-\!V?gV?gV?g,\!V?gV?gV?g+\!V?gV?gV?g*\!V?gV?gV?g)\!V?gV?gV?g(\!V?gV?gV?g/\!V?gV?gV?g.\!V?gV?gV?g-\!V?gV?gV?g,\!V?gV?gV?g+\!V?gV?gV?g*\!V?gV?gV?g)\!V?gV?gV?g(\!V?gV?gV?g*\!V?gV?gV?g'\!V?gV?gV?g&\!V?gV?gV?g%\!V?gV?gV?g$\!V?gV?gV?g#\!V?gV?gV?g"\!V?gV?gV?g!\!V?gV?gV?g \!V?gV?gV?g'\!V?gV?gV?g&\!V?gV?gV?g%\!V?gV?gV?g$\!V?gV?gV?g#\!V?gV?gV?g"\!V?gV?gV?g!\!V?gV?gV?g \!V?gV?gV?g"\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g \!V?gV?gV?g\!V?gV?gV?g \!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g\!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g$!V?gV?gV?g4!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g !V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g?\aV?gV?gV?g>\aV?gV?gV?g=\aV?gV?gV?g<\aV?gV?gV?g;\aV?gV?gV?g:\aV?gV?gV?g9\aV?gV?gV?g8\aV?gV?gV?g?\aV?gV?gV?g>\aV?gV?gV?g=\aV?gV?gV?g<\aV?gV?gV?g;\aV?gV?gV?g:\aV?gV?gV?g9\aV?gV?gV?g8\aV?gV?gV?g:\aV?gV?gV?g7\aV?gV?gV?g6\aV?gV?gV?g5\aV?gV?gV?g4\aV?gV?gV?g3\aV?gV?gV?g2\aV?gV?gV?g1\aV?gV?gV?g0\aV?gV?gV?g7\aV?gV?gV?g6\aV?gV?gV?g5\aV?gV?gV?g4\aV?gV?gV?g3\aV?gV?gV?g2\aV?gV?gV?g1\aV?gV?gV?g0\aV?gV?gV?g2\aV?gV?gV?g/\aV?gV?gV?g.\aV?gV?gV?g-\aV?gV?gV?g,\aV?gV?gV?g+\aV?gV?gV?g*\aV?gV?gV?g)\aV?gV?gV?g(\aV?gV?gV?g/\aV?gV?gV?g.\aV?gV?gV?g-\aV?gV?gV?g,\aV?gV?gV?g+\aV?gV?gV?g*\aV?gV?gV?g)\aV?gV?gV?g(\aV?gV?gV?g*\aV?gV?gV?g'\aV?gV?gV?g&\aV?gV?gV?g%\aV?gV?gV?g$\aV?gV?gV?g#\aV?gV?gV?g"\aV?gV?gV?g!\aV?gV?gV?g \aV?gV?gV?g'\aV?gV?gV?g&\aV?gV?gV?g%\aV?gV?gV?g$\aV?gV?gV?g#\aV?gV?gV?g"\aV?gV?gV?g!\aV?gV?gV?g \aV?gV?gV?g"\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g \aV?gV?gV?g\aV?gV?gV?g \aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\aV?gV?gV?g\ !V?gV?gV?gi!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?g aV?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g!V?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g!V?gV?gV?g!V?gV?gV?g B!V?gV?gV?g B!V?gV?gV?g!V?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?gaV?gV?gV?g!V?gV?gV?g!V?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?g aV?gV?gV?gaV?gV?gV?gaV?gV?gV?gV?gV?gV?gbpf!V?gV?gV?g $V?gV?gV?g$V?gV?gV?g~$>V?gV?gV?g$V?gV?gV?g$sV?gV?gV?g$V?gV?gV?gAV?gV?gV?gm V?gV?gV?g$V?gV?gV?g $V?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gAV?gV?gV?gel!3|O| X REr+ WVs_DuDB W-n2zoozC*03>EbJO7Af5 1Yyke"Z xVk3cl(9=kZB~`6*k\-Of];g"| ;KOry~xb.Wu*&/`\RƳ(:$vV |FkY9Ԥ4ujjI(p_Ъ?$S"z@>ax%z *_RgK̳?%um/p|Aʂ#+qci^,gW]w <" dwiLK-1ZGR I$$ȇt쒰M5*rK+ppuhIx51~k@v4I(*hT)?nAacI4~y]ABQjVaf WE-Ot-;a8 :O^IsBs&4$a{6xAiNIFG=1,N6f }t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4TA"4 (e!e!e!%%hȈHHe!%%NetBSDpmAPaXNetBSDearmv54p@-D0D 0@`Qp(@P`F`F&a03/T@pX$$A-`0`` 0PpU(pGpG@Pq`P03/T@0US $\@-dPQMI T!T1 P`0 0R0418  0S  /S 0SP  00S4 0pp WI2I0@3)1*03/ T@p0pWH2H0@3(1*03/X@ 噵 d 0 P0 0@]$(h$L$z%>@-t ttPl@dphP L0"v`POU &P @v&ȭ Ii P@-@OO-`@@R@<2tH4M$H0[p #Pp@tH$H( 0 R  o @Pp| 0: S u A`0SЍ S @P0`0vw; 0xS'x0SP0 S0 [ hP   0S;00 0    P 0s 8#8T * THW*T   P Ru&,~&zph*@~&7H0`  BR` pR RX X/u&@v&@-I0 Dv& 000/\&G-؀P x0M@ U. \05`p M. 0T625P0 Ѝ\&Y@%v&@- M @00@  o P K ЍCA- l1X0Zp 03  @P 0S@ ((/@0X;0%  P- ! U @0`V/PX`!  p0-S  @| @Ph P ULP@ U( p0SX %PZp&dO-6M@T y  ] @P Ѝ   p` @5Xp0S 5%0 0 |5X 0S_d50S&<0Z pP(@ 0SN50S0; p  pPJ400<T$尠E00CS0 G;Pᐔ Pp  PYU  0 P00CS0 /;0 X80: S  +  + pP p Qt  X0 0, 0X3($05x000 00 Q00SD 0 0 `_p8  px  0Y 1(#00 H +  0P @ P㴂~ t0S@zM K"I 0R 0Y0YY]820#0 p00 R0S 100S  0 5(  Pʨ0S; a@T c@P@0 ?oR20S 0  H1 0R0[ P( @ P @0S "P0S ,'P Xp Ty P0Rt00! P ꀂ&%zp`&h&l&d&|&1x&v&pu&t&\&&&&0@-MM@P  | p  ;0U$C d P TT-ۍЍ08 P ,(0P X%t&Q@-@ T P DD , P $ 0P@%t&Q@-@ X P HH0" P $ 0P@%t&@-酀0 KBv&0$/`'0$/ᰒ'@-G'd@-B'z@-='@-8'{@-1   0 0 ЍX'@-1   0 0 Ѝ'@-1   0 0 Ѝ`'@-0   0 0 Ѝ'@-0   000 ЍC'`'<00/@-0   00 Ѝ''<00/@-0   0q0 Ѝ' `'@-1  ,0 a 0c Ѝ' 0@- 00 M$0P@NЍ*%,0C-`A!圁!ᘑMpW0 |! R0B=00 B  T0L 8 R<B 8!4100!0ЍPP ^&=aqP 0p00S  0 P0P      0 3/R ! 7000@080L)&D0값''`' #='5bu80p@-|@PtP00 R 0p800 p0  B0Sqs 괓'`''0 0 0 /`''@- % zp@-@- % zp@-@-80M@0(@3/P $ %H08 : S( 0h 3/P   00 0Ѝ00 0 1/qp~0S 00zpm8@@-@:dPЍ@ PЍp@-(`Vp80@  03/PP%8003/(PpS@-@P`P 80 (0(3/@~ P ~PЍp蠒'O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 Aoe 000+ xpt| 'x  ЍO0 P % pHp 81/qp4  % ?P p 4 $<~0S4 tp0 0 0 0 "w0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0D004 8pX  FЍ蠒' \'zpR/ R 0 0 /\\CC  B0R00!/0"SSS S S S S SSS SS SS SSAQA0/C-lBM0 0  P0 0  0 ;? Ÿ$  ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!!!! d 4 !P`4 Ё/ V '* u 0 <;t 0< 8p$(4t t 0  *t0040008 04 DM t880$0y'(0吃# t 2!p8`  0 @D  0p $E긓' %T%;?*I5̓'vd AB\ #Ҟ >X` F_@-pPP`@@   uP Ѝ`3MU@pp@-XP8@T`@D p P<opQ<Pp踓'A-AP 0P$ 0 0 SQ ( $0P y2h d[`P, 0R1@a@qU`0``00Py >00CS000    0,`0CS0000 (00/U R ky8 4D 0$00 0$ '8v&\''rT0 S 0SP/P/S/@- g' p@-XAXT0040S+@! PPP P`04 0PV R@40P 0SU40 ^*00"  `0PEP P0P4  S U 4 P0CSR40PP 0 = p''%''p@-̙'''''A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT }@ 0̙''%'G-@p0 PR` 0 PM(S%H0  d P 0 ,(g̙'8v&@->`0 Nv&O-dGM0PS@pM$Q403/P n0: S9`00W +L P9:-`?0P0: S 0SP0: S 0S 0S 0/S&P3P0S[P( N P 0p#~ PN+L0P 0#P]m]P  /SP/SPppZP! 0S0S rBSXG X[00CS0kpl Pph pYWr TT~\H Z0Sh0S0c ?o2500>?G YU.0.0 ^G=0JIPT.0.0 o^G=0IN7P804@pl0l 0 0  L00S   zpv&7r h'l'D'$0\ 0S p'7r zp L R/   /@- M R     !pxepЍd d@` Q@X  B ?QS 0Ѝ@''$'r',' ('P `00CS`0p S00 P0S X0X /Xu&: S@-  S  S/ I* S  S%|@=A-|1`@pTXPM !\;@T10S H10S. 00 00,10'p  @0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?R 0T00S  '9'$'rdh'l'd't','1('D's@- P@@P `PU00S @GT CЍp0t  Q \0 \@-T (P@$U@''p@-P@Tp0 0C0  ,A @G-@0Mù03,30S`V0Ѝ0 0C0v 0XPS !,c0S 20Sh  4 "; $p | G0 0 p>P20S 8<6 (,2(20S  $*0 : SF0( " 0@"$<10SP :1!0 0O 10S10S : S0: S y`}P1q H1Rp@1 B?Q 0 'Q Bp 4 l^ 400S00S ꈚ'@' ''Y9$'rdX'b 'i`'h'l'd't','1('\'D'1O-0S,0@010S 10S40 001!0 q0P0S ЍOPa0HQᓸ0P 0 `0SWpSRQPPU% Ѝ  B 10`    0S[  L0  ,R4   V  ''$'d't'%,%'410G-S,0@010S 10S40 000 0 0P?0`VG^pP儠UG k0 0C0 W bp0S,4  `YpP R` ''$'d't'%0G-@0T,@0@SP 00S40 00@p0`0夀S㤐@VG +0 0C0 W ,"p0 00 S p0S,4  Dp` ''$'d'%@- M @ p ЍT  P  T0wHP 00 0S@SQ 0  eH0@v&0p@-0PS``@H@P PP PA@P4 -P4:pl'wzpC-CM@H `T TPȐ`T *F 0➸pPPCߍw ? P@Tw0S ?@UP?lP@z&@-U v& 000/ᔚ'@-U0 }v&@- M50P!00A00P!0 0 k(p Ѝ "$  0P @000 h0hx K(pX   DH"$  (0ꔚ'1q zp^Z1O-L@PQM Pm nU0Sq  啶`(P 0S !P 其 d00CS00Hpp/`Ѝ0S P X P`P`(´1 04 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@H Rt$tpax0) 0 p W 00CS0 p pYW 0 P 0S  tXP `0: S P8X P `0: SNpP` H`PVc0S x 0P@ `P; [ ,ԵtP ͵0˯S ,!00  1 0x! 0 p(_p|壵80H0 .P 8呵x t+P \T0S 儵`0;`0`P yP ET0-S  lPT`Ph0S  <"O`ꔚ'fpv&u&rPq pPzpY@s@-@ `PgP 90P UOЍpU EB\@sq0 P41.@0%.=A-A~M0pSM P0` 0`PSp! p~,"P S@!1P~܍Ѝ0 0`PS ~,PPʓS ~,P `0 0wP~Sx W mQ \#10 00_PfS0$ i10%mlL00CS0 0 /O- U`DMp 000D$000 0000SHV"4`0p Q 30Sa4PZ| PZS0`$1000 0K4$yPS0$1V 0030p Q  #\P0 0R0#0V0030d#EPR0X#0L3000DЍp(0: S d0 S" P 000 S|2"00"00 0R  Rz2`2Vn `i S0% 00 0VJqpR0S 0㐐唠0 0p) W W)2`V%  ?.L 10 0R  S0R 0!CQ:++R:0'WW~Ta0@ 0 LT04[@T ;0W ` W00l W~,0 ~l0`Z BP* BP*Q*S  Q T0`0%''|%<%F(ؚ'DD%^yM%m8@d'h'\%}D00S/@-4@~M0S~, KP~܍踚'0%0@-p@$0l00S Ѝ00 0I0Q Q, / P0%'L0@- R8\/P 0 0 P/긚'G(h'.A-p`P@ 0PPEU`@T@A-p`P@ 0PPEU`@T@p@-P@T0` Q@P 0 Q @;;S p@P00T@ HQ(0( K/( .0%'h'l@-,BPU` V0bP$00 p?W0 pGWhPhQ0 SV.00P ЍP#ڀ;;S 00 0H0Q P? PppD1$p0pQ Q(% 00$0SP ( .P0S00P0ES00P0S P0ES $0Su.P0S P0S P0SPU P(0( .0%'4H(f0 t!0SX@-dQM0S T100CSDA.Ѝ0S0SS/ 0070S S00&.S0S0@pT0pS 0L4HQo 0!Jp T0)HQ00L 0CP000S$ʲ/Ḛ'0%|%mG-P`0 P ,p@P"ڴAQ"GQ 0Q P 0GQPD .ЍP 0S0%'+@-xaPMP d1@0S2 SU@D;00U0pp0 G0QO -Ѝ P0S(0S 0GQO  Pڌ0U 0?wI  d^-0 P 0PO 0, -0%'[h'mO-rM,M R(`RX0E@FP0 0S 0 00 S(0S d  T"P2p00 )I00"JJ?00"To" ?܍,ЍT 0S =! !!0`A 10Sx1pp1 00H00!JJ?08!00,q0(`0 1娀(0 C0J 00 $0 H 0 l  0  `y@ /T|%v&'4H('"w-DG(T'f'(|p'0%C-XRXb0TBS0000 Ѝ440 0 0S 2r0S Q2 O/B 0S pP (0: S0 0a p10S10S P P -!0 0 0S(q<m 1 A00 0S000p000 S(00(000 P@0S 000S 0[IP 0+0P0 H 0`AH0%''G(H(G(G(G(ؚ'|%H(4H('p'A-MM, oPN#,E cPN" ,RB$0`SF 0`CĂ0S2y+pIP} HPx 0 u S( .pe+lc+h2Lr0`0CSXXZ+W+HU+DS+@Q+<_+P,HP000 0@+ 2 `ލЍ6+0S  R  sS SS YSOP+yS+$qx+l+<+P,HP 0S8 4HP( [?1P *0S(*PP Z6P0000+*G(!0%'lH(G(?D%<%o|%*OPx G(m S 0O00@-@HpSp`%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S *@DT  A30d#0UPTP*PV0S p|*@X`ꓢ" @2/PL0 !ᒣ#, 0:p%d%'|%`'54H(O-Q0@`p@F f[ PppWPHB* ЍPT10S  1*p@ 0 $03/P$ 0 R T @ A_3  80 3/PrP\\00Sd \* Q < 02/P " "4H('|%''@-AMP/MN@@P+ p`pU P/0P0 Uh0h !*AލЍT0_"/0P0 000 ` *ꔡ'H'\00CS0 90 /0O-S$M00`Y P$Ѝ$P0,03/P00 T30 S,@C@sFP7PPP 0030SY  PV 20S w!P!P x4 CSR P8 ,G P{K7"~) H70/SWPS= A^2X | 10S  P0S !S 0l!202;/P Z ," 41  0S a0S 1100C `]0D0 3/`7 0S 0S 0VP0x0CP0&P"P0403/O4H((H('G(H(G(G('''G(G('G(P'@-@@PJ( (<舛'@-Zp @@J (@-@pJ0 (@ p@-MPp@J0S  0C0J `xp 0: S@S NS ЍpJ`C-MzPЍa0H03/P0 03/P㷫plA]P@ 0AS0@0 a3/PE0 0#P)3P/P WP0/S4P0< A;10 0006@ 9Jt =(0(03/ Xer0 P4H('''@v&u&!G(O-MPЍe0H03/P0 03/PP9D50 S 05P I%'50SuJG>P 0(03/ :#P 0AS0@0 a3/P|4C003P H4 C(P(40S  P T 0 0  P 0R S = $ `0Sd003p0St00PP p@S`3`0Sd00/SXPT;, A_0 S0 0  >P0SW 0S = $ `0Sd002p0St000S "SD 0 l 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P  x1 Hb X RP$PP ,1Pp<0 P E @ ;/0S0S P0S 000[\000*4S 0S 04H(F(%5(H('G(P'$H('H(H(''''G(G(G(G(G(%G(G- R@}P T T 0 9&@H03/P0 03/P0SB0 Y Pq0 09paMP P: 0 P0(03/P@F P0 0 @0S 0' 00OP@' m?P0 0 p0 0S TQP \0 CY yP4H(JH(G(H('G(G(G(G(wP'T0@-0S\PP 00H03/P@H(4H(0O-MMD嬀$04 PPA$W@ *P 0PU@$ P@0 0$ U0 00CS /R0 S  00 UP@0`'G-pP`lV  0 BRk PPEUPR@@  C`Fp`'O-0M00㒍PQp@𑟵 0`(P2Y0 0㬡$0T0+U R 0Q0T0%X1@00S0T0S 0 :4S  !C0!! 0 BR  PU& o`Ѝ?T000 00 $0%PPd 0 R  S@T o R 0Q0 `'G(VG-A`#RPp㌡>0S5  Up 0)  jB000SPER0  !: 0P! 0p 0P0U00pPF0P0 000/`F p 3B00`00Q Q P0 S  PF`'\%G(4H(p@-0@0PpP EA0Pp@|`'\%A-`PlplU@0@DTj@P U@0 A00`PE`'\%G-P`ကpU0@0@DTG@PğU 0@0 {A0@UP0 ``'\%G-pM =@ P`AX10S PB:8$! U00 J(A 6 0 BR P#?U0 P0PU0o0fPJoB8h @D 0RP J(L J\B80 _ `ލH(`'\% Q/p@-JTUPP@B0P C PpP4B4$ 7 +0 40p3F(0@-PM@ Ph00S Ѝ0 $ R\ 04 0R\ $H(D0@-MP @PЍ000S0: Sx<PPU A0D P 0[5A0 $H( sG(30@-M@, 0000S# Q0S 10S P'0S% X0 ?A3c000S&!h0 ?A3c0 P A0NS A0X Ѝ0A0< 0S rp%%Mbp@-@P`gP p P $04[A0 ^pG(@-!@ P 04GA0@ IG(O-P0`/Sp/M/2@P7  P. jp /00 P&  P!00S  P P0 Dx ЍG(G-@P 00/S (QP 00Q  GIyZP@0 0`0S q뤀夐p0 KP@0S@$<jP@D004 40 @嚢DF( f}G(G(A-M`P@phP5(10S Ѝ 0RP  0RP !0: S|;P P_@0 b'PW P K@ P W0 @D$H( 0@-:(4@: SM=0P - \ 00[ P0 p 0: S ,Ѝ000  t:P/  0 fA-pQ?ZdV`zP?0H!@1@0S/0(DS7 (1!0 0 0 00! "4S pqP?p0 巡0 40Ѝ@$<@0(DS PL(DPL(DP 00 0G(G(%%F(O-J#Q30` P (tJM Mp40CS񟗄p3:P x30S FP0: S* XP2,3,0(So0S| (4S~ 0S20S 4m0C?o2 000! "p"p/?0 "1X&?Z/ Z\20S0 0 D" J>0@Pz=0 C9z Jލ Ѝ   Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(409Pz P#P> 0 `0 + D`\ QX00O0S0(4 008 00G(cH(G(G(%%'G(P/O-p@M W 0DQ 0S08 0<000SPP0C080pG0S 0`S : 08 0 x! x3  P< O>@0  0R X2@ @?6Q*<>@0 ?0嘰 R KP` dЍTT ĝ * ` `@xH(tH(H(|H(Rs@-Ѝp@ 0@`P5Q=08  ?P=0 F(0@-@MPPg00<00S  = J"Ѝ0G(G-`QM MJP㠔@ Y #p 'P 0p 0PP=! SR J(Tݍ ЍPJ=8 = $ HL0RP J(L0 00R5QJ{=8 PT "CG- QP 000aq@T+00CS0WpT0 0S0T@ 0 S@ 0 P 0S@ 0S0 0 S P F(F(%u& 0 0 S00@-@R00000S0@000S `寜P LP40PH( H(F(G( ]G(p@-PP 0S|p `ᆜ@P` .@P0/S000000f PR @@@pF(h0 RX R  H R/< R/ $R/Q/ F(H(H(,H(l0A-0S X0XP@0P`PpT R S> 20@G(F(8v&C-b@ 0,MS0S/,Ѝ0 0P50C S>#$#$<##$$$$x20S 0X0 00!P 0 000! " PPP  0!$:$!5 0!0 㓝 Iz X B ;(4 : S>  S8  S%  S04 0L! (0 J $!(17P6 S  S0  S04=! 0400S ̈́!!" # "040+04 <P;0P 00   0 OF(G(5Q G(ep@-8M@  D 0`P`U`$ $ @ 0ΨP8ЍpA-t1hM0@S T6hЍA/`Z(="(<p@G1WpP0 0000p084 40CSH$0"60"$0( 4 CR+x .hЍB>'PS+<  ,G(8r P@-@XM="p:(ⵚ0 XЍ7@-@Pp )1P Q Ѝ0 0 +Z Ѝ0@%Z0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-@@+0CQP0"S : Q%R0W^$B0CBSB 3b 30j9@pQ0^AC S*p P@-*0S ^*00 S R( \000C R@30 ? SR@*:@ 00 C@ T \A C@T2  0a0C R"  p@-0C@0 PR"S :$B QN%R02W" 0C@Q `@ 08PpANQ0 C S*80P @-  //H(A-@8q8`Q PC-PQPUPQ S AAu+:UP0 ddq? 0:S@ 0S000 |-F(o&v&/4s@- `f20P PQ10*@PЍp0S @mR! bR kR% + 0*S xS SwR! /QP0@P0$+* &0!SP@P0PA- 0S+`PpP 0P# X p R 000R p0000S ,*P0=0*@P5F(Irs@-@ `P0C30 0  R R00P᭘@P0@( 0ЍpPE 700F(@-  X㒷v&0 Rr @-/|%@-4@4X(X WWvv&O-px vE@ |\Pp`80, [/00 `ꝉ UO-lM/P,oPv@P p`0p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE < zP񟗳752575555575777755557555555555555555555555555555d7p755|7757755555555526555566755558(755265875@75X755555555L55X5d55555555556H6P6X6p6P6x66656`N>4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<= 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eB Q P@AxAxAxAxAxAxAxA\AxAhApA !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0㛳1Pd HG(cG(F(lH(d%o&|%v&G(@v&d'r̚'$H(%G(G(%H(G((H(I%%%%%%,H(d%h*G(@*V8u&Q?;%0nc ҆0H( H(%aG(H( .wIi v&E H('H( H( 'H(H(G(G(G(%G(|-К'!lH( G 0.4H(%o&G(`% `S#ߵL#۵US'0   0G 5가z0P  , G# 01F  1@ /P00F HP`1*PE 1E  1D s1 1C1WPC1PB $2B  42A  D2A  T2p `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C 70 0S3# C*SS8C0U Pg000Sv|30UӈePE3PhPN0000S 3 Y0P  /F(l0P/`0p@-0 PL@LPP@0@E.P6 ҴBF(4H(v&G(cA-`  @PA?\+ \ *\.  Q R( [\SPQU !\@@]^.!Lo \0S8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ ,H(p@-@@0/SN00N P\WpPQP`Q*C0CT030@"L00Q*pQcg@-1MP M AaqRP/-P U$0P0Sۍ Ѝ.S@T|`l @ @G( S 1P`O-cM M33 "@p3]PW0`0 00S 0f0 0 0=P`` 00 ;RSVz @0 0;T* R`DV:  cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 O 0@&P\P   (0 0CP;T+ 0S( `0V"p0S 0 0S F0S s  Z0l 0 x5@T *0S0T00  R S 0 $G( v&C-`PMM RP p\SP RT P0S #  0S~C\S R. gS PS$ SS GS i. 0 0=pS sS0S00 R @@@(PPP =㧐@P p P ; 0 0 ۍЍG((YA-PP 0Sp`px@PL P"40  R p`@@ @G(X0A-@0LPL`LpT  SZ N0@G(8v& `10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0  n04GP 0S/  00p0S/  0`0<" @0/S000 0D  /G(H(,H(G(1 N 0A-j40@TPp 00S0o`0 00/S @Tx0T0oP0 SD fP04G(H(0H(2A-0@SP' 0`.S0.S0S/S X nP 0 Q CR S.R  S.R0S/S  10S410S 4P:4 CSR ! Q`V 0/S0S.00 p! 00C0V0<0J `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0 0A0 B!"00@D}&A-Q@pW : J($S20d 0Q00CS100 0=P  0 R ⨁0≎ᩑC  S@ 3. b 30%  J(T0Pu[[P081  1 Є0(p [P0<x TP0@ MP00  0 DPP u00 09Pl #PK=Ђ;PP P @P hDP0P 0@00aT8@ppSR(A-ppP`0005@50 05000@0CS000SAI(I(p@-P`@T PV 0@p@@-PG-`=0@T3 =PP&P 0 V@0P U VX00CS00 hV 0 00@pR(|%mc%C-3sPc 0 p3@0! 0  0004 Bd @3 3 00`D^5蒟 +0@ Ѝ/R@R R@ ?&@ B&QꨝPPPPPPPPPPPPPPPPPPPPPdPPPDP4ԞĞP@0=S0  "?R 9R:BP\ԝ̞|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]D}&|I(F pI(xI(dI(0@- `I(0s@-0P`0Z0`0@S P 0R@P@J   P@B0S00S :0ST P000 R  Ѝp`I(U(p%| F (@-L ^ꄡpܡ0P$ȡ\T @@~, \ 1#P? L 0l0̠?0 c0àΌ SQŒQQP0R0R0P0QPQP !LXiO-`pu딠P @%R@ &R X(4! 0[00 @P@ P@ Ѝ`I(v@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F2P@$ P@ޜ W`I(Bp@-@P0)Sp`I(O-@`p04MTV TY T( T) #T! @$TU "T 0@#SP  +4Ѝ'0DSYG x@W'0I @S 0 0@SP'Y00p0p!p |W! sz! m0  @@P! `0  @PWWM'T@@p@P, @: `I(BO-p`M8P谟蠟4!@ 00 R@ 0DS U# 0 \ 00S^^ :U 00SY` p PU @ 0DS Ѝ`I(ȱ C-`p 0BS00@SP! @ 00 TPP@@ Ѝ`I(G-`dP0@S! p0 00PP@`I(@-@MP2`PL 0P  IR NRpp  PpEp@@0PS@ $z2Ѝ`I(PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P22Sp0@1PH0@P 0,S@2r`%h%xP(U(qp@P/-0 /RRR00I(@-@PMލ0/S XGp Bp 0RP 0RP p@-`\1@QP y1D0p@11J0"SP VpC}gI(p@-T` RpH0@Q 8 PP Q1pp@I(%O-pWR 0S)P |B000000000CS020S @T  U tU`W 1x828b0400@/Sp?EpPI0S0/p0CS0oppW001000pA0P00 {000 hWU \SU00CS0810S 00CS0 0W00 pR0S/S0@D001@ P  R*0000t/S0S P 0/0CS0 pG0S 00CS0001@1@1@I(I(I(`%xP(h% S A-Pp00`0墣P 00CS000S B0@0CS0X00S 3X @06 R0S T$0$pQ@$I(I(p%I(8G-p2B`M8&0@T"U@P$ 0SM .S00.S0 00/SSC10 x PPB|ePpZ% ``VTVPP@  ` /` E0Ew 2x@`0-S0S0@T@@UP0uP0: SVP >PЍp%R(è *I( #@-A$0Q @ T @I(9p@-L@Qr70P000S LT#PP 0S}@@,P 101P00CS00 2P 0 P0p0{TomR(dI(x%G-pPp@R` V101 *Pp #Pp `b\TQ @0T! \0DQS񟗀ꐵĶ̶Զ@0 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 O 0 0SY00CS00 O 0 jO 1 0d1@ @ @ @ @ @\@@%<b\A-@ ` PR 0R 0S S9Op0S0 R O0S  OU  OTOz xO Td@00CS00 O 0 ANh%I(I(&%ch zp|% 0@-PG 0I(@-@(0Q KPI(@-x0@T   @@@@ @D@00S 4060S qЍI(tP(p%-$0@- R    I(-@-   0@-I(-@-0@0 H@-P@` =@-@-   3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ 0H P @-4 4N,P / ر I(0/I(p@-@᭠PPPP ɟp` ͟`P 㽟p` `ps@-P750@T t0t`6 N N2h0@T POT0 0@ Q@DЍpR(rp%B I(V(A-`P0@S'4<0P 0`p0  x06S 00S PЍ @0t0S0T.S I(N@& 0    /I(@-@TЍ0Ѝ0CS44ht  z000 P p0 +6@ 00 0@-@M PU PP 0p ,P   HPP 0p  , n Ѝ0 cw0 0I(%,%@-@P 0S0S 5P 00 0E ЍV(G-`0S q0P00$@儡T0SXs'@d1$@00CS0D10S &Ѝ00S P Uᘞ x1  R *P00CS00S UC0SwCUPl@ e0S#I(I(I(+C-c@PP^0M& S'@,똓sQ|tH4XS#$0@30S NK0S 2$P@@T L^0S 0S@,T ^0S$0 0 @^0S 0S$0S 20S _H+ @@$@+,10S IH0S AHo^0S 0S$0S @TM$@P10S +H,10S "H 10S H00S H  0$ 6 $0?o2$0-0$ R  h00S G 6@ZL<Kp+  Ѝp%S(I(U(@h%G-PMp@L+0 `㠀堐堠APP p+Vx0$`W U ^0S W P 0`S0+ЍU(T%p%I(P8PG-P* `0@00 0R0Cp0W S `S0p 00 P++S p0@*PD0(00$+ 0$ 0$/`%h%xP(I(A-Pp`@䀟000{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S SI(p%G-P䑟 M^`AV $`*pWT0尡p0p00WZ 0S- |1|a4EKlCK AK00CS00 J 0= &L00CS00 J 0 J  jN^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 M* Ѝp%I(U(V(|%2A-@ M p * 0 0P[@T/ 0S0$`V@ 0001P 0`@0T$0 R ^ R 0 R 0$0 $0* Ѝ`0U(I(p%G-`倂Fo@p0媢S' 0S$ L2LRH23J8JY8(JV}J00CS00 J 0 IQV000  'P7 V a< 0$000CS0l10SG  D FP P00CS010S  C00CS0 VVp00S $0$0CS0|00S 0S0S0000[3J8JG 0Ip%V(|%U(PdsI(I(I(wp@-42M000000 20S 00S 1 `1-3II0Q@TI1SIWPP& |1  1@"@0S @T H1G dD@I8I$10I0S  1$ ލpA 0 000 0BP00CS0 0@ a0 00x0 ?00CS0 0S sIlqIL0HX00S @00S I(p%V(U(P|%I(I(I(I(0@-00`o00 00^0$MSP4P @h(000P  pu&P 00S \?T0 p000CS0(00S l($Ѝp%I(I(C-@?mM000@H0?_00?0 0P@,@(0@ ? `0d00@T  1PPpo0 `0^@T pd0hP 00o 0lP@T 000P0l $00`0S$'`0 S 0D0>60S >0S$0S 00D0$ 01C 0p>0S$0S ph@PnT@ xP H077S 7S) >0S*00S6 -0000,0(00 0p(0P =&0S(7S%00S 0 0Sp= 8  8=, bp@ P 0 8= M8 $= <, R , ,( %P000<<0S @A @X$ 0 $ ` 0bt<H<l1Hh@T: =pHPq`P H00CS00 G 0PppH@T4`@T @ [00CS00 G 0 H@`@T0Tk PU#00CS00 eG 0 ;FG00CS00 QG 0  \BP @P07:0P PP@HP\: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP0077S 0C8#8S0\\)SS B708#8SCP0 Q A!Q8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  p8 @  (00(00@070040/ 8<000L厖P7 7H 00R}0( ?$0SP007pGQhJ 0'000 000 7 0|'0x'00$(0h7  10103/$0 7 G474' 6,' FL0S ;L8 6 6 @ R] 4 0  X $EO&@00CS0 ql`60S C P x60S%,03S5T6$5D h0 L5,,0( f0000*,0( b#0hE$0(0S,M $ \5 d50S $5,0S p傗t<%050S 0 @0 BP0ET#?0 0<0$0 0C0 000|D000t4 8\XR00CS0D40S ⚕P) `40S*T0SX RK8 3 3 3 \ 4 03~C*00C<p3 0 0S '|0R#C#0 0 3 BxhBL00S0\P0"0C0000Q5K8 2C  |2  t2 \ 2 >*00 0`2 T0S@"00CS0 2 R   01D0S$mߍ;10S %0,!SS{1 08 L0H@_Kq10@0@0S P1 @0S1 41$ @0S  1@0sH1 R#0S01   B  @0S @0S7S@<Z 0 00S ;X@,0S0  >,0Sh@P3 F 0,0 0H 0V(U(I(V(U(p%Ȳ S(I(tV(I(I(V(|%Tt@%R(R(t-o&%h%%I(I(!|R(I(  B G@T(0Sp0 t0 ,0 0s,#p)DlJHF0/I(0 /I(0 /I(0/I( 0  /I(P@-@ (P@x<0 QP cR   I(0 S0/I(0@-0M0/0@0P P L0: Sl  S` PЍ0P0 : Su# PPV(L p@-Px@x`M$P*00S n#0`00``00-"`1#$ЍpI(R(@-h@P$0'0 RP  B R    I(//C-LM*88 p@<(P@0` D, ` 0CLЍr% A-@P` pWU nNV" 00z(v pR(I(O-pWC R``%` P0S:S2HE@А @0S,W@  @T 0T/S/00[j0 00S00P R:R0:SPPP@DOa"S"`%h%I(@-@MP/p P㨐K  0  @ T9ߕp0 @~0!0P 01pWZ0S 0 `T 0S 0S 0 Sⴕp @G" f`P T T T0 @@T >0DSI(TA- @PM`RkT81000  8p"XZU hCB Q PBLBQ8C 00AS 00CS00 zB 0* 00CS00 jB 0 ЍQ PBB000M 00CS0 TBBHD00S R,rV((@Izp%I(R\bI(fp@-P@@Pp 0S%SpCP @м p@-P8@Pp 0R2Pp@P - @0@ R0S P P\ 0%I(G-`P@唀0吐00|Up00CS0h00SG0S0 S 0S00kPPpI(I(%I(A-`pP0@00 Q Q:R@ @:QR@P0SwppR %Rw@O%Ppp0V:SP0@w@V('%A-`P倀000|Vp00CS0T00SA0Sp00Mrk@T`I(I(I(0A-pPS R+V`a@T"W p0008h 0 @0 0 Vh00CS0H00S ?`HP `@I(I(I(p@-P$@Pp0P0@P @-L@000@00 k00CS000S@ I(I(I(O-PM/`@ 0P @@@ (œP000 0S 0S 000Ѝ#   P@ |FP @bPR R R R 0S 0   " R0""  " /R0 dpP>Z0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ $P %pP A0000S R  pJt#PG R C R ?( P0 * R; R 60@@DY P R  Bn T@0000S R    BR =D R9 7 aV(%I(|%dDI(h%I(O-@`pM&PP'0S*[ 000`0p0Sw|2!| S6hB?01 P @PЍbPEUt4HT4444444444\dl4t|00p`@[ Q V  0P!0X ZWYV M1 00 _0S& 0s1TP P*X 00SW0 0 S0 P 0STpYT 0s P kz@TR(I(%hJ(V(%p@-`P0000S S@rK000 00 00000CS0p00Spp@I(I(0@-x@M0 0000\0P>00K 00CS0$00S Ѝ0@Ѝ0I(p%I(@-gP 0S/KO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩H,<00S"" 0RPW>= >0 @ TW 8L> P 4>>0 R @ T Ѝ>>A00CS00 $> 0 00  x100/PXP!  rZZW Yo>l>TἐPWb>W~`FfiWxWtWq ~W 0` @ p`>`'R(84 r9Ncq%V([c[O- MLBLRp)0@0`V' VV:V  VF /V   BR 7` F RdddddddPl! R  |a[  0000SH-B@P  ~p[/R 0/S 0I(^P Ѝ] @TW 0 BR  R  BR    BR  V Q h%lJ(xP(p%èJ A-(A0S 0PS0 0aqP0S00 P000f00CS00S P 0SRh`hp0P RP000f000CS00S lJ(I(I(pJ(s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `f@0S00S=STL00 <0 R0AD1U0 S 0S\%|R(R(A-dp`0PS@  R R00PH @lJ(O-rP0M00B00 00,`000崂00<00Cm6<`0P X0$00CS$0E0S00CS020S  P⅍P+0S 000P P f(P F10S 0EC{0P0CS0\10S Ѝ000 @$P[ [` V0 0( RP0  Q BP 0 SR 0 0 0CS00 S00C0~000`0C0  `F BR V00SP 0PlJ(h%I(l%xP(I(I(J 1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xQBP  `V' Q`:00Q@  @% Y0S" SP P@P P DoQP @@` lJ(V(pJ(%,A-XPX@X`P0p00e0p0CS00S lJ(I(I(p@-P)@b$0@ plJ(@-QP`p0G0S `*00E@P`P P `R@ Ѝ0P@@0`SP0S0O-@ Y X0 S@0 S@HY" \YX0 S@0 x00S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x^\| ]\Q000``S XSQ0 0 @ 0000xQvS^ P[Sd:Q" P-Qf]Qc  \QQ PP$` $0( <{P1 0$0 $`( 1{P%H0?PP0 QPQ P !$ P80QP*0$0dP d`0]S0 S 0p@X'\PP  8QP4\SSPP0 SP0S  @p3F O- P@M0?S*S3 [S;0^S!S00x \/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xPS@0/SR"@ R0A$x RP R  \$$ЍPX9$P| 0U0/Sd 00EpP $0S/00E0S``0` xQP 0S V/00D0x RP0  Q: 0 R /00@>0P .Z. B/o" R  P V0 _$lJ( I(0  Q0@-0 @\C\0CC/x^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S> P m$$$Kb0$000CS0H00S F 0S }0PlJ(I(I(p@-@ PTp 0@ @@lJ(G-p 00 S QA0P 耟`V `R`F@ V @@<H@S`` S =QQ RU  0P   PF 0G-`@ M G0P (q000e U00SV-00E@`PIPE@T Ѝ00CS0@xP(O- R@@0`-SPM S! C Rd\4?So @Sy 00C Sh0 0 a`z0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666A0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   O ~ I   0S  QAQ$AQ!   Q R V  BR + `w~   0 BR儡  BR  ~ ~  `K E~paQ 00S T 00 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00R(|R(J xP(lJ( p%pP(I(\%V(%O-$M000 Z0 0H'0=,W0Jp00 0 7'0` 0`F#ZGF@Y0/ 0g@P`6 Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG (A+9 6`0P`F 0 0S Z?0Y : @5% @AQ TK[Y0I Y@i ZD5  A0B F0  %T5  0 Z@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R`&d$H$%%$$$$$\&\&\&\&%3  AQ AQ~00AQ ~ K R  BR ~0 0  BR j~0 0d @0RP[ 22 0AT[ @T 000S[@Zp  Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0 0000P  00B 0C 0000000T0 00`P 000l0 GR00#S00 B00S0p0 G0 B0o,[m$Ѝ|00S[0000p0SQF lJ(xV(h%p%xP(|R(J U(<O-0M P0 4ԄдД00C0~Q 0 `p0 @Q Q!:Q =Q Q QX   L  BR  V PR AA KA P񟗇+L((+(+L+L(l())d)W 0S@ЍQ Q@Q =Rp( `p(``# P  BR  wp" w     BR u    u   BR    ( R 0BQRQ B  W `   BR  v v 0AS Q AQ~@P   Q @~  @   }@P | i  ~Rf=Q0Sa 00 f   @V(%lJ(h%U(xP(G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S8000`0`0CS0!0 0@$p  X 0  i 0  R 000/ 0p p%lJ(h%xP(`%U(J( @-0@h%O-XAX`0$M`F; 0 0C 0S0P 1P0 R"Y 0C0PEPE0000C0$Ѝ0000lJ(h%xP(U(BO- aXQ q0@ 0 R  p  000XP P X 4 0 E0CP0 Ѝ0S L H1C008  @D0000D 9)lJ(l%xP(h%%8 ^gO-@ brP0  DR40)0异Q} R    00d2T`P `8 T_ T@-@FT+: PR0CZU * TR Q  S0D2@ P80Z0Y0S@@T: Ѝ@FT: P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C0`FT00 0 D0C0CS@0 000000C0000{0000l%lJ(xP(h%C-PpM@`᠐ 0嘀00000p000CS00 p0@R h@ЍF00plJ(h%xP(`%A-Pp@y0A00CS00 / 0 ` Va000CS00 / 0 ` V`"000CS00 / 0`%c>@-@-00S/ R %T0QH0 0Scq o/P0//J( %0    B /J(A-P夀0@000p `R$ 0 `0T @   0 0C  S000SAeI( %J(I(0A-P` @0p0W0 6P 0X S S0 000 00 0h0 $P   00T /Y00CS0 00SA+ %I(T%J(I(G- b B0 pWcr 0S .. 0R@P܁P0/sP2b000r0S^00CS00  0S 0Y0#S  ] P   UP#/ 0 0p0P0 R R   BR   A   BR 0E0CS0000`0D00S .00y.` %J(h%%p%|%@-L@00CS00  _p00CS0@VJ(@-T T@08     00000 0$00J( %A-P`@000% V |`0Pھ%p0PS Z  D0  0000CS0 00SA3I(5 %J(I(@-4ap00MP0@P  P(0: S$ 0  wP  ⽻P$0 00 {d$%TsL00CS0,00S ЍI( $I(A-h@Q0P0`0 PHpP<0`00CS000SAI(J( %I(p@-`P@00P0%P W 0S00W0X 0000CS0p$00Spp@( %I(J(I(0/ %p@-@,`,P0SpSTp %J(<p@-P@0Sp %J(p@-@Pp P0Pp$0@p % 0 R/% @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 N(5rO%A-R0S20SP`AT p v$q~pp .$\$RP ?- 1N PpW~p ~ 0P 㵠 ) ))~ qP ~p;X  KRp,/X p~ P ~p X  1RpX  $00(((`N(tP(%"l?Sp%pP(0S/p@-@PP1PL1DP0a 0(00R 0S"00D~05#0s  0C?o2^0SP'pBP WdP p0C Ao PQP0S*00CS0p,00Spp@#N(5rOI( I(p@-@\P0P00 V@00CS0p00Spp@I(I(O-@`LM R0 LЍOR,ؐY) PPY   0SPs  0 S S S PQ 00SЀ0S@LЍ0S~22 F! 0R+  p  !R -  x",p 0 0H", xp0 sT R0lp+ 00CS0m+0p W +㴱p^ Z 00CS0V+0 00CS0J+0 | 00CS0>+0  Ѐ YZ+000t + #40  + +P S#4V 0 0p@ gd s+pZ*0㙃#ЀCCN(%5rO/8=bNENS@- 0 S  .^\Q0  @ S0C  C/o "P R O-PP10 0%SW P j0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  0P T"@` P:P \0@00SJ R Q !" R @%hN(wG-$a$D0S Qq0m0@SU @ *Р㼐0Sʰ00CS00 * 0 W+0 R  0 S !h*N(rR(5rOb%A-p@`QP00Sxt10P 0S XjPp pP@ gP`WP P11@,*@V Q@ T0`p0S0 *@00CS0)0S 0 0 00SJ 0 S 0 0R( N(5rO)C%800S /@-P `N(8 P  /Q 0SZ//N(`060S/P00S/D0Q<0  40 A!0 S00)p%tP(|%N(5rO/G-Q`0SS@00SjZqP000M:;@ 0@C$ Q 0000CS0L10S 4q000$100S010000<>00V00CS000S 0S @pWZ00萠@ 0 ZRꙂ! P00 R @N(I(I(p%A-`!@SPp% K 'WVV |1N0S9 U 0S0P{PzV81%Np T!1@ ! !&0@$$060S& $$$V&&U 0S PP yXyP HHyV WT  0 tP(p%%|I(lO(N(R 08 N R S  0S  P p%O-pR0`BM0 pP 0S0S ЍP880@000$00 #"P%:T 0S0 10S 160SdTf P c100CS010S 0S  02, \ Q R05S00|) \~ Lo ^ \ \ \@W~ Lo ^ \ 0S 00=TP 000U(I(N(tP(p%|%I( G-pPE@P ?P1N0St `M@ZzT @VzLpSR v`㜠@0S0S 0S0S#`@Y 0 X 000 -p%%jN(A-@P#P PT0Q 0S wylP@ pP@ ZP@jy|06 R0S@@d`Q 0p) 0 0 Sk9R(zpp%%O-PTdTt,M @P Y< U0!0S05 @nT pTU P300SU00S00 ,Ѝ 0W(P /,P t0S 0SD3 P#Zp `X*00SM T0 @@0 00 00QCZR00 RjUX  *Y ^  pP\2 R  Y RQU@ )260S& p @ Y00P'  P0`0V 00% 0V0S(0S0S 0S06 P 0Q p$@I0S 0S @rԀ0U0X0S 0 S0C0 qn0SY UX r) @0S 0SZR(N(=R(^tp%p@-@zw``Q000 R 0S <1` 4` V0P 40``0S`0S[00CS0X00S mp800P0V0S 6I(%N(5rOI(@1A-Q40@Sp%P`q0SP00CS00 '% 0 y&0Jp $P.G!%PlP000T0@0CS0800S N(zpb%%I(I(@- @ 00rR(@-@ @rp@-`@0 0 p 0Qp\ PU"%00pN(A- 0p\b0@PU RP@ЍR R =RU "0Bh 'Rf 0 BRbccc$cLb0 000E000PS V 00CS0l00SG E  P0(` 0`00I(`%xP(I(T 000@0A00CS0/00S/I(`%I(p@-PPP`@ P T @D@p00C0C0p`%xP(p@-(P(`@0@Dw00C0p`%xP(( A00C 00 0C0/`%xP(-A-@P(MHp@`DpPVP u oT(01 0P @ @`@DPpU(ЍAЍ/T (01 p@vF0 P Dp  T4O-` 0p0PU 60 \0 e00CS0?H1P@0H21SZ0 0#<R00SQ 0SJ'0PS܀V 0@P0 P>WUT@>P0 |P0 &PU000@$P 0ЍT%%L `%H J(J(&&?&V&n&&&&hO(dO(h%D}&F R(xP(h% xP( N J P0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0YP0  0{P BP 10 }0 01{W00E000C00Q#PpIM}PP 1 " )00 0: <}P,p @R<2 3 p BR *p) p|2  BR P=  Ť;= P2 Y%W :W5 #Wh~f 0P 0 g[0G P p BR pYpT3 0 @ R   B 0p3pP3@  BR 5p02!R1S $H<Q C B R% 71 ( C WPP ( R  WPP UP W R rP0 00CS0t00S T0 00`Q RPR(%%|%hO(dO(d(I(`%g(I(O-`0Pd#dCM`s`` `00 t5p(V( PEWUCc 0 pW` u@p00S0S᛿P20SU0SR0sS vS ɶV`p0+S -S X延 @v @Q0 @R: !kP     -PU 0 P0SA<0OЍVF p p0 %  " Q  %5S' Vp"80 Q  0Vp0T !000 A X0 M IU00 DZt-o&i)|-vdO(hO()=)n) )%))*A-PQU 00CSQHq10SL R@ 0`0CS00 `01L00<S0S  50qL0S 0CS>S0SSxh R 00CS00 - 蘴  S*p@-@0TP R R R& 1S# 0 ~PpR!Q QT " "D0600S0T0S 00S0bS(I(I(p%@-@-P @/PUP @-@P bVP0  L  U([*QA-@ 00CS00 P `tpt ?U UH?U!P0P0CS00 `zpOG-@Pp000 T` 0000CS0H00SG0S 00S -@I(S(I(P P0  /\ Q0 S//S(@-b@0pSM910S5 0SPPT,2C 02S p? 0Sl UX U` P.p2 W`RUU0@D>T000 0i00 T10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ S(tP(p%R(\PO-`@TP P@P ,P0FpS`@ PCPBPP34 PP`tDa0S! 000,U 00CS0 PT40S 00CS0 40S P@U00P@`s䃟1 R 0PU TgO@`@VT @c儃Q0S 00S 3@@TP@P @}PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X P̱̑@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR +pVP 00CS0\00S ò0U00 P1q s~*[*%h*S(I(I(Ii j*Ou*Ҟ `*|% +8A-@P P0` pUTA0S 00S Do0@0@000CS0 00S {PS(S(I(I(p@-H@P02`S@20CSpV02pS(40T0P?o20S 0S//S(C-p@`1010r!Q0@S10C1 ЍqXPU X2忼PPM!+벼P 0S ᵼS(I(@ 0P/!!R /S(p@-8P\2Sp@?<9\BpS(0-MM01`"R !R X"R   1 1d"1!d2S ,PPl1, ,PP L!0,00P@P$1, @T0dS`0P, U @T 0S Pд00CS0 ! R-00 0$0(00D>S 00 QSR"!031S(I(I(I( 0@-`"dyS(p@-L@'P%0PPp0C/U00pL p@-T@TP0 0P0 O*0 0000CS0p00Spp@HI(h%I(A-@R`P  Q0PPEU`pp WD%0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000 0 000CS0h00S sDP`0000 0C0hU(I(I(p@-@P@0SH00Spp@00CS00  h%0h%0h%@-@PȰ)Ѝ$+-@-   Ѝ Ѝ/-@- 0  ЍЍ/h% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`P$ 0S! l 0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' O+L h%0Qh%@-@@h%@-0rS˯T+t+0G-p0 P0R(0帐@0=00I=`E`F@VPpPER000 S=S B`` R`ĥ`PGХ@h%xP(`%0@- 4@ 00C00 0 0FЍxU(+0P P PR00/0@-HP@^ ^ R0L00F A-鸀(  R T(p`@pW p0S 0QPU  0S 0S   3/P@P00U(0SfA-@᫬PַU p`pp0S'STP@DAM'ᔷPP(  EBr*+++zpp A-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T Z%*O-@00Sp 00P㼀✠Z  0&@PU* Ѝ`V Y   [ QʁiaP`0pxU(U(40@ R P=R/=R/A-`P0S=SPERPU@'0\0\p!0qV@pT 0S 彊PVpp@xU(U(@-1`0@S @  PPV 0 `& Z h  `R Ѝ@&Dq   R <0 2/0`& 0R , R  00 0000@!L@0P U U0 U00CS0`00S Ѝ@藭Y0#L 00P P Ѝp%+I(xU(I(-x0GM00h0 00WLP  <0  40 Gߍ 0  0  eI(I(A-`p= P w@VPp /P^P0D @S= O 0V  @E#`ЍA50C+-GML000LP00$0 0  GߍI(p@- OX@P0`&@0U<a 0U`00 0p@xU(++"!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ]$Ѝ|R(+R(I(p%`O(p@-@`TP000T 00CS0p,00Spp@袬@I(I(s@-P@T@ aPP0 P00Ѝp@n` OP 0 @Ma00000 00PЍp蔵 xU( ,A-PpU`A0  P%0K%@TP@ l0@00`U( @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =ᷴ@@I(C-pP@0聟rS``PW! 100S T! 0  ЍC]nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  h @0 L @  !W P 圫8R(,/,s@- P`?@P 0 Q   00 00CS000S TЍpQ     R T0000   +$ 0 &$I(I( A-`pĀ@TP0U0   $9 $0S R   0 02/0 #00 0000xU(P%p%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X @V R@E,R(PP@- ߪ WJ,C-p000P0`-S㸁@TQ @ 0@00`0CS0Vl10SR ЍC茪 Y@P=9P ~0 @0 00  0 00 00000  0  RP 00 00=Sw Tt0T 10=S010C0 0P00 ЍI(xU(P%p%I(  xV(p@-@PTpt@p@-魴P@`P \DNP@ xP@ IP@P(P0 P pU|,j,R(00@/ 0S0@/s@-@0 0,P`0S 0"S U1r0!l%*0S`0T000 @0C?o2R0SЍp,D}&-@-M@ KP ލKP@D 0RQH0PP0@-M@ iKP ލaKP@D0 SPH0PP0@-M@ HKP ލ@KP0RP 0RPA-@`VKPI0 0SC PJUA JPPP]pJPJ! 0RA4"@- 0-RS# 0S0 00t? Ѝ0SX0 0P0S00 040,"P$<  , -4 0@-0P!S@M0SPЍ0P{ 0SxPUo U U Po U JP? JPPEUR ,<L\l P  P  P  P  P  P  P P p0St00@uJT @ J0(S0)S0 0qop@-@`P(P} 0Sz00CSt 0@@@@DpToopLPFAP0`@,TV%@`!VT`@V@`@ P`@P`@V@)Fc0S0!SPpp(S0)S0S pp@-@PӹPPE͹P.U)  ,@0op=Pp0\0!S0P p(S0)S0S 孧p+-$-@-0B㰧Y-|%@-$0$0 00 㢧I(|%{-@- @" R1P\ * 媧Ѝ-O-@`@M!T0pD P-R lRC 5R -R| `G@P{2 000E @PppGWP 3PW pGP〢倲PE0%S``PX刧pW ;sR R`6pTP`2wPU W@1 000 PPP@U aDP@ 1 Gp GP l$h9Xٸ@P ZG@P0S0Sp@Gpꭽ0 0 k `X0 R P!q *S0喽 0R dS  Gpv   TTTsForD}&1q . P./.%.8| _. 0@-DM;0   0@@DPU#F@0 =   FH0P x, pp LdDЍ0=P J(J(T...%k0#".\#p@-W00S 0| 0x 0p0p p@0   PU P@P0P H0H P p PpI(J(J(R(T%R(%%h%|%%p@-@70@Rz 0 0@0PU@0002A d0 R 00CS0H00S ɥp@^@C0PCI(\%N(p%I(U(I(P/p@-@PTp000@p@-@P6@P 0 Dp66@PH 0p W ; PuY <YFP0P 0ES, 6P xL0ES^Y0?S0 -S00PH0,Ѝ \00S00H 8VPH@7 I0k0q0y000s@-0@0 0 \7XPX`Q RP= 0Ѝp@700 7 P1 I1P1O-Mp:~Ps]0䁟䑟䡟00SЍ#@P 0S =dPP Y]00  wkc[h孱P 00 Ta4i[D墱P 00 ,囱P Yk 0$0l[危P 0 0o[ ჱP 00 |P :k 0(0 `Q 0 SjP00CSH $k0 0 0Se1, 1Bz11 /1110K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 /@0D 9K<@0(080$00= 0D00<00,0/+$@0@-0$ 0d8 Ѝ@-@4000@-@4000@-@(0(S00 0@0,0Ѝ`t p@-@G?PPqb8`<^@\GPD[`XUT\R`, 8&?`>?V0,0p8@-@480,0@-@480,0&6^ @-8@6F( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ \@P \ Ѝt1@-O@P\nt 1@-D@P\ot 1p@-0MP`0@-S00(00P0 0  P%4P 0( RT  0 0 S40(vJ03/Ѝp<0 1I0A-@`PpQP-U@QP00  PP 0-U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp8 , p@-$@P0S k500PplW(Q+  0 BR@- :5 M| 0- BS^0@Q ^ 40 ? 0 C  / /tW(lW(q0p@-hP@`V Pj5pY`HV4b5,_5Z50lW(TCzpIi C-MPp`@T HA5V@P 4 @$       @     T  | p d X@<  Hy <u@ 0q $m i  e a ] YU Q M@D@ <$A 7t@  < S S  SH  D6 C"VyP   W        @uą0ST  le4" `4X@ tZ4@W `T4t @ Dx8l ,` TL@4(@  T4 @QV \ T@Dt8 0d| \ x Lt  @p8l(h d`3[@V RNJ FD|B@l 0@:TY h3Vl2<08 *(@@V  S W   2VxApr`VЍ00 d2 @V   Q  20넑0l  @2 Tl@ p22%3-333;3B3I3P3X3`3i3r3}3333333333333333344444$434v22;4B4J4R4Z4c42 z422 33&3.343<3A3H3O3W3_3h3q3|3333323333333333342444%4-422,422~2r2z2:4C4I4Q4Y4b42j4q4@-鮱 u3l04v&@-,0, P 0 0 e3\0|W(4v&5s@-@`ᰱ000 #S@Pᥱ0S  0[X00S 0 KXЍpzp50S/#Sp@-@,P$p0P 00p|W(厬@-PRP@ p`p 0R" Ѝd0"S0SO 00SS  00@OD}&@-TPL0 p@>0"SWЍ5W(5@-TԚPL0 np@#0"SWЍ6W(6p@-h@P0S 0S 0SS <<< U   S(X000P 0pW(C[?66p@-Px@Q dWP L0   P    pp@ @H R6W(0@-@PPM 0SLD00Ѝ000 0>P0 0 k6W(6O-Pp`PM 0S<;$ ,  P 0S ߍPꃯ0Q 0S @s?0P P@ P@0 ST WpU: 0S  H 09/PV` 0`W(66U66@-G0S S S8 4 ЍgS$ Ѝ7zpZ7777@-lP$ R\V;@ Hf $0S p (V V Ѝ0W(8](B8m8p@-@P 0Sp@巖0PS 0P0᣼00Sp8@-ɯPD@D D`DpD0S.001 < 88v&_C-P`PM 0S00(p/p0 AP" @/Q `0p0@1P T0p 'PH$0@@ 00Ѝ k6W(W(8G-@0X T11 HRD2D1<#<(1( 4 $1, ( 10 18 14 1#4R!  1!4S 1!4S 0!4S h0!4S L0p!P0S t00T!T0S \0p(HP8W ЍG财0S. a`` G 00 0 00US !S|  !3 \00US:3 0U  $0 0t0pP8@v&H Vzw9999998$9r-969?9H9Q9Z9BBc9k9p s99p (O-Q ,@Ql'P0QT 4QP@PQ,80S,00 80<0S804 <0P<PP<P1 QB"9`㤱8X0apS pR   <0RXP 00< S4P0S9`(助Q (僩Q @P0S0 BS `a 0h R  R* P*da (Z9999990:W(r::;@;:D::q;O-;$M p*g bP 0$S ? ߍS `P@T[D@P 늤40 婫X ZS' ("$0f0Qf/ j,2!S!R !SS0䡟1,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2,"b"!4b4# S 0 Hp#> 0"448#8 R* 0S 0pjX P 0S 0 p1Sq j3  @p.1S jQ f/ jp01T T %Hl ](W(;;VEW}};WEVr; <O<z<\Y(@v&A-P@p%P` %R 0R000005Sw D $0f0Q $S  W(](<W(p@-0@kP  P$p@`$0@-0S ,PW(@-P  W(O-@:P,kCM M00 8KP( 8TP008⌹80p0SP :፞P  $@00 tY x ҧP 1(p X{ p@ ħP$4 X p: 0 $0%P$0S  $02P P pGGqr嚧P,圙圩$ pW 0S$00k P$00 P$00$0 P$00   @hP pWa 0SY] 0 0$0P @2 8$ 1\ t$ aP( $0S  S;Ƒ8@z0;RZ(( .P   %$P  P0 0$0P$0S ++RP0 0 F | P 0 0$0gP$0T0 < P 0 0$0VP$0`0 ݦ P 0 0$0EP$0X0 ̦ P 0 0$04P$0\0 |廦P l嶦P 0 0$0P$0d0 (夦P  50$0 P$07 咦 P  l50$0P$07 {偦 P  (50$0P$07r jdp P  40$0P$07a Y$_ P 0 0$0P$0x0P HN P 0 0$0P$0|0? 780aJ0S0S  |vP0X: `X0 H0I070t 0 ST 7 . 2Z/ \娷0S 1 #0Գ000S05 0  3000"0$0 0 0 $0]P *@$0!S D"@ 0$0|2$ 2 ,@pCލ Ѝ0S 0喜  QP0 _pP0!A"A倜0S 0崡0S 0C RS񟗚HkaHkaa laHkaakaaaaHk H#0S0 0S Pz  0$S o 0 S Pe ~ 0$S~ ڤt 0STsl 0 Sk PI b 0$Sb 徤>W W(<86D <MM!M< ==W(/=>=W(zLW([=h=|===f======== >&>F>W( D}&g>>k6s@-`0PU V  PeF@P h=Ѝp`PD!ި 00囗0@wV  >N$00S 4@-00%p@-@5S4 0PSP p@_Pp0S 5S 1S PP|Pp5S T \Pp< HPp%((( Pp7PW(W(`>edArdA ?s@- 1 AP(000(`;a5 S4 5S PZ0S V0S005S  Pt| p0pPX)"5S ЍpH DlP8 WEVW(fd?md/?%XpW(gd@?@-@P f/@W( 0 I%](md0S/!  -3@-PvT ]P 0S S@@  P@Ѝ0@ Ѝ/u&p@-4@4PQ=p@`) ) @%EE@-t@t0MQh  `P0cS CS SS 4_sS00ۍ0}(fEE0@-MM@` PP 00YSP ,=ۍЍ0nP FF,F 0 \](@v&@-@M0 vP ۍ:F{p@-@$P  0p@ o@v&\Y(\]( @-YMM@p p\ YލЍ<0< S <fCPژ10YS<0<03)rdANFgFF@-PM`pW@(WXXaX`8WYYX (ЍF@-P0@ 0$S0SA  0`Sp7 TQ,BQQ,nSt10S+ 8@0 ḡ 000!C0ASutututuvtututuutuutututututut(vc0A R(( Ѝ8W 0SZ 0MZ`(pW 0Z X0>Z L0 806Z ,0 0.Z 0}(FF@@-\@\0MQP  HP 0nS yS0 $(00ۍ}(TpG8GP `00CS`0p S00 P0S X0X /X)u&G-P 0p`0C@P NE(pG1T@Y @ 0@H/mPp Eǡp〠 0  aP U  `V `` X ЍGG0s@v&O-@M MhP`᮴X%XTuTT0S0#!pD P  P M P'p0 p( P \ NTt`(p P  [P `'Z⾺P< 08 Tt`( p P  y[P '0(0Ss`, p P  b[P y'0,0xSXs`0 tp P  K[P 4b'000$Sr`8 ]p P  4[P K'080Rr`4 Fp P  [P l4'040xRDr`< /p~ P  [P '0<0 Rq`$pg P  ZP '04Qq`$pP P  ZP &04xQ`$p: P  ZP 8&04(Qp`P p# P  ZP &0P0P|p`T P  ZP &0T0ۍ ЍRG\Y(@v& dG& uGGG\h GGG H'HJHjHHHHHI8I[I{IIIIIJ:JWJO-M@ M/p PS `V30S0`S@:P`P8apEbWWnF`0E `F 8ġk됳0A"S0#1` pVp P( ATiPD#" 880 BP0S  3/ PA P ,ࠐRx%.A p P" 4SA4`S>94`P92a0C" 20< S :A(%"YA%x5|%.A  p` P0 x5< A B0qpA%A 0Q<0PAHx[0x5< 0RA | njP 0 000S P0`p崀(V R s S 0 00 0`PX~%ލ ЍuJJ% J& JJ KJKKyK1KK\](@v&}(K - BR0 R &A-P@& R1!% 0%0 %lX0 fX0 p`X0 \Z #( H%, <%0 0%8 $%4 %< %$%$%$%$%P %T %$0p 1R0S*0X`p\PQ %VlAqL QLLL MMM M)M;MNMcMyMMMMMMMMN\ EO-pᔀ 2MSR R@`aX 8QU ,[R 0Ҟ0 ̞  =0@" 9$ 8 彞,  ᶞ '`@04" "$ $ 02% !R21` )% 0S 0C RjSg,,l,L,  1 0 0p%8QI T $<0P+8cQ* 8 0A0̝ @$2<0P+8IQ *ЍOI0 0 0 0p$ d$8 T ЍOЍ)N2N NNVN@Nr[NNNnNNNNA-@Pp(D$<`8SAo 0`NN 0`( "4`#/A-P@ "440 "440 ơ ¡((,,004488<$<"444$D"444$D"444$P"444$"444$`"444PTTXlpXQl`pQ("448("448P`0@`V@  |0TP0A0T0A T"440AW(@-@l40Pm087f/=WEV@-@LP TP8#!00Q@WEVW(80@-0@S B08f/TY( 0\ P0//@-ܡL0 D#<<8@8P(` R  0# Ov&@Oh%9SP7@-@ PTP0 08P8 0,p0 H Ѝ0*}(vdT0@?o2P0S@- p`Pɜ@P ĜP 応P 府P@V@l屜PH@T@T ,p0 4HH@@ ЍQXOR}(udT0@-PM xdP@` h,p D)H 0 4]"00+ +U"Ѝ0}(zd@[OlOzOs@-@ H,p  H0  9"0 3"0`P   *"0   #"0  h"0  P"0  8"Ѝp}(td@OOOOOrO#PKPoPP( p@-@PM`P㹟 +p  ( ୟV V d!PЍp (⬍H( +p 0G 0!}(}d(@PdD~d(PP0@-PM @ 勍P 8tG4P 0+p0 oGЍ0P}({dЀTC-`0@Pp!匁匑,M00 >p0SP@TTA  +p  0EGeP qP p` $0Q 00S*@P #GQV\!W V 0" R00J!tP 0S,Ѝ00* *  :!`@t-o&)Q}(|d,Q;QpQrN.QQ@-P$M /@P +p pF0P S UD0P 0P3 0Pp@3p@ 0x|@dvp@{U@@PptcidyaraUrbmngnts.r qpzpU0D S/ 3C5C$1 4! 8<0/ᘁ(0@-4A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @ꘁ( 213/P/(A-PT0p(,`@,0T@@DA??@蘁(?0@-0@0 (20,20㖖0P!P30蘁(> 0R//G-`0(,Bp Py E˗@PPW ,20CS(20CS G0蘁(RWMWp@-@`42SM%^  E 82<"@x 0(2,"qЍp@lj<"82E@d]` ,"(20@RX"\4Ѝp@Lꘁ(8%VW_WWWWWWRXfXXs@-P`F  R0SЍp00S@50"S1Ds@-$M@00  0 0rXv&A-`P 0p @TʬB /,s 0d  ? ϓqp  RЍA`%L`]%0S`@D@, Ѝ8%[[(A-0ppP@`ph!14P S H d" R S R 0 Ip[U([p@-4@P0S( ]0B1p蘁(O-PTM0$ (00#,0x0@08030匠s0<080S: (2,3`sa(0,4 0=40D$04 @?2$0 0+$0  00 "@ D00Lbd"P B$0( 00,0 8 0 RL0 $R0 S t2000#1-R0" 8LhL`P@4ہx0P00S mP  gP  aP% L`ᴧ0L00 S? 0g2< tjE%KUP1`?C$5\"0㪔P@\2S@0x0@XRx0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (0 0,00 0h @$PTЍ P @Wb\(8%\(u&H\8D}&,h\k\o\\-s@-@{00CS0 |SP` Pp pp)A0 P00CS0eS0 Y@oЍp@Ѝ/u&\O-a0 pAPp/B$0e@O 0qp Ѝ  R ЍO#t`#0S 0 qp `BE, h#0S 8%\(p@-@P2S 0p`n/(21!41#41U &"U 80U p@@PC @⨘@Tp蘁(((G-r@,\6`P @` VPmYTLE J$࿀,|U 0V!U ! [E@s_Ps ⶘X2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@t000蘁(GGA-\P@PAds 2FY t B B$C00C0蘁(O-Q40 Ѝp0QSP LaXR XF0 pQ 0>80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ \(\]O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y JP9?Y 200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$00C0@@PAy`d1S  14P8 <   00P2S. Y  a14a8a<0#d1a#h#0)S Z0)S  R0 Q !P<00 0l0<   0S8&ꘁ(^ ^r^8%^ __S__``_^^___U_;`^`` ^(%`.`A-4RUP@P@DЍp(0PPPB1P@TaTaTS <ЍA0!14!8!< 1 11p 11!1<0 z 1u1 ?0o1!1<0d f 1Pa 1@?0ЍAYꘁ(r`````aa%a6aGaYaO-0P4MpE``d,0 q 0Sၤ0od\,("/op" R 4 0$ 0  ( [ 0[䒑 Yy @ `D pH L( @P 0d0h0l 0XS T0@Pt˟( ppPppW;0} @P8 21S /0.3p00102044p58<0 TTpQ4 R:HL"T /"R, k4Ѝ0(2o0h(0}H 0 (v 0 (m wpUt  @D H L(@P0PXB(@ Xv  0 `d0h0l9@`V2SjW 0l !? 49 r,pi  R    0$  $  0 0@PPT0p V0S P8`@V 0PS$0 @0v 000 U 0S@8Xb\" 0SR ` 00 RV0P@0 0z P`@,p0S{ 0 00@7P2S W[: @P@~  ᱒v 0@ pR,'0Q0Z08!2 @PSppaQ $ 0s ^A$ D 0 H L@   @P0|21S  "/0.0010T0 3p2044p5 8<0 T @P @P2Sp 0 00@P52S WC[ @P@ 0S7 2S H"%>0 $00 0S- 1S*  W000P$  00SW0!14!8!<!14!8!<W p$ $PLPD(P0 S( 21S$ / .0$40 81 <W S  PW 32 $45(, W\ 00$0`@P`3"Rq2S0 h90 00@ P 40 00@ PWS (00D#$0 #(#< 0&4 0&80&< 0 0p `xR0 @2Sc BT0cp%P[ 0 1<Ap 04@@,2`0C 0 0@@(2 00p ? 0@@pp0`Fa ??`1`<A` 0@@,2`0C 0d0@@(2 00 <0@@? `Fa?`?``0S 2S@ @TJ041S0Sd 0s PX2 0 RS  0A04o(Iꘁ(jaar(a5f a&azpabb#b4bDbPbO-HBp42MgS0孟P(r(b42S 0P*U42S 0S 唟PqЁ 42RSfP:兟42S]1!$1(1,ЍO0Sd S^` d04兤Y2S L` ` ؠ0)P"PR S0SЍO9+@ D0ЍOSPy 0Ѝ蘁(^b(obbbbbbb c&c0c@-0@M0@ pp`PLpߍ\ \0  0 WP \ t02S 0S " `P D3!SR ※0PQ^?cXc(ac0@-Xa0 0LAP d2S8 P(F!p! 2SP0U0 $pt"* Rp\EU$p0 00P d2SP P@  Ѝ0P0!!1 8%(md5?(cc(cA-@T2 @PՋP ЋP ˋP@ `p@T 00S p`V@嶋PD00S @@婋@PfXOw(T%A-Pp`&@%%000 0@@@A-@pT` URPP&0@ @%@G-M0h4 P@ TPD _P @ 0YP(4 00(0 4QT(0 ,0%4@ 0#0@,0S @@((@`@,0s0000CP倃0P>PP0 !01P,30  ,3Q #  c0T0< Op@8 PA ,0S ,< 00S< 00@ $bP&0FSʆ`w%P0S -S@= uP00@@P,0S ,^A0 VP ⯊8800  0 R00S' 410XAXQXa400C0  C5t0S0Sm0S0S C 0S C CC|$0#4 ܍p PS P(r6g Z vwTwIi wwX%7r w T0/(0/(0/(-@-$@  $  v&G-P`p@0S  0S X| hU hTY0S 0S@ y (&!y/y-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  J C-@M Mq` @pPPݍ Ѝl!rp@P=0LLD@rOVP,0: S0RP00 0/)PP :P81: S  S U rB)PPO0L0P%PPPU r!PP @P( _y(zpny~yyy@-@0P  0 00$Ѝ  y(y0@-4S 3/ (@- 0 @(U 0$咍@ (@-@eㅍろ@@-p PL`@@0 7/P0 S Ѝ e00ꜰ(O- MM06@  @  @ 0p$000 (0/P(LL@ ܍Ѝp 03/0P0   E!P @$0PS (0SDUI5/`P 0 W U euX0YpY 0 `  W p[ 0S $P % 5  e@uUT \ 0@W0SU 000 !0i 0S# 0S,aQ e00CS0"D@ T 00CS0!D P @YT Y@DOoB 0Q    @OoB\ 0 @0  0 0 SNT기(f{t{u&@v&Tpl{0@-M 03s0c00@S}  oPP* R!PP<] 00@    0PS  PQ `Ѝ0S  0S  0S\0S\  0/@ \0Sp 0@0 @"vp 0S0S忘 @g0S崘  @"  @0St墘 @D HP@ @0 @ `!0xP|"%#   T`    P @@``a/ F] x Zp h 0 @`기(İ((~{{{{{{|6|B||||y||G-0@  0P 0S< 0  Q*a  HPPZ   0`P f npЍ!URQ PB l 0 p H0 0W40p P , 0Q0   040 04!$0 !0  0( 1 0, X0`P`  PD 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0pց00 QP   d 0P OP |yOpP1S1S1US1S 3S3S3US3S,  pP0p* p2 02 121300p0ኁ00 QP  7   0Pp00S1<01@040  0f40  QP   0PA0O A0  9OP 4W ԡ 0R  N eYigeX`V P0E 06#++R`HX8 $0S,0,  RT0CуD0"P#10P  0QL \0   0P 00P00h00l0dd@%}=}W}}}}}}}}f RRaArrAaU"~9~Y~~~~~f-@-p@`P P00 P0ᶀ 00QP  Ѝ A0P< !@ !0 P0ᘀ 00QP 4 0P}"~@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  k ,zP000`!cG-Xp` P@P W Ѝ0!0 0*XY DF NX0 X0 PO-@,M0p@l@$0`P PprP$P &@,Ѝ چ0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S 0 Q q 8( $ 0L $ P 20 2 p(p,"  @ "  p@! P0@ S  2"!"0  0@pW5~0P s s// /ᰀ߰cO-`@PpMP0S Ѝ X  H r0A D00 s/ r qh  \*P0p@P q x0 ` P 0 00  P 0 00 ` P s0 `P pP0 0 P`8P 껀f 1D '<R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0ꊂO- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  3 0 TX  R 0 0 p pP YP  L BPTR2 Q PEꥂ߂!SO-X`0pM@PP`Ѝ 㨄0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/KP Ṅ  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0!  0B}0 QP \ PG-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0S"P  S`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@0ꦃۃf ۰[@-?`XP\@#@3P@T@TpW @@T`Lȱ(O-P@H@M18p p00TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ0 0 0K| Q P  P0 W:0 0 08| Q P PLR 0  P<0T 0qBȰ(W>O-M@L0Sp<`@DH S!-P PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:qɄȰ( A-@/pp0%B?[`0S u0ES PC p@@0T?  C0Ȱ(0 PK %/Ȱ(O-p 1cMW, 01 SP0 S@0Pp(0@@D0 0$04@|D0' R$ X0`1#b#000<< 0,00z{<00 QP cߍ0P@4p(0@pD0 0$00 C``02#  , PV002800aL0`FL08 SD00S   80< 2800,0008{<00 QP  (1 0H 0  RR R0(104D0L0 `0L0C < *9P.  (10(11  J  , 4 0B0 D0P 0D S140S  ZI@(1  0I0@;+ 帀 P(10(10@4 40 0S_ 0@ H /o@0(0"s R$ 00P p, 0壁0(00$0@0S@0! 0C@0 0@ 㓲"X 0X  PP  :X R: U$0p 00pP0 4n U00 00pPd(@\Q UpW$     Pp PK/\T g0x!P0p00pq P$ b QQ#hQh  0 U P p$pp000 0000 ,p@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W x 04L |1r 8 <|1 0W4 8 <1u0U`0  0\}xQ1PP|!R \  P PPL0sPP|!70I|1@|Qx1U0P U* SR   1S \ldP@ 0 00000I1@0h|PP 1|!RJ PP 1@\300 0Q (0R{ U$0p 00pPs, uun000U\`0) 0$ (\T P0000T 0 00P0 00 ,D@W 0$ Sd1Sa I^1 S0(0XRh|P0S 0Sk \cxQR P0R*02S 0S0RU 0\2SI\D|!1xQP =PPx 00I@ s 0 |1P &L#P PPPPPPL0Is0PP@1@S U @[Sh|P=PU p|1WS P@ |qppL0Ispp@P !SP{ p8PP 0 1|10|1#40L0s_?00010PP # K/\PP05aP 5P0h00h0Ed 0ES:\P P|!d1HrH"HP :0 @0|12PPp78 , 80PI 02S0P0 S0 U$0 P 0c000 000 000 ,@ D00S< 0,00!x<00 QP80,R0  PI Pd01S\+0!X&P %4QIP0%8%\0 P@jȰ(>W%, 6ȱ(Umi  S˅߅%G߆ $c;G- p@r W pP\aPP Pp $PK/~D08QP0Q:" 0PS00  Q pJxPh`P 80"8 R 00 05 !$xȰ(Ňc:p@-@5%SQ%  5%QPR 5UUwuQQp  0Q   0Q0  Ȱ(A-lP`5p{@ @ 0% Ņk@ŕ\Ȱ(O-POMp0P* b5S 5唢@TE  :zP@ ET XT 5d 50 ! S$5"R$%P0SOߍdP  RR @`0d B2" 0v JQP d Pd0P Eh0K/0h0 }0 @!d,qr0d  01(}  j x}  t},10,1#40L0sK?000/1001001#40>000310 00 000T0 Clv(%,5QP Hd d0P ˆȰ(!(̈\h @-@ P w0 5Ȱ(0/(0/(0/(-@-$@   Qv&G-P`pV~@0S B 0S X|9 U T.Y0S 0S ~@ (&!y/y-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @PPݍ Ѝl!rLp@P=0LLD@rOP,0: S0RP00 0PP P81: S  S U rPPP%PPPU r0PP @P( _y(zpny~yyy@-N00P  0 00$Ѝ  y(y0@-4S 3/ _(@-Y}0 @( 0$|M}@ (@-G}@.U||=}@G-`MMP@p`PR0 `: SW/Dq0P  rR }00A 0C @H#@ V& 0S UP0P帐`0PPJ0: S,^0"K@PTP&P wP  PP @u3M`@ S @ S>@PPZ GPPn UD e-%@+S R UCPXp!t0#4PU00`P00D!$ @P2  }P|0S `X UPiP0 _PP aW80% ܍ЍXnVPUz fNUv TrU 2: FHF F@ 0`( "4`#/ p@-"440 @"440 P"440 "440>^ $(0 $({ XX {ddhhllppttp p@-"440 P"440 @ ]]]DD]@@]HH]LLPPTTXX\|`\ `zp` pz p@zp@-`@"QUpf@p@-@P]]]]pA-P@M4Q->C]->CBX?X\<\99>]9>:>C]?n:>CF] 0? AC>|]}C>Gw]mFs]EnFo]E~Gk] 0X J~XpW  $$((,S>,H]}S>GC]mF?]HHLLPPTTXX\\O-P ! "441!"441 $$((,@,0`Pp0Q࡟\5 S L5sp`PҀ0,$ $Q p W avTrTpXnX\j\`g`dddhah`l]lpZptWtxTx\0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P̈X <00!Ч8 %8 !(0 40(0,0 R0(<0 (0Ṣг at 0 $ R Tt  000  S:0 0P00 C c9à30S00  S8%0@%0L  (0Sw \I z$20Sg 巂0 0 0 000$? 0 6@ptP 0 nU` p 01S0 $400(!(( x(o? khn4k( h(g,0 R0(40O8L @  H [! 0bM0P000 ʏR0T A'' 0'2 P/,P)8 $t2 t0 _1( @(  Ph@h(4D( ((d%ȉغ(܉\(O-M`@ ) P0I: 0 @0P40$? 0 ;62  BQ p{("(qsQ<042,0 S000#000 wD2pQ 04  0R  @PЍ( 0Z  0 4 Y: |10S<000D0z`&2 `0 0Z 020S 20S 0[` `$110010S ?p1p1000 . *d( (T(d%H(D(O-@PFM M X `:rp: 0 5 R|"0hSD 0S00  000S Fލ Ѝ$00 10000 0~4 H0pT00X0400!0S \`  " p$0 0[h~"`.P P4 p\t4y"0S$ L000 0s HP #0000S 囀0  0v.P0K 0 8 s@ o  0 0S r \  P1 "d.P Ѐᴢ L000O0 H I { 0-0X0|2 0J0  000r00S$c 2j0 0H 0Hh [ Z0# 030C  4 S 00403P!p1 0l 0l0  k000C0 0 S <   0 0001    t0000 0 !0vs  0 00S غ(D((d%e<\(p(1*h̰(O SڊG-P`M@HXpAZ 10S t10S 00 0N P<ЍG(@PEU> 1 RP1H W0  P!`0 H0S$00S U ] 0S H0S G 0@ЍGfX7-P H0 ЍU(غ(((d% /EQ\( 0`( "4`#/p@-LP@088200@ 00 !/0@0 pp(00S 4 /T( 00S/T( 00S/fST(P000R0SO-`02@ RPMgD R0R0`ď080S  C/ S ! R 0C00 0@ ἰ? 0jp\5h!S 0 00Ϯ0 ?@U '  ϬR7 R  0 \5S0 0/070/0 0 Ѝ  [ T R  P00 0<00/((ܺ(cTË܋P0O-@P:1 R0* 0똑嘡0 `P3Qx 0 T B:\500 P  10@(Pp 00 p4000?000S* A0 0000 0 @0S$p0Yl 0 `00P $ 0 00000 $~hQD(((H@-f ri녎v&s@-@P `0S 0S 0 g ЍpO-xEM` MP0S 0S Hp P 0Sލ Ѝ 000S  P `0S 0S 0S >0S} 0Sx 0Sdv0SP.0S 0S0 08Sd s/2#' 00 " " 0D@?!? 00? 0_ 0_d!! 0_0 lpP 0SS "04 0 R0  0"? 0 , R*( ,4ï0A+8 ?S%78P0<P0Q R0" |0S lhbPUt @0S HDb@PUn z,0SP@PPDPpH0S  `Cn* lLxl%|0S ll@0p00S0P0/% 0,0UA:000S 0S P H1 H0S 0S,0S P  ,P   000(P 0S QP LPP MPغ(1H]Ï&Kj-4aݐh(| 6g O-H0PSp`M W0R0: P p`0"E,"0 S n20SQ rЍ@ 0Աԡ 0 000CSY?00 1> R. P!\!0  S P  P (  . 80< 0 @80< `bP0 W P 0 @$M0 S@ `00 R 0SQ Q\ 0ꚛ0(غ(Ē$((ْ(\(В(00S 4 /T(00S0`( "4`#/T( 00S/FT(O-M,M1@"@ pW0,$ :00`SHW ` p)P( )XP 0 00 0؍,Ѝ:00 ()P  pX)XPh0S  0D k@ P c0S,  c ; ; Z  W 054%00! ?0S S :00/0S 0 S :V00#03  R00S l:0S7  0X 2P: 0S R< kP0@S0z4`Ə5 K)Q9000 B?e]pQP%90S  0  0 0 L 07P 090S, bTP09 SPp0 SYQ980S5  V0;R00*h0S- 8((d0 #0 (P fd80S (0 0x0` ?@ ((8J70Sh0 0! 7'(5SW/V S:'<V  3 #\  RHSQ; 0 0B D U0$00(p aL7 UPP0vX ZwPe P'000z@ 0PP6CPy"h0SPp%Q_'qQ PpQ^q U0 EpPQ Ppt A?7#Rp 10S0AL 0(  Z$0S 1000S 50S $0S 0#  t ?U\$0S 1000S 50S $0S  <l 10S0ꊡ  0_000 04 0 S0 0 00 0 0h$0000 #600SH40S l4 PP @pt3000 00S1 LPX00 H00SS9 0S 30S2 \P&  0HJDP  2 prLtoPd62 0\00Q&&0: @000S828040/<0a0#PQ8`\@P 1P0H0800A;\Pa`ppPU0\(85  @5D0L 0T b32 R p'@ `글n|$\5Sc%Ϡ<# pD ?(0 _D40S<40W SW ,4,t`V0`@0x@S d0,  [ 0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A 0 Ń># 0S  !0S\000 T@T`V T0?  @`@T` 1 0X20qA000Pᬿ0P0$W !^0 00 pS ;*00p0 VTX0 @ PX`` @W0`3V5 R 01<`7: R 0@ 0 00   0K0 TR 1VS0` 0P   W@*  A 0G^ 00|((T$(((,((0(T(D((єv&غ((U `((0(LO-` @ 0Mp̰̐ 0 0  BRЍ PP U QP |` @ pQ RP Q @pH(( 0`( "4`#/O-dMX ]0PpP0P1P 0L1L H1 0,0SdЍ0S @d0,`Y0 `00@ట 0D RpT0 :H`P 0RA0 ST TX 0S @PptS(((H(yv&D(T( 0000@/00S 4 /T(00S0`( "4`#/T( 00S/@T(O-LM`PV`@@M,:0S 0P *S *`0080< 010S y0 YP0 X P ) P9`0S 0S T)D P00 ,9 #R0p0,0S01000K(0 0!"4410< 000800$k0P@ ` \_W0@0C0N \100S 0z YP 0tE0 S$ 0S '00P7~`| .0,0S0100@0J@'0 0!"441('p` 0pp00ppP*0S  ZPa 0 1D`YNPU @ ` D D80< 0 80< 0@0C0Ɵ 0 00 0Q.*0S  P  0"pWWލЍ0S 80< 080x5 0< S dj0 00$001 ?D_ P 0S 80< 0805 0< S j`0 00$`S! B("( p D ⴑDP@180< 0 80< V00C0 80R<.PSR$ .R  $PPP3P`080<4l3 R0 *3 006P2 0 0q$Xp0AS񟗴(У``P0SS 3 00 20S40000MP t2 =#R0؀2 00 #R0tQ& l20S`20ST؀ 0 P  : S000 0 0 #R0 Q   0tFQF?d!d  @10 S& Li#R0 š!ɡ0S  0R ؠzP1  000p0P``0P00C0X?P8\  D(L((H( a\( ST(c0<{Еܺ(Ζߖ{غ((0:ETO-WM M'0AS{XԦ0Ԧ- wP 7 `ml hjP {P7 00T@ , 7 UP 70S 60V6 eIX TZ0`06`00100V0:6 Rp0S:`@aVyPVWލ ЍT P@P   3o 60S b @ F LqE!0 0%0@(0S S㘕u%pUVXpG(pP, 5 2  B. !@ ]450SW 0$0(000]/0o 50S h(0pAp(V4pG0(pSD ZpQ(?R,pY40xpS@09Y(0G5 ?,0 S1 # (R& S000000Y!"!"5 dxhp5  (  ]/$   ,0 S1 #( R S),)-*-ؠ d ` p0S(0S , AY2(p2W ,@R@ )' 0x AT!W"!"dh TR@ )' 0 AT dx@0 (0S 0$ QP 0  s00 ~ 0$ `010S x10!l10!00C0L10!tP0 Y00000C0!" {pI0Sz@0y 0 0C0t 00@op\(ВH(d(t($((aҗ(v&D( ((%غ(ET(Qܺ(K Se00S0`( "4`#/T(O-В"0`1CĢMa2@Tߍ0S Pdp@FDAG@D0 ddpH00@00C0 00 R2PU 2PU0p 0S0S)P@R1PPUPRPU P0:0000S 00"P D100C,(P X PW0P0!!0` 00p0SL" dTaX}!Pe 0 0q X000pATtd(t((v&غ(((((deD(Ș!  R1\ 10SK0T!  0d!S@1`0 ? R00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0 ؠ<0 Pp?(|(T(0(T(U ((P($(((00S0`( "4`#/T(O-plMX V2嘒嘢00,0SlЍ0S @d0,PYR0 DDPj000P0(@1 0 0 0DRpT0;:`1AQ \`X00X00@SRķp\t`d`V %P 10S  0d@P=P 00S  0_Q SR  00J Q  000 P  H 08D̰((v&`(D(ܺ(;e(O-oMM@P`00 U0|2H?0SX0S $5S$0SXPYX0S $XmX S Rܞf>`0Vd2 P\20+! `" d" BU00!X d"B1h21$\Pl2LΟ\0C00p21`t2QB1l2>V 2l20CL0=SLq Q\20B  0S 0 $5$> *=>=0S ,0 0PS0 $5B111`R B- 100 S  $|0S%  0帀- 00$%BR0Ө`S<B11@%L0jPP H VD PN 0S  <Pt| *堀+=`<T<0S 0 00\0 bA?L04<5A?X0 =<0T0.H0Tt; 0VHRQX0h0@ @0T8 84<ϠQ b{ S Q,0 S[?^ @P= ;0S @0 # "@0A!" !@0 ! @ @0| ! AP: @ @T0009|J*<p: d:0S G0 0؍ߍ0<00<`/  `!.0i0S pd,P 0 PP *000^00/\<$5St2 ` 0h pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0vP3 !D0 R  "0 0000 0 0P1  "9b2*9 2,20S #0 0T20S _H 5P 2p"S\?"0STT< $P VbP2 H S90"bST 2"TS\?< C9u0 0<30S 2@#S?d?0`#S\L P  -P 0#S\ 2#Sd2/?L c9E0 0$ppS $S00 S0`@$Sd2?/0?`$0S0\0000p`X 2R`嵟\ 0V $S`0?0$ 2Sh2/0^>00p`Y7 0%S0\000S7囡!"TpW`l嵏X7 0%S 0\000S7囡!pWO-P`@DDT(p  W @>CHA-Q0 % C@*r`! 10" q0SU 1f0a&0  a*[81t10S 0 0T 0@# 03A0S4 ^@ 5*< 538000S 0 0@TPVUAQt0Tp Pd0 0S L P<0 0S (غ(%|((P(T(Md\(0/L(0/L(0/L(-@-$@  | הv&G-P`pP@0S  0S X| >U >TY0S k0SP@ OL(&!y/y-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-   C-@M Mq` @FPPݍ Ѝl!rp@P=0LLD@rO,P,0: S0RP00 0PP P81: S  S U rPP%"P%PPPU rPP @PL( _y\(zpny~yyy@-0P  0 00$Ѝ  y\(y0@-4S 3/ L(@-O0 @(+ 0$hOO@0 L(@-O@'[OXOO@P/00@-0@S @ غ(&ٜ0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPP  hP R 8 4 Q  0/TTT8 l(T(((,(0(T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/@(x(T8 T 8|(p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\06H3H3L3u/L3P3P3T3T36 6h p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\05H3H3L3u/L3P3P3T3T35 5EEP  54K44K44h 45 5 5d0d00000P5P5H5H5 @ A S>S>h p@^0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//D(O-|4M X hDhhdhP@quP:0 0p 0<&0&0P7p0p(60pw>0 H0p(p2S# ):GP )5GP ).qVPZ `Y 4[ 0SZ?관X V.+0J  F ,0\:PV, 춝 Q3C ?E|PPe 2Sl3% 8 S20#"20#20PC 2SB4$040404X02P&V20A2T02@2 0*F0C`F `FbF 0l LEH  ?`0P*tT#0`P\`Q=S/0P 5` ( 2RV0 S0Sbc 5*< 5B23 30S 0 0`20S 0)#0 0R V 10S `2R\\0SD{2= C ,0"000 0t00Cpb&? p0("l `0S10S!0 R=S0S lD $000E p 0L%000P%X30,Iq *1, 10S 'S0 0<(d([h(n(X( (((T(X(Ϟ6g 0S͟T@YȠzT+ܺ([Veg<r_ -p(OPغ(tƣa(($(ڤ`((p(l(d(h(t(x(%\(ҡޢH(L(D(t(0LP((((P((u8(0(4(T(¤В=SZ0SR  0\p<<00P%X30*-10 |00S 0 00S5 0 >0S tPq 5*N> 0:#: 51(1u 10S p0 000S(PP0q0*01U 10S P|0 00<cQ0,zP 0r<0*0(25 20S 0\0 0倂0 RL%r0L%r0H00q" T 000cH00SPFPr*02 20S *0$# 0 00L40q"  400cL00SPs*j0330S 0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*50d4\40S 0$ 0 04t R,5S0%45S R! t004e0SP*0$5v50S q0X% 0 00刅(0S xQ$ V0S< x 0(%0S8Pȅ*/5I50S Dp0 & 0 08%<5HSR$ ( H00850<S_^P*/660S B0& 0 0܆@%D5LSR$  L00@50DS6/P<*{/L7D70S 0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@ZPLX p G@ Tʰ8 @/  @!. A@O@@8P 5  F,@$)P0 ( 8  Q DI ϠR 5l)p) x)Ҩ)p̨PW)pp \ 9 1 P, P'Qڨ0Q, D 0 0S }Pz*.:: :0S 5a0H* 0 00S aU0S0QQ 0 0S KPz*.::0S /0+ 0 0P 2U0Sh ,U0S &U0S^Q  "Q  U0S&! U0SQL<Qk U0Svq U0S0 T0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*.<<0S 0 - 0 08=0S 4=L=0SHm*-T=jL=0S e0Mh -=w P%L5s0SB B-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!@tN00 00L 00*->>0S ?0. 0 0@P0 @DT@8 HLd Lc B 0b03"4@ `P Z( \?0S  8 H4L0d @ B b"30P?0S  0p00P6@ H|6PpE h0d& 5000T60S 1S < EAP ,6 $6 @Q  V @ 0`P@@  04 8 <%c#!$c4"%S 50S TP 0 0 . ``0  0 04 8 .`T `*@0XYH`o0`0D0000 000D0@ p E 00@pDP 8 -30F 7(/ `@0V @@% p%*0@D@0 ?0`F0+ B\ЍO (ꝉ (& e Sde\%2R/C-=@SM}QPH 0SV㸠PV.'10S N!L5 R/ as0倀Sap ?0S  U 00 X0S F ?0S ; ?># $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍTkܺ(0(T(0 \P/Q/ Lœ0|   ,PŒPŃ ,c'TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> 2S*.'3`30S 0P 0T`dSTSPsPUU00Q AP 0S ??@9P`"hR0"00S8 lr003Pb0S* xB0S* 0R0E>0*X4& 2p610S 1]0 00S]MXP10S QM 1TQ `1*&X1` H10S 00 0H10S </M (1P 0*w&0`00S 0t 000S d0P`V 0S 0GL(\(4(8(((<(t(غ(̨(X(D(P(T((((((||x(B@(|([ܺ((uO-PPMp8 R B@0S 02 ?Q00@aV`` 0[̑ YP t \P  ?H < ? }0 =2r0S0c Sc 0!S 3S 00? 0!0! !0!S`0 0 0` Ul!Ϡ0008 L3R 24  B # R#  B ` 0Q" P*%0`0S `& ` `Ѝ0hS  j$  B$ $ R$  B  (($(T|((0(T(U (((P(A-Pph0``ATR @P<[0S @ <1p0A\(80 0 1S/ 0S/\(`0 5 /H0P 3S P 3S P///(^FPO-0(P,0@4p8`_ P P0P` 0S 0 S   000 00 00S 0 S P0 v0       ((`(Q 0`( "4`#/O-`@8 0P1 008Q ЍS@pd8Q Q 00$ 0pሀቐp  0` RP/! 0 P  C1  1 @- 0` R|lo/ 10#/C!000P/@- 0` RD (     /  /C! C!/! !/@- 0` R      /  /C! C!/! !/@-e O-$5 SW@ lPphU00 `1X 0000$ p  @R ![ 10 <T+EP 1C0 2 @ @Dό R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RM@Xr jPP 0P`  `XqP P7  Kp R<0S zߍ<08 H(00,0 000040!04 04$0D0(0P WP  `#pJ @p  40_` 0 :  q r r r q : p 0`?`a8S Pb 0  0**0P0P ( 0* ͩd@edAzd@RT +?A-PCMMPp`;8 p@P  P0AP>U00 ## CލЍG-`MMP@p`{PR0 `: SW//0P  rR ;00A 0C @H#a@ V& 0S UP0P帐`0@PPJ0: S,^0"s @PTP&P$ e6P  PP A@u3M`@ S @ S@P"PZ PPn !UD e-@+S R UXPXp!t0#PU00`P00D!␻ m@P2  P:0Su`X PPd0 PP ͜W80% ܍ЍĜnœPUz f꺜Uv TrU 2: FHF F@00S 4 /T(00S0`( "4`#/T(O-pX1`P10P0ʟ 0 C4 X 3#ˠ121@ R` 054P萟A00!R00S! H% 0%#s(0!ZXl000Z T00 pp8P,0^(((غ(ޢ\(a\( 00S/HT(O-,Mp0`P@ᄡ0V000,Ѝ00 ?U0$p$00 0000P$00S b00 ?3$000 0 P 8A00ğ,^ 0P Q P )Q 1 .( 000jEYq tcPl 3 4ЍLYPlTPX30S, t? `1G`$3P3Q,`Q0C,0(@,0h `PX,*0p ,0R0( 000V0A+3 T2 Q,``!(@,0)P,`S00@ 0 `0B"30 ,0V(! 1 1S2? @10S D, 0R00 $00?000P. <u4P1,00 0(0$0$ ئ0,00 00(0 R  000 0`@0` 0$00S # (ӜΜ^(غ(rg̫@1RT(^FF^"\(*D((\*qޢaO-1APQ P1a`3$MS0_ 1P11r00`00 0p8000P0@T <APXpXT 000/ 0[P'0Ġ[@  0S D  FP PD0$Ѝ(# ӜΜ^((`(R-غ(٬\(p@-P0 % .  @Q 0S pPִ# #3 l0# #:>0 @0SpP p(^Fغ(ВR/&G-P `$ 0p/@V` 0/@`` V`@&!D( `G-P 4`pC40ȠX㉑ ,Ƞ ,4 ă Ƞt,Ƞd0 "% ?Ѝ0 :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  20@`Spp `J 0 U 0 0n7Π ^ÌVQ 0V>  0P" G`p P b72 R0V1Q0V"0   P 0 P$ ` U P ``Ѝ34 2 t0A-1àQ`P |0| ||20@Sp࠱ P$` p@QL ࠁ PQ 3D e tp@-@PaSl0l llh20C800S   0崖0080P4 PR*Sp0 ꒭W  t ,0S/`0@-0@  L _0@0dЍ000(LBAW+M |tW NBAWܮ   G-0,0S0 _0P@X`00qW40S*ᣔЍ!  0K@P   l@Pp٭ $ tA-`0@c,0Sl0l ll&0PpoQ L0< H 0P@DT@٭ > t? C-`0(Pc,0S0 /p@BQ |0l x@PEU  0P !  0 P P Ѝ٭ O tQ X0sC-Ђ0@ P@` 0 00 0 P 0Ѝp(4(X0sC-Ђ0@ P@` 0 00 0P 0vЍp(8(CA-0PQ K@`p0P R   T0! β@P 8(4rPm&ꄻ((s(ȯВ@-,@P,0S 600(@-,P ,\  D Ѝ(p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRppD(T((27@-0S S+,Ü2 R0 ELi `Q |xPCaQ* Q( PDP <4B 5*< 50d30a3> 220S ᪵0 00@ @7.Bp#x3 Ŝ ' 0P w`XA 5*< 50d3 81z,10S u @0 d3S, CQ,aQ$ 0AS#JP O0@a3d3*0Lt00S Gs D0@ S Ѝ04ܺ(((В+((P(T((Gi @- so O-0p M"##0@` @ 0$0/ȃ @pPs0S@P-# 00" qp*$僒9lU tU bU0=p$P)$S @: P80 ( 0 @0S ,00(# `!$F P P0V xoЍVp FpP` ,[ prP `P0V:P0V cP p;0[0T$$0 )!9 Pl  @/0 00$ 0S Z(0,  $ 8v)p Op @.0 00$ 0S Z(0,  $ 8Yp  @0P  l P0 Pq 0 ! P0 o&%ưvQG-p@P` 0P V  00 000G 00`000O-0` mM$0P@t004080 0 p40S+ mߍbP AP LP `8Z4XcP iP0p8- 4@0 0H4: S@ @0(0D04,0008`0#P  P 0 0! xGTd p 0Q= $ 0! $∑匱@P 0V$0 0/S<<`V $噎pPp<0"<u<P0<0O`P< \v ZHp< 0 0 n?C0 n?< n/)0P < :<嬐!$-ᦐ 0#$0@0P!SL `V|s 0S `0S  R$ R Z m0$H 8 H)Pp`G0$pR 0$ pK opBZ (,PQ(,PQ S R `Tݱo&%zd@=&i7r {^ƲO-P@p`,M,$P ʕp)$0S0$020S($p P V 00 0P0P 0 0 "fP AP PP XbpP$p,Ѝ`P 0`P ,, ?o  00 00  0 `$ p| 0PCqp p Up`Yo&_u%UG-@pP` 1p`:D10S:- ) p% o09 6X $$ (,pp+ P%W00S $$ ,`p YPPU `fV rV GTP$$ + Dp$`Ϛo&ij %6 @- o A-@P`pP- hhɮ XU  AD<微4,  嶮 Ap&v&u@- R0Ѝp` P@5pP 0 R SR  R $$20BR R 3P0 |- (P/00#01"$# O-@  @T \  `?p蠟 T00 Ѝ@P 6 [ PP P7 U  Q*"ƌʠ? ,͆  RQ*  R*Q*"É?   C- 0P @8a8q@^ \ ^0᳀ 0S@ 0S@ 0S0@@0\ ?\CT:^ *$@A0607;00@R0@Q 0BR 3C !*O-0P$`Ἃ@P 0㘹z'0 0#Q P @ Ѝ mPC-`$4 p咓P`品(@ 0#Q P Ѝ 2P404-@-0  Ѝ Ѝ/-@-00@+D 0 Ѝ@ Ѝ/-@-P 4(嫬 * cЍ Ѝ/&O-MPp`@PЍ RP P 4S  0lႍT0P$ &Q$VP 0S 4S $ X 4P S $XSG30 0 !0!|p`0 0 0  @ 0P 000 00 0 0 P 3 0T0哇+ P#(` ,`$`V$R ڀ 0`  tB @  "\PY 00pP0SpWXccҴδzpO-$M@ХpPP? 2R 4S  0Œ$Ѝ0 mQ Q0   RSRQ"  "S 0$000 00 P 0Pᐌ4S 0S,  00 000 P0 0P0 <00SS PẐX   0 0`V4S 0$R V P0 RS 0  000P\ H0H 0000 0   H;pFWU3>QnxG-`p@MPӊ@P 2@TC^t# E@0$4$ 0840 ;p+p kڋ̴px H4$$: S! R B.T pD $4S8 (4,$0.B.  ⰴp 0 0"dR04<,$$4(4$t0K>Ѐ 0 c#   )00E`d$t؀E0  O#P0`P 084S   0p 0Op 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY"ϵ۵d@d@+Ap@-@P 4B BRP p 8L4  VЍ@蛲Ѝd@¶@-@Pp P P 4PS 4 'TyA- @P0TP p` X`p0 p蓷$$ QEAS$0Ŷ 8#8"(Ѹ0 / 0T 00 /$4 0T0 / $4 0T0 /O-`P@p M6f(`m#P̀PP `00000따 V:Ѝ 1 00 0P0 `P1 0 0P UP{ r˷v&C$$0A@-"P@- x`R@dbЍpP P 4U R 0 |-"O-P_o!R0`@tMR(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 P m0 $8  "P P  WP 2A-@pP`P 5/p 4 5/p 4 BC-(00pS4P Ѝ$d@ 0 (!  0d` 0!0  0 `WP L`O-0 0PƆp@ጀ儠T Ѝ` >"P `V DDp 0 㣆@|-v ͸A-P@$`$p0 @T O-Pp$M `@Ȁ뼰0     Q x tx0 p `p X0 X p`f00P0 ] Y$Ѝr H O-PQ@04p 00` ЍP P0S* E g`P0       04 p p#p p04pp   ,H0s@-SX`@ Ph0 ?o2R0S  Ѝp|-@- iR sR aR p` 4ehp@-P@P (`oPp Fp|-p@-@T 40`PP>pp|-iR@-- 0 aR bR LR( *sR% tR@P 04P0S`00p`(j0 й|- p@-M`@P`$P0 0͵0,嬦0S ⦦ bЍprG-Q@PM Q  ЍA~␀ p$[`P phB~00 0 `PP r Q^+O-$M@`HP ,`$ЍPP 0 0 0 $ Y># P0*] Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ ܅P 000 00 piP 4  #\$  0V,S( 0 `$4 80p| Ĕ$%!#,[PP T P R*L0Sh 0p_ L004 0 000 0PM 4$$  # 4  !4 "4 $@fp7 FvɺXc00S 0@-@C^M E$tE$$0@ 02P2Ѝ0 @x("(!Y"`#XT 80 H @KP8Ho&$%5@QcxԼ0$ 8O-`LM P4  "1堡報D0!΋p  0S# x! Rh!LЍfR lRG  F 0pS  #P ȥ@P  2o @ 㟃PЀ ! T  0 @  T @  @ P@ p|-h*'o&Q{<%u&A-p`(P@}P0 p!`P @00 0$0@-@P$0S 坅@蚅O-,Ѝ $ p`♡P H@- X@P HHH0H圢@@@@8P8`@XT㇟{ *׿v&G DR R R @-@R R///// Rp@-0@P! R!ȒH\\\\\\ R\@\\\\\\\\ pp B R"Sh 1@\ \"T0 L pppppppp, (O- 0`O@PP Ѝ0!S R W0Pp0(P\4S 0<0$$0P8 S 5 R RP304S ڠ0"S1@ 嵠0 ]  403/p 8 H0 0($P  P 0$ 0 0S (0, PpWEV$D, (OO-0P`p,M$0  ᅇp@20S$`|P 0 0!  pT AT fT 0@,ЍsT00$Ip0 0 00@ 05qp 4 `00p x0804S 0Q51!0  R@ 3R602G/ Zp p 0oo`@  0 bp@ R@ 0R R 0Sh0S0  00` 0` 8 H00 pppW$00(p,0`no&tX% , X8D(DA-@ĔQP MP  An``llph`paP LЍp ( 0 )Q^ )G-@P3p% U4 d! A~Ⱀ尀 p $$ 0 P ! `" $`p  H00`$B~ 0 Q^HeO-P@"$M;p $ЍO20SDP`.Px($  $R 4S  $Ѝ4SP 4S`P  0` 0"VU 0 r $ RQPI 4S7 0P0< 0@  0 pP  ,!? 0o 00_0 00 pup : 0"p?P   U0p 4S 4S  0Qp%o&uU4@-20SK@0SD00:@ DP 0SD0SA \^<40$ 400#qpp, 804<0[P$ 0I,0 , P |bU@qU PH04 8pPTЍ0$$ $(`VtR0Y `0 XW0 0 0S$ (0 [ P20W0 000$0 0(000qpp 0 QP Р 0Z'p , @!p p  $ o& ,%O-@PDMCnp F#p apX50S H&DЍqP sP 80]p#  0%qp PPp0#F0$$Q`P P  0@x$0P0  0 H0 0$0P   P 4  0 (0$0,0  4 PSn 4,  (WUXp^P 0T 1 T00 S :0 U 00[ 0  40P40 (, [0V [(Q,UX? U0U0Xp6P p (V,#X<) 09p8 0  U  0 03P_ Q QXX 0 0  P4\ p 4 "$P0 0S 004  4  !4 "$0 S40H0L p $01S 0S P0`8#8&h$ r/0$0s?`uph4 4$$  kgo&%k'  0a C-P0 @p`$M!!ᜑ P p*0S00 P 0SP0SM \^H 0T' 10S#!Q` W.NP. a@ P P 갨TlpT T  ,$ЍP`)o&%Dp@-M(@,`P6# ,X0/P0 0͵0,巛0S ⱛ mЍprt@-WM M`p^@T 4G0S @^< P厛 0$$ 0$$0 xw0 rxP x@ xkx 0`lcm0 $8P[LY#<(Wލ Ѝ;zp}T@-0@ n00 0H 0 /Ѝ@-MP@a qPw h@Ѝ@`  pЍ | p!80pp\XT0 0 (8P  @08 0@TS Q2P  Ѝ@Ӛњ $m0 8 00  ` ppx帚1S1SDPЍ@諚q!+rXe BLPP `00CS`0p S00 P0S X0X /Xћu&G-PMM`" x" t"'*2r@p嘂嘒TݍЍ  ^ Z `Vj @P   `0"<0 B7BZP 10S8 1B#B&B#!$! @|<#℩P%$ !P<#  pm0 $8L($# b&@B 0B    E0S 0CS 0 80ϙ 5f \&b{tNzp( r3_G-0p P`@M!ဂ P Qpd20S$NPDH&@6 lP`Pa@ PȲвuP xP @ЍPP  p2PPP0S00 P 0S0S \^ 0 Q  < 8%0p帠W ' # Q   }   up o&%5f \&b{tN@-LM@P`4  0pD0 p T$  P 00S 0 TR lRxLЍT pT86p o&ԵD % 0@-$M` 0 0@P!!dq Hp$0S00M P 0SC0S@ \^; 0T 00S!  0*a@ P (@XTt$pT  T   F$ЍMo&,%D-0,M$00 0 00 00 00 00 0 00000000 Ǘ,Ѝ7@-@ P00+0 0%0 0000 P  S  Ѝ0C-@pM P`  0 00 00 0 000sS 0lSp@ P$0㓄( p l@ P 0㓔) p Ѝ@T@Tp` C-`PIVdsq  5f U6@v&O-@PpjܚM M{p :0S ЍO 0FS iS:`pC>؀C$T7P WT Ѝ*P%P WP9PXe0P0 bP000$$]PzXb`P |bP (0]PXfWD0 IP $0   pLQ4 pJP 4Pl0P 4 CPu   P00000[000000S 000(0DbP d@b0P$0 #lPP HHHY`P Y$sPP04 WJP 4`'P `P @ HPn H HPh @0 SD00H0 RL0( 0l` 0 qpH  R$4,, 0w qp 0`} $4P `$$ޛ$4P` Va`P aP f&}taP kP+8,0 X`P X<&? ` 04 qptp *HPw3po  4HP   -HP  &HP   HP  $ HP  X HP q@ HP  ( HP q/   HP r GP 01S 0r/S㲰, s? Ѱ  GP s/ GPz$$6$4P$kP裟z X`P X$$`0 qpS, p0x< 5IPj <pP < <(< %IPZ <P  GPO  GPI L GPC 8< IP $ <8 ^GP3 8 Y* 0c$ Bp ~$ ŚPp$4`  0; qpt$ ௚W$4 $0 8V8\008$00(0 0 00(0 40P0,` 0$00P00T0$0b X^`0$$qp|$$p$4P0 00H00L0`@$4+` 0qpc$$O$4P `h*o&%|- 6WyD 5f U qcU2e'&5>IVdso6KXc0@-@M P s   bp< <g 4坛p$_0Ѝ0 'i@-SM@P, E0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0x00p0`0h00`0 0X0D0P0L`0|`p D Sߍi@i"!i.@-@    M0`( "4`#Ѝ10S/p@-!MPM@P% PA. (01jP A!AP8 0`0?oS c`2 06P. 0I00 0A. 00P0;P A A0 000bސލЍp`א0 0A. 00PH0P A4 4A@⿐v`(X(r:CWe&WPs@-6PP nP g )`@T!Ѝp P  00SQV  @@ ?0 R !O-M@ Pxp*p"/`P"  .  *^P- gc^P:^pP [cpx^P Tc \DP 0"h 0R00  p!  DPr 0SohQl @ pal %c! R R RZ  0PW l Z X嶵X (s<㭵W 0j0S, @ hP@ `ۙpd HQ L 40R ! 01Sp0S 3/p\ U 8 X弙p \ [ 5@ `寙p Ѝ M oK.zpA-pb]@P@]PPi]_^ POST+^P T`PT@- EP ЍJA-MP plD@P00p`ЍpP   ₣0 Jp !0  Ei@-@p @A-P`{]pP7002bP@.?04b *  F A-P`]]pP00bP@:?0b   F @-( CP 00 ЍDp@-8M@ PCP 1 !  $]P a0 Q0s0S00waPP  g]@RDp `  _a< PP]`kRV8Ѝp$g ( -ni0@-@BM M Q  8p 0S 7  /  0(P(@0S700$0/ 0h (dP(@0S Bލ Ѝ0bR@ZJ@ixp@-xM`\PP SaP@ VP0P P Sa  I  ,pЍpn5 -i@-@M   pЍi@-M @BPC0 | p  1Q0r R08C84 1p`Ѝ$g +iis@-`Pp@ @@BP0  H@Ph啳` P@ L㌳@n\P 4 nЍpog +y7@- P@=pT TlL[ P@00 <<N 0400@\@ Ѝ0 +oK7@- P@p\ \E0H8@[ P40 00! \@ Ѝ0 +p@-M`[Pc 0P0Ѝp\`P@Uxk@Pd0 D+p<8 P@ PP :ni@-$Mpq[P- 00$Ѝ'``k@Pp 0 XpLͲP@ P`@ p$Dzn]#8iQ@-B ЍN.r^0@-M00 0  Pۖp `k@P㗲 ` @ʖpp P0 `pR00bS ymdU qᰌPxi jzps@-@`.PP  1p `l0?p@-` MP@ZP _ Ѝp P(    '_  P[@3PDsvi 0@-,M@ P)AP0   p,Ѝ0 0R0s0S 0 $0^PP  (Z@ODg ( f+sp@-P-p@`@@jZPH0H HH+_Q P ԱmpM 2 +y@-T @@P 00Ѝ  p  %l< zp@-@-M T@@PD0D DD08 0~ p$lЍ g J +i@-M T@@PD0D DDh08 0] p$kЍ裝 g V +i&0-M $00G P  [Ѝi@-@0Y P$0$ $$8.Z@_ +00@ P/a CRWC/A CR=C/@-t 00@- M@ " 0( 0 p ЍiQ@-PM  X@@Ⳛr 80ĦP0 0 8Ѝ:r?N.1=H@- @XPP mpPL``P00 00‹t0@`Vm`` PT0d0X @ @@@@宋N㣈03/`l N%rBHiv&////0 L0L0/%0 T0T0/%0 \0\0/%0 D0D0/%0 d00d0/%p@-@prP 00p00D S 0A0CS 0$P>P  0@p%@-p0( 0`P/ R/%0 O-4M@@!2T0.  DP!pďů. 0$ (`pVD@PT P p1cehT6l PP@ Op 00JP`p R  P Q R/6 0TS $ P\(P  1/P ⚒@0S  œp "SR(0S`Ư\ 2/P W0 [ e ᠇(ɚ;?O-MMPp  X p`%㞯 pP$ 100$0 H-É  ⻓pi t ⮓p Q X姉 c8 p$0Q 嗉$_ X@T ⿝X00@0 0僓P~@R 0 0姝 ,0@4@lp 0h0Pl0q 0X 40,@]pDg 4<W]j0H0S $P31HH0S=I0S:Z`@T 0 3/@: " Ÿ렒M0S:00 % p"嵟pM0S  @ @03/@r J4I0J/pNI 1R㷮a`"%J` 1 0 d1 T|p 1 d\!1 Hʈ`@#%Js!1 @ t1 x!|1  gP@Tf 03/@ 03/ݍЍr ;iH~idlY%ii3Me( szi! HO-@PpP  p ,T U@UPT!VY`P \PPU D1O0S  L LW UP.Z  NP' >P! K0S 0 L0S 0M0S 0 N0SO0`S PPV 㼇 ,& ?(J@v&@-,MP@wpP 3VP`(  p0S h㜭 HU<P00< <吭0 $傭,Ѝ\(8i( @-P@Y0 Pn1G-@UPP0 S`@ Y㔀ZpZKPP  ͘pp H H@@@h@I 2S\(s@-@{U@Ps00ЍpwZPjZ@P <` ͘PZhu \(s1s@-@QU@P|0| |NZPAZ@P T` 夘P1hu( iЍp  S\(s1A-@"^UPP0 `@ZZὣPPp Yp< >FJN@H  S\(@-@ \;PP0P PPL 0 S@@00 >00Ѝg  S\($v&0@-M@UPTP TPpTP d0P P P P^ 4PDp XЍ0H I\(7is@-@Dh偆 jP LyHPH`w P! ,nЍpi@zp2j vG-M`@PK `ppP"(    { Cp% (( px" <@T t8P/l2P\( UR TЍ0 PxHe@Pԫ $@p 娖t 0R k)㰅 㮅` `ptQp R%P\ 㜅mKP;ЍGfQ\ 0Q    1 0PP0 RSY ᱅ᯅ # h0` R P U 0pD` P\\\ 8i(i-, 7>j@RPq v rH2j t t}^Pp@-P`@SP V  T`P 8I`5It 00pRTp'IA-@T a00`PpY0 p @-MPPF00Ѝ`0 00p0@ 0 P W0P. 0 p 0 `P0G-@(P00`(  P1r0Pp*0X!U0"R0 "00"SЍmK0P 0 , \p 0 @0@-@P H@ O-`@pP,(0V0S 8jcP$P$P 40S 04S 0S(0p(`8P0S$0(PeO-M00 X$000Ѝ 0Q`?  0Q> 00 <9PP; X.OpP ,,pD,4@[T /@P00 D0800X5Tl ()e( R R[`"00eUx 000 ۷Po0"0CSi 0BSe 00Sa2^ 5!445XpbPPT  Ჰ$pP VdXB 0  Ap; 0STw /PPZ0!y8!10#R0 0i8XdP Z@ 0YPH@T 0CS00x C00 X ^0:T 0CS wQ0x L @0aD\W@DAD\ 7@D@SB0@ 0#0  0@D@ TV@_dTl p QPG< DG0 0 0`0Dv|  A-X Pp@`P100i@0P( 0 p 0 `P0O-P`$M@ HpX8 P W0  tPp` 0p0  0yzpHO-`MM@ <0< l gK7KP7['S(0`0 @$0 0 @`F( 0R|P~$0S0'V$0$:$ 0:0: 0:0 :0:0:y(@!!0 X o0 /C BRZ  0  00=C$0Cɟ"! 0P PE ^p PE0`y\900IppcppCppPpp Spp@BppA`8$ 0PX0` y!0X@"0,0,0S> Yy0( 0B'S(0؍Ѝ 0$0d(S   BS>C0CD(S Q:ȟ"!! CR   ##9C0C"!% 'S>Cǟ>C"" N=C0C Q 0*S ;S. RU 0C'S9x::::x:x:x:x:x:x:x:x:x: :x:x:x:x:x:x:x:x:x:x:x:x:x:x:x:(:0:8:@:H:P:X:`:h:p:S\44,345,3,3,3P52S# Spt 0S R Sm &S|h 0R  |T |0Lx0, 0 B, @W0S 0S `pxpW>x 0R 0x`0S x0S `p000 x00C!xx娀XP0  @ xp` x0S W  04 8 <$S Wf0S  +x0S 0x~x ` 0d|Y1 4  `pG0p00D(4@Y400 03c10S1և!u Vxp 00 Nx3I $( P  #P# ß P# 4xp|P3Ip#S0S l&x0S#  PxS8x0S $x s 夢 ` V0V"    0`wV4w0S 0XwgDw` 0 d(Y1  0G p00Z100 `&"R 1 !o 0B0 w1I $( !P  $P|! x Pt! TwpLJ|  lhd`\XTPLHD@<P0i ia'̤(( $"&,zp;r5v<IRf\mPx}2j tPP& t ',7BLT\dns|p@-P M@` QP0 aPp@@UW Ѝpi@-< @+P$0$ $ Ѝg W@-< @p+P$0$ $ Ѝ[g W0@-MP "Mⶀ@PۍЍ0@W P+ LP@WۍЍ0@^0S0S1iS #0@-M TPfp@@VЍ01 jk@i2F@-T @[+P@0@ @@HI \p SЍg AWp@-T @=+PM<0< <*  >p5Ѝ螗 g W 0 /%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@03-@-  XX ЍЍ/@-@X!8 0S/@-(-@-  XX  ЍЍ/-@-  XX ЍЍ/@-\00S 0  0000 0 pЍ(@-@~Hg~a~p0dp 9Kp@-pMPP2 P0S 0@P 0 0 00 0XRp DlP@@ ((@,P0P4P8PT0 C/oQ" R *}$@TSS  Q  R S000 0$0}@ (u% ALA%p-7@-P0@00 0 S Ѝ0@Ѝ/0C>S00!031 0@-Mt 0@P \㪚 SLPP @ (@@ 0sP 020Ѝ0%S(j@@-@0P ,vu  oufrv&aSP@-d0 !X !T@0 60\ (0000/ Ph0h@-`  !TD0 60\ ,00 00/ P-P040#^4<\$0000/ PD0 40#\00Q 00/00 PL- 0:# ^4 0Q$0000/ PL- 09# ^4 0Q$0000/ P 4 <# \,4Q00/00 P@- 0:# ^ 0Q0P@d0 :0# TDD#^<0\ ,00$00 _s @- 0 00qP ЍE%A-P⋑p`@WЍ P 3MP@ p7@-P@U0  (sT Ѝ0هA-0@nS0oSp@ pˇP``QPdT0nS0oSUPPUPP'v@-/0 spv&O-MM`<(0p0 0D@00 l0wp0S SH 0Q 00,00 ]Hl[ 1Gvp@-@PɪP (S0/Sp0p@0@-f -o$lv&O-`@ Pp(,-000 唐唰00 Up0@DTq oP0 P冀P<w9 O4t-o&|- @-M@A>0 0D@00 l0`wp10S SH *P 00,00 ғk6g 1Gvp@-@P>P (ȓ0/Sp^0p@Z0@-  ! kv&O-`0@P(,p娐娠娰0 Tp00@DT oP0 PP吓  okA+O|-t o&@-MM0An H 0P0 $@vp dHkYp@-@P̩P (V0/Sp/p@/@-i 0n'kv&O-P@M P0.`r"Tp)20 R. +x   &  x `!p 0 *00)0`Vpwpz uPfPMP9 9P$ GP g@Pdcccc\ddcdcccPddtdUP|0 0|00|0|00|00|00pt`x0 $P寒~Pyvp Z,0p0Y00t0V0;;0x0UMh$00|00|000ЍY00t0|-9o&R!-MMJNP0 @P300 |0up0 `e0 0N/0 4 0@000l4j$3!K7@-@P M0Lo SϜ 0 / Ѝ0@-@B0P@@-@ D0P@# @-@ jM0S 00S0?  Ѝp@-@PsP (0/Sp.p@.@-@- 40 0,0,0(0(0$00 0li!v&X7@-P @!MP00S\ 0 帑 Ѝ0p@-@ PX0 0(p̈PP(娑Pip@L(O-@H pH 8444f lRp60pGWQq 2@FPkjiiiiiiiiiiiii,kitkkiiiikii|iiiinininhoiiToiiiiiiii8kTkhkkiikikiikiilnjnno`oio8o40S = 4 40S 4 0<007aE08:h$0000000D30@90;g)P|04P 0I 0(80@008 0U}PP0       +  @   ' B ,# R#  # R" , @ ( "  )            |20  x|0$000 T|0 000 0|0$800  |0<:00 |08:00 ||0@900 r|0,000 |h|000000|0909Rf01r`0$000 0 0tS0,0wL0 0xE00007000+040 E Ѝ<%%|-o& (((,!4s( %A-RMMI>0PC@P@(0L AH`q匁( `L0Esp0KSh0  R < (Lh0 [,(g0 帏( h0N/@  0ePP 00 0,P.0T0P P T0i0\ $00X 00@00\0|00x00t0 0p00l00d0iRݍЍa(03!@p@-@PݥP (g0/Sp+p@+ R R @-J/*0@-@MP`p 0r000 GsPPЍ0P0 0 0s0 q0P qs@-`/P0@00 qP0 TЍp 0`( "4`#/s@-@P`@0 0Pd00SPPP @#@! 0iЍp`(!G(002P0/0@-@CMP( P41010 0000000 0P kK< 8hH00Cߍ0Cߍ0@o꠆!TG-0@`p8Pp6 Ƞ,̠Č Ƞ,Ƞ D}4$03 00n4<40 8h0e,b<0(000pE040p<0< Dp PH00ЍpHPD PG h`(prs!gO-$M@0 H`Pp0 @T V0m<00$Ѝ 03/ Z0p @' 0P0:@ 0 `  p00P LH0@3/pEPzH 0P 0T@Pp 0  GhHP P @0 ` 0  h꠆!wC-MM`p/  P@1L#Pd8$#4d4# N41 D0@@ 0@00 0|@pߍPHڀ@Td8$#Td%4d(G-P[ 0M@@0P` :0P`P*] s 00x 0 /P n X*0L 0pp000S0 W0S00S0 p |p`  hP 00P0S`!0!D0D00W 0 000  P0b"!4b4#P0P0Ѝ 000<0(ad(0@-M 00@08 P  ጐʖЍ@- gd v&O-`@M$  00p 0@"@0"@0 "Mp20Q0CS g@⨢P|||||||}@}|||p}|~0p00@0Dp 㝌! 0 yP同xP pPP0S R  q ǑP  th 㥖[!! DJPP0S R   ᣑP   圑P p b+=Cpp p 0[4S08pS @p @Ѝt-o&m|-s! BSz@-MMCN@800 0@(00 0iop  0 'f"$f!!f(=0P( lf,a<0P , Tf0LfލЍ4 f(fr7@-@P G0Lo SϜ 0 妋 Ѝ0@-@<0P@@-@=0P@# @-@ F0S 00S0?  zЍp@-@PP (t0/Sp (p@( 0`( "4`#/ p@-"440 @"440 P"440 "440 $(0 $({ XXwddhhllppttp p@-"440 P"440 @ ifcDD]@@WHHQLLPPTTXX\|`\ `%p` p! p@p@-`@"QUpf@p@-@P$!pA-P@M4Q->C ->CBX?X\<\99>9>:>C?n:>CF 0? AC>}C>GmFEnFE~G 0X J~XpW  $$((,S>,}S>GmFHHLLPPTTXX\\O-P ! "441!"441 $$((,@,0`Pp0Q࡟\5 S L5sp`PҀ0,$ $Q p W vTrTpXnX\j\`g`dddhah`l]lpZptWtxTx0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P#` 2R  0  ?<#΋ 0`x 0:`0報 C c00d0 `c C ca0b0 0 0P!\Qpx 0&0sS $$TGQT`P@UOl  00 ЍO 80tS hhȀB XȐP;U(P,|($(U TTt0p@-0`S[\@ L00S000000B0E0pl(%PhL0$00/000/B10B1/101/ s`v&O-eM  dϠ 0@ `Ì0 1P50S  100 R(0S\PGpЍ P` ` b5BL RW@QWR5(ȚPP/ RD 4 P D " PD1  2D1" " P 1 21_0 8 P U Pp000 0$5S ? 00l1>0@D@ @00C03`0S30 0C0 0#0030 3#00020SQd 0@ `?50 ST0T00  B 0P SX0000Y0,ڨ0d0? 0 0@ `5? 0댠 ,1# 0 ! ?0 00C000 \S T10S  2 dϠ 0@ `Ì0 10! 20X@_T40A8 0 B0 080$ 0C $ @$  $ 40040 08 R R` /  `1> ``& |($(U 1Wv&t%O-MM␵`, l51^OR0\u@DSia@517hg ?E 0S/nE? 0?E4[P`؍ߍ 2@ŒD 0L 04;2 0d04 0l0  0 SF0LSia,41gg `&!""#0_ED@HL0? 0 040hl 0@DU0 L 0/4d;0 0 0@$ P` 04 <0#p R0C0p00sg`Px'x20S6t 2ܢ 0 000`0p  `  Z ~X ZPPQ ," 0"\0Q>? ,0##90 P?( 0P@/  0@őD L 00 /4;0@gf 0d0@ 0_ 001r 0PV f`P 0"Ϡ #$$%90\X`d?(,0I P 0@Dő L0 0/4;$0 ff 0l dh 0@ `Ì0 1%(|(A%%\($(TO-)MM,0=0?0(8$0f <pW:t< 0 ; eZ 0P@P`P  <x P@ 0  ;lpwf 0  ;E]p@ ;T@  ?[Pp *? ?P xK(50S0,5 Sx0<0(500,; 0,%S00\:X:Q04D T\\ 0Q( L\T* 0 04 0A >\F 040A 5\= 0 4Q ,\4 00 Q* #\+ 00Q(| \" 004 Q\ \P9 p00W 0G\3SrD9\sXX9X0S[ X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R0081[ p4张P 0P8 a 2! Q S,QdS18$Q<4R:[ @<8*\50? A00p#!3x00084$0<04D0t p@p加0|00pXsL5P5 P4H   ?H8@`D ?A p?i`hxtF01o&" A00&"n0  4%8$05<4R0@[H 66 p84<00x 0 08SoPN @P@0 ? @P0PP* ?@PP(5#R0:P@$0[`- 0000%" a`0 ?001>0[`0 c2# S,Z Q Z3?001> !00 ^  BB0P`0/2"0$ 0  ?yV`1V`#T0`10F 0tI ?nB@TP 0ἐY똀  00B1  B[1 ` Y"B !!0 R0C!I0B ?D0 `5똀 0  B![0Ӡ!`S1B 110S UZ]r @P`x1 F084<ĔCP`0S84<Ą-0$5BPS,`QɑRB@L0 0 0000 20S|0` ?HL404P@0 @1Զpr'Fcqp00"R6  QT1(\50? A00!#4t x0Y0(0#T a2!, A3 31 0  @P0t(%%<(H(?k@(*BP(L(%8(D(X(\(^F>Y(((`(0(x!h(xu&ht@@v&l(A%|($(TT (U 04 ` L 0H$4  E$ ( B, @%LV.  R*h b <  X ! \ ! ?.@Xd@+@B@A.@B,-8 He `q @40K `N0 ,p B8d i A YZQ 0 30 XZ R A  pW?΄$t<4Qï80P@D04 0H4(0Āp 2 R 5#< 523pr0S8 ႇ * 3 00 d AQ\ a6Pa`(PXX `4g뼐@ c`  3`0@0P 8彝 0,X 0  R0:1P000\P2#00@P`@` 0 0kp00 R00LB&X0 O0S:pD RX TP0 뤤@t j0JF 0kuK 0`0S 40Sa 0 # $1 P$0+V. X050S  O 0=S,0Sڤ0S0$0! ,00C."\ ^  00 0?d B2 b<10 4&W$@6@H p bPP04SP0 0R0 S00C0 S 0,00P0F 0,0Sz p开8嘥ȿ+" < Q \%0R.  @(0 0 @DU`40 @4Aໜ`70 @R40 `0```0T0[(w 0 f` p7$X0`0 I9pQ80< 帐 P0x0 0 Sx0x0t B\0X1`01tQ0C00h0`0lR#00B1 d0R*%pĈU0   (0 0C0(0( 0 R R` ` e 0$5S  l01` p0000S3d0)ST0T00! !0)SP5X0`0`P5S00d0 08 5   /0000080@ s`Q +H0!H (AP+H H000-ᴰR㰱 ,  BU 00s0000T0 10X0岑0= 8R\ ?0 P 0  B  R\ ?0   00C 0  080 C  C 4400CS T00C@ 0|`4  80QT:  $5SXL $`$`(0t|V0S ,4 ` d,04  0,4 $" 00`  Vjd0S   0帀0 X#` x0@} X\h># P 0?d @ `0 < =\%R m0SP,m\`/ `ƌ$  $ l(0`S`  0$5S  l01` 0000S1d0.ST0T00! !0.SP5X  ``S 0d먐     0Y00080@%0C 400400T$*Q`?0@$00$0l0`0@hppT:S $S0ppS $S00S0`@Pl倐H(ꁦP00@`8p`0x1ሤpY70IX!@@gl00@0T: 5@$\,Q 0@08(0  (0d0O@ 0NN nC 01p0Sڔ30S0 000S.T08CLC P3 RH0ł."\5 S 00 0 d 0/ @ `.3,00 $ T0000S0S 0,00C0S0 20S T0S TT20S 0Ῑ |T00l:h*,8iP 20S#A C 10S303040404 0#pCVW*TzV.PaV.GVN0S  d10 PST1\5=S,:41?^ E?A0 0S 04 W dLĒH 0@ `Ì014 ,$0S0S 04 ? d ,04 0!^ 04^)ݍЍSoh|(T((rPq _ S(h%$(,(8 0(G-`RM@Xr &zPP 0yP`  `P P7  ^p 0S 64ߍ<08 H(00,0 000040!04 04$0D0(0P WP  `]pJ @]p  4y0"` 0        u ]p 0`?`a8SmPb 0  0**0P0 i c 0* ͩd@edAzd@RT +?A-PCMMPp`;8 wlp@P  P0AP[U00 ## CލЍp@-@PጏP (y0/Spp@R/dG-P `$ 0p@V` 0@`` V`@&!D( `G-P 4`pC0ȠX㉑ ,Ƞ ,4 ă Ƞt,Ƞd0 "% ?Ѝ0 :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@O-4MX0p0\00``P0 0,, 0S% P 0 1xmS;aSMSASB0C0b0C SSSU0@0 0DT dS$ 09R P"P T 0U8$UQUDT P 0 sS @ @ @U00@@@ X 00 l Pw0S00 0 000 00P4Ѝ.Qr@-,@ (R'$Ov&@!0@- @    O-@0p Pp`G0 00000ZI00SB_: W `B?F ᴐ(,(P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p(0P  C @- 4w co`/D !.s@-@PH` 008,V @ wЍp((J !Is@-PX00S@H0`ă5#040<,V @ wЍp(((O !hh10 PS/C-TQ@@MPM`6`@f$a 1p P09 0 T:@6S0O@ , DD6ۍЍC+ 0P \ 010 S a8!#4a4# 0^ P;0Ty 0+ۍЍ(((((T !G-HB` px/PP$"$v 0F0( 40 06# R 0 !kv0 60C 0 !Yv0006&0=06 0  B 00C0( 6V0:`! `Vp 0>$&0? 60(0 6 C c0 0 &$&?0`L0V&S %\0: S `0d  &ЍGG1< ((I( !%A-Ta00S FT:p.PP  0 0A1S0S1 P @D A01 S  u0S @2106&0006   B ! ! 00C 00( !O-@PGM@XY?P>U㰐Y  0@00D @/60d& 6F H z Td> R`$0)u h2 XSQ 0@H0} 0 R (cR 5-0$00ᓩ (00UC (0 , P(0,   @R 0 0 $0F 崼0 0 60 6< 0(0,200UX,0000@| PD   D $`0P 0H\ d0(@4LPXX 0T0;0Lh5!*L0So h-);PU ᾿Pc  喺0L VR0400$ & \`#  @ \ 110B0oF0D?0$APpepeC0CP!P`\` :0p0>-P`0"  pF 0(0d0040\0@080< <0(02(,0 0C0)0C000 SJY 0Hj00 pS D!*&A 7 @ KN|) 0 ( "*AN 6 !"0H& 0 09PpD |IH&0SK9 R070Ds$0S 40S `PD@ 80S<000 Sg0C Zp,  00 001(0@`@ QHR'0 Xx0S7 0S00S00 0  C02#(0cM7P p WPPXP 0R SHS SQF`@pb Spm0 0Y 0:Y:tV3006X  0+(01 0:0 J4T  060 6&$(6Y:$0TSL0S d0 P V50SapW~@0S ԿD5L R d0 P# 0PDT%_oRU+E4&0#.H6 C 0 ᓔ)6 40 눔p 6`U0CT 00C0CSX: B 5Y1 21[0!!!0 Sq# 0 ᓢ"  0d0$&S: 060& 0vg0.LxGz 0W4#0003 LpXk0SMf`F`VI l30SA LW ]LD3PUBL0S \0:`0l ㉑ PP1 P# zG37V6|0X0000V096 30;Pp`fL#r^` Lp` zX27ZVX0000Uf &1 #?1#  0RP *d "x P0 |0PPP!f v*`Pw!\ *P  6p!dS!PU:< U*!:0U: -0 -0 xp$L0S\^UB: 5((/(W( %%> (| (%QNS H(( X( ( 7 (n  ! xu&ht@@v&Pq r_ SA h  2 b   ! 0 % %A$% !Z ,(((0Q:BS! ^0 B 6Psd  0P0 S %%* 呐  0p1Pl 1 !7P 8 `U&`D1l6\0U/0 x xL0S `0  1#'$/%17GU\X0|000T090& 2|0P((  /0 `px2& 0x90Df?o2U+u &0#6` c2H H0 HDTGߍW@G-`RM@Xr pPP 0pP`  `P P7  Tp 0S *ߍ<08 H(00,0 000040!04 04$0D0(0P jWP  `TpJ @Tp  4Up0` 0 I  M  { w s 0 GTp 0`?`a8SڂdPb 0  0**0P0_  0* ͩd@edAzd@RT +?A-PCMMPp`;8 2cp@P  P0APRU00 ## CލЍ@-`p  V @P00S0?0\$ 0S 0 oS\F\GL \ T4dDdgL0 SDKT ЍE%KUJ%FZO%A_0   @-P LrJDDP<@ /嗺0P00 , @R  T_0[0Sj 1Sg 1Sd 0 @D1C0S [  [ *0SR3#:\00<0S @!0S P@ T <0 0P U8 PDJp82P@@11 1 1d000Z0`S`Sx0S4\0L 0H?0 $0Sp+ p`PpC0S)0p2 p1S?V?`#)$p& a1S)p Q1SAe1S X$#Pp< k 2"OKK@0DP?`|KL0OK\0K@L0 0Z0T0Q0S<I[# [ [ ? [l0S |-80S l0Sd0h 000@0D0 ,#h0S d0S  T*,800S0 [0S0S"  0C0T {0#Suҿ0S0`0S S Pe,0S , 0C0,00`00l0S1|0 0S010S 1h0S(1d0S,140S /Ķ40P(0&Eb0P(0 (nNpp(fO0P!* Rb R ᬾV 00S(dR0(0S00[X1` 00PV`5U0000AP0pY ,g'HE똵U p< 0 pSf:Yf$10p+p`$uU ?! 0`SM:(!XR&0S ,1 S$40(00p000 [ 0R5 R4*P (!RP5P"S4U $R,1SPP,Q,1 SR U |\SRQ SP" 01S<1 þP3P%P5 1CP0巾Y [  0Dା0P000pP1+!`GT0b#02b! b&X 0S [ ) Y': [ᆾ00ŸS#."T0 S :0㈀ 0[q00@ŸS#j00S#? 00Y`T00 !000 30q W5e:0+a! `  +!  G0  h [dQ [XQRU10A+!2".Y0 0@b"0` t0 0 +!H 0@G00S1!YV*0R !zpBxD}&^%[=|=5 Ao5c8W`/? /RN.r&4PX`iqL\h ~rv&,)gfffp!URRaArrAa [0 [00S 0, S00R 0, t  [0 [00 c\U* 0!A(1(Q R0XLC101S0S0010 [0\S 03 $!q515C000 T0CP0S C1S,0 C1\0C C?0Y0 C>0!0E?00@0C1SL0 \CY$! pCtCPr(bRQCC,QC BCH0S yލ ЍS03150q5 [ 1 1S|0_ ? C0 H0#2>`"PP iHM?C#>Y 0 T02#H0 [00H <080$40`0P0#40d0,0#40h0@0$0Q l $   Xt  0|0(4Q0X080 S @40S d8௼80 0x 0|C0$040S' [#,q4 0W0W03 W00S pZ@ D0pp͹0S  p`Kp T  ($ p Z [,1T C/oS" R `0 [ 0 0 @ 000000P00d00,00h00\0001010100L0 0  1$00(0$1,0J?03K?03)001x 01100 0T2 ?@1c4 04 v. 08#$0 #(#<l 0 0&Bt ?Q X0Q40S00|00o0 00 R  ST @XaH'?  $JpF TS x(!R R S 0 S7071011H0T RZ* JQQ\0 [0 0+ S  R   0S* 0H0< 0J?oR20S D(0 00 25 010 0P B24 0180S{ 0`( "4`#/A-0 0P@p @0s0 `Tpk 0PseA@00@- 44@4P\P 0B"" 0)-@=B'X)@- aBX?1v&G-@P ` b!>0P V0 0  PP GX pP`0w, 0P;g0S 44g0 }V 0)-s@-pP@ 0  9X 0TT@LЍp  P `90 @0)zp@) @- 04#$$04GQ   -A Ѝyp@-$MPp  / @1 00@ 0! 0A)) A1 pAg9`Ab9P@`PDpATV@D:$Ѝ@Wr~YHp@-0A0MP`   0 0 010R  2   $0Ѝp@@R  #   $R 0S1#$$ 0("( 18#! 0Ѝp@@0Ѝp0) @-HpQfX)L@-0 L@ R0* 0 #  P)P `00CS`0p S00 P0S X0X /XAu&p@-`b@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hβd̲`0;Pp <10C <1$0 810S810)@%@v&v&p)O-@ ^"44”P dQ\4$M2=p2 04P 0;t8  t,  t  P0S 0 8xS`S*?S DS . y000Sy*P0C :K+ C 00CK+ æ00CS00dSa0CSX-L,-d..L,L,,/L,L,L,/L,L,L,855L,6L,L,5P65 ⼫  sWPK 0@P( 0@0 9 90S|9 00K  K W ▫ < MWPK 0 Y PK. D;K  y  0WPoK P 0K. 80  _ t W@PU T80S 7  G  VP= 8 (<08808407007,07(07$07 0707070707 07070707:   VP K  PP 070Sx'0 0C!0R3x X70S0Sq K 4 @P PRKh <PK t0@Pp[ K> 0 pڪt`@@hP0V"0T  HT\HX0Qx0pW pdR000QSL00D0Q\DD0@~0 `X\ X0S 0PV)PP TPP K 0P@0 K. F:K>x%x 0 )9 `@씟D@pP @ VG| x 0S$0 0C!0R3 0S0S 0`0~P `0xP c=0,C 0  R+ .t 9 ޤ0  d0|d0`@ 4KR p 1  1 S 01 \Q \HHA/p@!bJ L0 S1P00P0P D0S( X3 R  h9  X   `%H0 S   \0T0 S `,@0SG @DUYC  ĩ  {UP0S|& x 0 ⲩ ` iUPcݍЍ ⥩4  ⟩  VUPPA0S, P ⋩  BUP ~  5UPt r x )UPPh@d0SXT000+ 9MXY8' Y%***&d*v&&&` &&)7r `*d%9D&&(;4*W''k'2'''''(((Q(((((( )))&M|*H*gfffE)l X) Sq),')r)8(0)))))))@-<00iS03S ! ?[P58***l0@-h@   Ly @0t 0o j*8*=*E*M*V**@-`0@Px0 B0PU1 S2P T0p0S @0R<< 0,$pu8 Ѝ`%|*H*_*D@v&d*C-PD1`0B8! Y!R!tM@p  10S Q8 tЍ000iS00S 00S d `P $7W @ 0  P ( ᕱP000 p 0pf W@000`%|*4*n*@v&8*H*d%*`0@-@X0 B0@T1 S2@ 0P   0S `%|*O-tQ0S hhfT @P 0S <@[@ [ R  R  R* T Y    ```_ @$ R 1  17 V 00030S3Ѝ  R  R  `& "  V Q `Y W  0D X@00030S 4`60 6X0000  000S 0dd6 0  0@0020S `0 Ya  i 00  0X@g0000Sp X     Rd @ 0 0 <T R(q0S / @T  0@g  0 @$ 0 @Wl00S 0 xP} 0 h0D>60 D$66|**4**@v&++ +v&3+E+b+*+++l1G-0S \\@`PqP T0 :@18a P8qU @T+$PuP@`0S 0D !0R3 PȐ尠U 0S 0S   58P0S0S \0S  5 @H*@v&+p*4**,|*1,0A-0S 4P `p @T V @\PT$@ 0S$p$00_`@H*@v&I,*j,O-!1 RR0夑S @P|q| 0P0: ЍS DP`P 0 5] ]5000p PP@:SR  0H5| Q y`P 0pm0 000$n0008*H**@v&,*p*,,,v&,--2O-0S  0b00 Eg1P0pȡP@ #0pP00Z: P0 *@@ @ W0: R0*0 S( 10 R S U0:W00#03RQ00S &P 0000 S Phr \ X4000P@ ЍH*@v&1-*p***,v&C-MM@PQ 0S  0 k`000@T0S @p㼀 T0:ۍЍ`PP@p0 F Y >  /000PU2 H*@v&J-Y-p*0A-0S P`||p U0(@TP`0  RF000S C@H*@v&d-p*}-A-p`P@P 3_p0S 0X0 0C?oR20S ,DoS 0-v&--p@-/0@Pޫ 0Pp SRp*@-8@0S$0$ 0 030-<. *-.v&A-@0`0/0000 SPڤ/0>+b T0 P<P0? 4 ј00?*+n%0@-@0 0坩0@0Ѝs@-@P`P @TZ TTa3?0 00?Ⴉ+"+R  + ;Ѝpk.v&$0L<S/ @-難P+n%O- 2@`VCM b@0DXCߍpTW B/ 60 S'44x'xpX j@t1P0S8Q 0SD{'{{g W:0000[9*0S n0 0S e0 000R*Q 20S `X0 c#.$cc4"0,4 4Q0 P 00000S  ` ,*+@v&...+H*@-<q:p @,P}:0@0n% O-X3p0]MS DD@c@C 800#0k100RS #0`1~p"& jhRPP "zWz2W 0"D100RS[ 0"91x~ph"lLAhPP"L  PpDDB@@r0PSY : SVHK`P؀/0 610L<aS$ < 8H @ ( D `  P  `\  T  ؂X  8UP ,9  28!88"hG/0>+b  P<=P P f0?0H @P hP)PD & 1L P hPBP|]ߍH*@v&.h* *8*/n%/+F/d/n%r/%/ */*/n0NdN+/v&n%/@-$@0 00: S*G-@ q `0S+J9P 00S P0 S00P R HRڄ00S td1 Y `ǪP 0 Y00:$00S $K1p*4*v&/0 30O-AMM`P@gpP8 0 840 AލЍO/0 009/P7 0p!p 0 [`Q D D @P <|PD z@P@ 1 1 0dPD b@D t`Ġ崰TAލЍ0A. 4B   R ; 0 0 0D E@D W`0 ⸛ 0 D Wl + }0v&U0 S0A-MM00 /R @`㨀psPP 0S P@ۍЍ0 D &Ѡ`D @P 0V LP`ꝉ +p@-0@ @P P @p@-@M8@O-3tM0 S ttp00RS`3 T3T#0PE;:^E7E""442""442T0AS8Ċ,Ċ ` Pk PI lPdT0S40S xx00[XU R O!"441 40F""44"2"44"2"44"2"44(23(,0,T-TX*X\'\`$`+g0 # #1 0002#22 02 0 (0#(0/,0, H0T0/X0X0\ `0/`0d 0,d⃡20i0005/(0, |2-02R0L "S " 0x30=00 2R 00# |# #X0/80\ /`0d 0 %0L0<040h00S!##3 |#t h1S 0SP! Da! AQꠌ(0 0#9-0CS #  R0 R R 0N\ \0|Tt0=0- 9!m,*lT+H*@v&<k4*=r :=v&[=p%o s======C- 2 B P000000 MQaM0S q쑟=聟0=P  RP 0AS^갏p=0p、0W\hq P  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ"0=ۍЍt0 h0P0`0\0S H,@]r7**T+*h*+*>v&p*>(>9>Q>n>O-AM0A(0 "S $U+p0 (У0AC5/0(0#R00 #0Q0h2P00 (0S $0(C#5/0(0,0S3,0P0?0!#0,0@ (P Aۍ<ЍP(0S  +p0(У͡0AC5/0(0+p0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B"0S 8#R00SQ 00S \0l 9P tl!x3  P8P0S*T>++*p%>*+?4*>@v&> 0 *n@-@0SS*0O-wM0""<080000@ 040P0 00  0H0@0@L P0D`)PP:P S  S  S;  S 0 ``!p SK  S"  S<60S  ,,t!(60S *6v0S -0)P2 050S  S!Ѝ50S P 0 L50S  <<8! 0,000%p,,Y0S40S  !40S =* P 0 0 8'' ))V0 00 `40S 0 H (30S   30S30S ) ?S)P! 0> ((V 0 0 8Q'N'P30S` P [L 0 0#p0 0020S   20S620S )(PԞO 0 ((V 0 0 8''20S 0 $m"p0 00c (10S 403/ ^(^(!PbV00 0?X10S00S 0 0 86(3(00S 0 '4\  03/`V 4   00` (*C?v&H*?@v&D*<*+4@^?d%q?opp?+@*8??| n@@/@0*+q4s5K P@A-1( 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-CP- !0 010000 QP 0PT 0$M %P ЍPB 0P;C0P|80S050 000 0 @ 00 0**T>+^@p*@>p@@-|cM0S ll庼hChS0S Y^P0#0,,( R0& 2r 0 0500K Pr5"0C590C990C9000Ph|n xq0S \2d"`2Q090 9Bv&H*fB@v&p@-@PP` T0:pFP 0S 0@Pp*p@-@PT0*p.P 0S 0@TP0@-@  s0  xhm0 dPg0 P8a0 < [0@ (U +8*zBBBBBB+p@-P@P @0 4 0D !0R3 kp|*Bv&A-Pp` ]=00CS0T@ T 00CS0T P yTnTyDo0 @00  0 0 Sv&d*t{-@- T 1L00S @P@0PHЍ@Ѝ/v&L*XBR7@-P@00S#$P W0  Ѝ0R00S$PB0 l`X00SD 0@P<$00S $ <*Bv& C6CH*BOC@v&B@-@   P   P  P  h$P l H\0QX X ( H@0Rv&fCCuCCCCC-wCCC0@-@MPPPP8  P$0$ $GЍ0PDDD +@-0@ M \0 00B Xz5 ۍ'Dp@-0@S g&t0P0SdR%P 0@00s p@044000Sp p@ GD<*[Dv&H*lD@v&A-/`@Pp/@DЍ/SpPP 30 002P0000S@-0@S  0S 0 000h0@0S C$P @044000S @zDD<*[Dv&H*D@v&@-0@S 0 000d0@0S $Pf @000,00S @D<*[Dv&H*D@v&@-0@S 0 000ld0@0S \#P8 @000_,00S @VD<*Ev&H*(E@v&C-0M.S`p4P4A0/SS 庸0  03U ! 媸  夸  !      p  x X  d I00@ < @Ѝ@*j Cߍ0zF$+@- @ R200$+F @-$M0h `  P @PPDp$ЍPU D\!0P >F=8$+Ep@- M0P@H  o 4` %! !! ЍpF$+ -\M0 PT  \ЍFQ -CM0( B Cߍ/FF 0`( "4`#/p@-`Pᠫ0 R  @  0!S \X?> >!>T0 0 d Dop$+qGKGp@-P@U U  0<\ $Up@  GG@v&GP 7P P / //GGG-M M? 0^ۍ Ѝ@v&4`00CS`0 XoX0 X /u&O-pQDMDЍO覊@x `lP !W200 u00020PS00C00@@ Rp@T3 W+X( U U P   ᛕ  30. k   ዕ  ҕ.0X   p8M p W@v&G!$+Ii zp$+3<0S/@-@QPM PЍ@ p31Q``X00CS<<<<<<8ĺ"n1PЍ@L b!0S SL   Rd0AS&x̻ԻHC 0S0PЍ@$ 2 , ( $0.1hS fS501 0400030020j0CS PЍ@=01 (0<00$0;0d 0:0090080070060 0500400300201jS$ $Q Q ( xVPЍ$+G!&HHr!H!5H9!f!THfHHcHpH}HH=HHiNHH'IFIMNI!pI:!yIO-@`pRDJv!XJv&O-<`0S000 $p00P0@0 0@S X`hP$ PP P00 P0G00 WL00L00 ЍPP PPXV "XX `0 0Bp W aB^WBAB^7BR"Q@|0 0V0C0V € 0B ^aBQWB V 0B \aBQWB Y/奅PH W3L0 S p 8  ЍO6Jp/00ԟP2Jp"KP PNP1 000 zᶟP @ PWH DᣟP WL0S NJp4IJp ;:$+<%J#qGp@-P(@P ᎎPp@%0S $  R R  0@- eN(+@- (0 0 0 0 0AЍNLmNyNP P P.NNNN@-(M0@ #\S@3@#:@ (Ѝ !N7@-P|  @P .ÄPP @PQS , Ѝ0#)+(+0@-@QPM 41a! 4aDaS@$0d@Oo@@1e% 4eeT# ! "Q  R UP Q T%<  @W,Ѝ0%(T h \F%T @ 0;P" $ @ 2N(+#NNN Q@-.@h0 \!@@QR  0(+!*+0s@- @R`  0P.P ,#0S ,|Ѝp l0!PU U 0< 4Ѝp@!Ѝp@H%)+#(+N@-@T T 0( ( ЍЍ@,Ѝ@N(+"!Q p@-@P T p@<  p@0 p@zp>O-0TM@0"00 p` @@0@$(@t}P P~TЍ|PP8 @@0]}Pt@hlT:TЍO0 EW y R@x   ;y0P `yK  ,\100 0 S00C00  Q,4P `0 l0 0`f L` `pX`00CS`0 X0@X0 X INNH%h*Ou&@-00B Ѝ@-0  : ЍO-@p P4 aTAD -QP  P PPP@D`FRPP00SP ЍO@-0@ 00 Ѝ@?@- $Ov&@-[bO@-QAM`@0Vp M0d!/aXQX!0TL0P 0Ð0 ,Aލ ЍP0001!! |?t0C s!R  0G‚@PN: b :E<T0 <V<@D@ \0D0X L@ DDï*+}OOOvOrOO0+N.OP=P@-0+0@-6S N*+]P@-Gxm/l`@P" XT3C  <4>, @]PjP,+E,+@-% eRv&0@-h@  0@ 0\0CS @CD}&00S/p@-8P@U``p840#U: 0X 00rX0X40P80 0X0p`P -7@- 0@P0v0P R*0 B Ѝ0@Ѝ/O-PdMP ╎@ T0D 0 S vdЍ`p | J ]  ^`T!0 J0  ᳎0  .0`  V0BHP WHD}&RRC-@`Pp㬀嬐@"!0# U 0 pp p<6 vP@T0S0K-P    Ѝc>R!RrR-,M= H0 $0@0080000 0(0( $$0 ASUS^ShSrSSv&R-7@-`P @XT@ R 0@  $000 Ѝ0@Ѝ/X%&p1+Sp@-PP@ 0S 0CS 23 0 0p p@ hh 0 00Sp  0 0pr Upp1+1+SdDA- `(p 0rzpЍ P 5w@P  PP 0[zpЍAt01Sh0 ` 0X2TpT 0` 0S ^` FP `Sp1+X%2j rSHA-Q@1(pS1S` W 1SQU(W1S WЍWx1x lQU %ЍA <1ЍAfW(WQU0S) S S UU   ? CU  .WЍA(   / U P DD ЍAp1+X%2j @v&&L\h SS@Ix4 0Q 000/ p1+X%SA-|AJM1MSh =`p0 `P⠌ c40`0 Pyp0S JލЍ;X P0傌A7J.H0 0A1$HpL  $`0P0p0 PHyp, Li0S8b1!0 p1+#THTeTdDG-xAp1 `S1SP V1S \$V1S VG 1tV 0 c\ GVV\\0  嘠EPe0SVGxA1S ;Q 1S 3 0. G p1+@v&X%2j &H~TA-a0 MSP@1St)X0@sԓX 4 0 0 0 0P3A7/,%00D0 Jލ ЍX@  RH 1 H0qpH0S# 0 0 @3SH  /n8pW%$RZ 0 00@0P0@3A4/HpX񟗶  0 0 @3SP1 04S) 403001]P  0Aqp 0040 [*Y 0 S P40So0 00   $ $  0`p`08ᛣ#0S P   B ( P R0X0,( 0P$0 ,( R$0H0pp pp0p<  H0pp pp0p+;㨀H0 H0ppp!0 Sp HpP  H0ppW 0 0H0lpH0pp Hpp0pH@P0P p ppH0tpp 0H F1+% r %2j p1+&#W*W5Wv85+>WHWQWYWcWkWuW>4yWW 7WWWWV!WWW4+WWX%XO-`ؿqM=P `_v@Pp Up#*p0T?SpDp00rP.0`0p/809` R  0P1S@?"@`  300 14@,0 ,&@@<@%@%v0pP@ @0WX!3W0 SC0JSI ` <  =vP@8PYP p080,N P8@ T@pDP3Y =y-  0S qߍ,u0P00T  8Q80S ` 0S0Sp  PY@P,T ~P ~P040 ~P040 ~P ~P040 |~P  h `~PT  8804S  0S0S ~P T  880pS  d0S0S!1R0 0:q~d~P9T] 0`080 Ro aBQ#       |                 ikklgj   p  l 975/ 8 k8 W $ R R0!P  : <0<00140kS00   0H0x9Xh)   8 78 W \ R R0S*  %00140kS% 0404@T0qt4tT:k 꿂 8 8 W p R R `001  k40S0 S01X40S~   0H0 4@Tt@0s;p00k4@ThXeX01S|^4@Tj0@sq o0P.&90004 081@AvvP8 Bo804@U08080S@00 @ c/4 4 6@ @m6p8 80 @ Y@0-1 `0400<0,0@mp' X0H?oT20S 0H?oT20S0H?oT20X0S0pp0r1!05 1"04 @1@SX` 0 ☀ 0tH0c?D`D0`5p`H FmpH0SX Z}H-0A1 ^d! `0 D00P0`qFmp* t1!0`100CS<$H$1"@ =Ps@P qߍOdoob4S g043((0 0,0c?00400003, plp;WO,^H RT=00D@ d`P0=S "8 R0  0P 0=Sd h"8 R @`  P 0=S 0"8 R  qߍO( TV0@40,00@pQVD@0S 1SL X* 5PP `V-,  0 0(0 0,003Ap06/00`8T"Xr(@,PX\0,S(` T'&Ԁ Xqp ʀ0"S ƀA ~0 SX0T R: p1+j X%%X>Y/1 XFXhX{XDDXXX&Xd XYYiYKZYYYZ&ZZlZZZ!ZZ [#([%J=[F[\[~[4+[[dDX1+00S, S S0&P00CsL " `B0P T0LP0PT0pkpW65h0l PJ000&00' T00.T0hPE0S @@T T T0P 00,0@L D @' 0`@0 J000.00}0h 00PP \0pkp WqߍO0S \0,`[0 0 0LT0( 00,00p @-@P  | xx lt `p Tl Hh <d ,`Wv&`=`^`l`````at0p@-@PT`z P   p@0p@o D6+a/a@-M @ P  7& Pۍzpp@-IMM @`PIލЍp / P0 0 lhP 0S 0S0 0S  : PzpNasaD6+@-M @ PDSۍ00 R    PzpD6+H-p`3M|M PPWZ@PzP <zP@ P04yPV 7 P00S , P  Q PPi P tyP ,zp[ , P U(f%P0S V! J1!0 0J P RB PQ m~ 0 UxtJ|!|1h@  R$BP< P~ @c4S J P pR/ Ph 0R :CoP᫲ cy > ]yP00 S5VP~0 xxp~0 `XpD6+a] zpaaaaƞ aa aFbba!bv&fbO-pMM`;p.p P@@ p p p0Wp㼱0Z:0S xލЍ0 0W@P\ @PLqLL?HxP  1pZ`V㟉 1Z SP }Z.pZP }Z.20Sa00 0Z:0V9 Z-P {}\Z.@)0T:Z^P l}Z. |d2j edABxbD6+,sbFb@-0`0 0]PP 0@PT ]P Ѝp@b0(PP DЍp!Pq O-tM< 8@40LPPptЍB0PP(0  (:0P$0,#$0U  T T T;P07W 0oT6P07W 01P07W 00S\PT7TP 004 0S0R0S00 00 (0$@` 00@TH*H7H'0D7 0<7<087P0T0@(0@P,@$00Cs$0640S 0TS0[dDt   0`( p~  ;X pv xX `(j0P0L6PV 0n0BnS010<0S 08 SJ ?@0?D000S5 0S>P ?Pv T0z HPpo 0@v? 0H8v0L 05,`p1, 0v/ 05.H L R,0 0,0 0@000D0@ B^op `4 0p0`X p $?4 $;` p H\$?4 ;$h p X0 08T00 0+`p+ 0$/ 3.h `Pɏ 0u` 0u  0B0SP0剤T400[S%  p8c0p`$XF p $;`> p 0@[ 04$;h2 p h0` XP 0u `0~u 0@[00P  0ru 000 X,0S0T4 00[S>  paX0 p`$ pH 4`P$; p> 0[ 04$;h p2  w&`p r& 0y. <1-h00H!T0@PP \&`p W& 0^. 0-0[P ȯ 0u 0t 0 tT0| |cj@ ddcc5c?=fdEdodLdrd;xdY@dddddeKeQeke@-z ev&A-@`4Sp  PT0DPEE$UX uP00uP 0-80 oP $!3MDPE@Dl6+ zpp@-P@Q0 _ 0 puP @0S \b$Pp Hgg0@ 0< 0p R$P$%e+e ,e , , ,e@-4800S ,0 0$p  `e+e+Ox:+O-\M0 MS1 HpW-Q`@`((Q(0 m+ 0=P 0 0 ۍ Ѝ0 000nS ?S aS ppS qS x0  0 d00L0G0 8f+e+fe+u&f + f@}&ˍ0fSfkfA-X`0S L00S 08P8@p0Pp00 +e+f+e+@-@L0@h3@00S_',0, 0S00W'f+e+e+8,|;+C-RP`tM  ,,E P RQ ğE R`S k0t`FQ ğR   TDR 7 4* CR ` 0S $ L@x ,4\ P20@04ßQ [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+e`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0ʗ00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊD}&@}&, , , ,e+/gPA-@@P@T -.@ P`p0Sl冗 d0 @ P ,0< 8(0@A%Pq e+2j  , ,KgA-@P@pP0`S00|0 R d R 0L 0S @!P@`T ! ,(f+j+%mgH ,eeP@-- 0 C ,gP@-- 0 7 ,m P@-- 0 + ,gP@- - 0 0  ,e+l ,gP@- - 0 0 u ,e+ ,gP@- - 0 0 c ,e+ ,gP0p@-AM 00@0 0@Sg- P1 PS" 0S00!Ck;P 0S0>PP 0T00aS0` 00S0``0 CK;PaS` 0` 0R`0 0@0S0@T@ @0 Q000S0r'NAލp ,h h4,hhh(,$,G-1MMP, 84 1ݍЍP0$C;P @4@0  PZ30S Scs  6@PQ 0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2&Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2& Qy10Su 1@P0001@h, 9u 0PQ0S0Tɹ,PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o2b&Q|00S  d0 0P000<0P ,&h +* x:+e+e+(,f+$,4,hhf+e+,,2hPC-p0JM M 00@0 0@S+ 1 @Jލ ЍS2 0S! 9P 0S0=PP T0  x1x t1 R0 0S0QY`# 81 0S ,1, ! 9PY$Pu0S @'00 R   R 0 (|0p00Q5qp P0ST00@ ,h,,$,(,$ ,e+NhhnyH,~h 0 0 0 0ZH,hpS 0 0 0 0OH,hC-KM MP"+ |2 Kލ ЍP0`"C'9P @@2@<2000,ZpP 2 0S@ 2 `. P0 aQq0S 0S 00 4@P .d1@0S t6PL1 `0P <1P 00-4 0 RU A)e+q(f+'q A-PP   R ЍA1P   R  @0S00Ѝ@`p ,X%e+r>q0A-p`P0 A P' @PLp @AP 700 00 ,e+qGqp@-X@PP D0 p<00Sp@,0,@0 0Pp(f+ ,$ ,e+Xqqp@-0@p@SP \0 pT00Sp@D0D 0P0,Pp(f+ ,$ ,e+qqqp@- @x@RP d0 p\ Rp@L0L P0 ,Pp (f+ ,$ ,e+qqqO-MMPQ u 3 ٍЍP0 #Cz+P S@p3`X 3 |@ 5PP@)LPT0`t' P00S 0P @B0S000p@I2匆2@0SP$S \S0P0" 0   0  P#"00B   BR 0 D )bT0 Y@0SPiR0PS 0 D)bS0 Y@P1@ d1 0S x10SL1h`10S ,0)00CS0. ? S0 03/00S 0S 000CS0 S0  )tS00000i0  X 0`S8 ,o+k+e+Us+D}&e+mme+m(f+e+e+@-@P 00P 00P00 -h0lM  X00S kfH 0d P000p cf+e+lse+=+-lMT00S KfD 0d P,00p  Ce+se+=+A-@9XP` p0 0C0SQ3  MPP 0 B RQP  00 0C0SP3 p@-`P@:WP R- 0S1PS !xH-p@lD-C+`)P %WP00 04-S!0Rsx<sp@-@P 00PU W dPp00p@-`Pp@0P<G0 .?0Sp 0h R00  Ѝ0 0S0C B RQ"  j+sP/0S/0@-@Q0%Q#0S P   R   07W0C2007W  BD}&G-`P(P @ LP  LPU0 00 P0 10S / VPe |*P@VP 0pS 02P pm*:PVP pe*P :VPQ p000 SPY0S 00S1 @RđU0 pZ `SLP0 0 U 0*-*** 0 011 ;0Ѝ @p) PQ 0S000 *0S 0PS S St0 0S 0`S@)H0pW ),psssj+tt tf+ f+r - BR0 R  P R O-0@!M M P<@8@4@@0D@@@KPm4` 0p 0S 0S 40S 0S H嵧@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /ZXTpKX`V P5PUp@ @l0S ;BX@P dP TP D|P8k (f000@0?)@P4UP 4@P@4)4:4UP 00+)<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU &QPPP @ @ PpW QpPp3 Q  `3 wc +ZP =0 080( S, $#(0 00 0$)0"0 0R S"  c`pPR  0(P0 Z , \0%T00S9 llX% 0S1  + P=0 00 (00$@0S0S20}S\# @/TP00Y@VN 0SK U +HO+ HO+HOH` +@O=0 00P$` Q(0 A `00+SO=0  0`0@@DcT@@0P/VP0,00(S  R[@psUw8t f+ItQtYtattj+te+f+& tD@ , ,v&thM0 0 )00 YQX /=0S-p= 8pR* p $p0p+0 R\P;0 00|S ;h@^0S;0y IhM A< @= 健d5\[,LNL;P0S004  V( ]:+ 0S 00S P0Py 0Sv &pIS̪ ϢPPP 0S :rUPR8SX :HHPPW AxPx0SV x0SZ h+0 0( P$P %RP  0`!U/1\1X1T100p `10T1S 0S \AT! 0S \P p [UR0 0@0S 00S P P&&\K8KύU000,! 0!c4 8!0R PP000_84010c/10Ab`P V`;04 TPtPt0S4 4 \laU`P@xTv e 0k_0P0/VP80S WPPk/@ꔗ IM EM00S \k?/H80S00?o 2z$PP0 tP60S P 0S%P 0S%6Fp圆VS[P@3|)xLtp60h6qP )00@T  R ^P 00@T Q ^P 00PO `M`ElP<zt'>)qP<m860S(`x@T*4!D'K0'$' 5 uPU<U0 0( 4F~ ' m@5 fl5@T O?00$0X@4!&t40ShPEI PT4T$T& &Px ,4R(&&p0STP/X3Uc d40SI 4  &TXP|&'p8XP 30S D4Pv~XU8cb30S 4  v&U@b l&UT  c&`R0<0`0=$ @0<BP= PP? 0 R ,2000@/ 9$`pP8p p$p0p! <0P,ȠZS @P  2Q00S P PHT 4 LTr p=+UwCvvv8f+iv+ ,rrv5rvvwOw Ywpf+rwww& wrf+k++"w+e+e+z j+hx)x7x|j+hvKx`xwwxj+sxhhxuuxxxxHxx8&D}&yzyw#yLy[yeygxyyyyyyz'zzRz1rzzzH,(f+zP,zpS{< Tz &{!6{j+S{u{{{|{<,Lf+@B=+{<{,f+Hf+|e+|@f+8f+PA PZ 0*S0 kQ0O0-SK _0Q $0B 00 S$0 0<0 0/R7 *R0 G0Qp80*000S%!0 0O5P 0, sL0\LsP 010Ss7XP #PxyP tP  lPT~V ᶿUnZa Z000SP NP P  "<APY Y V` pT ᅿჿU#/K/IR032 U 0S|#0 0up#2S 徠T$V ] $4Y0SK?00 T| V FC3 9}SK=|<4 儠T0SJ40C $ 00 00Q$00S00{s<0Q 0 00& t50S0|05|80sw58p00 RQ 60S50=epa6d R(6(&((qZ6R P L6(F!  686`l0Əs l<0l0I@T? V  O%PI\0 0 妾 2 @R \0"0C?o2? \"0 "0A8宽,000 R ;R @WP t000 R RT 0S>0S(0?'"( ,0".0S ?0.T0@.͡!͡!..R0n0"R0.͡0 ;$PP#PP0S0Sx80S#PP RB(H000.R0@D0$. 0 pwx'xT PVpPT \ X[XP\ #P U d S R|90S p90St9pyP $hO0S @DT90S pYF1!0S   PZ0S= S E#4: 4:` T00R0SC rPqJ  O$P  VP Ub d:0Sd: P _** ϠP 0; R#O 8;R.sr ZO%.!0Q3/P\p;@ ; R0;KTdh lp(#0S,0< 0R.K~ |=;0S 000S 000S 000S 00|iލ Ѝ0S 03/0S 00s@- P@HBP  BBP0P 1Ѝp`P  /BP 0 FUpP Ѝp@? 0S S0S  B0PPstts@|r0@-Mh 00P P10S 0S00 0 Ѝ  qQa @T0 S 00S 0s 0 :/LP 0 S000Bp@ T dwUP 0|S X00 0S00 0000j+e+ \ =+j+8f+h*@-`$MpP G0000000r@L0P/S:S y@P@tQV"P $ЍULP5@ F  F F0/0NPP":NpPP@P//000 09@P00.`0@@DcT@@00@0CcS1S@r , r8tPP00/@-Y (0@ 4 000Y@f+?+@-Y t0@ #d00S X0 0Pp <0000S vY@f+e+e+O?+@-Y@`00S T0 0Lp 8 10 10S RhY@e+e+O?+ h0@- X00S L0 0Dp 00 101000.f+e+e+O?+ + -X0lM@ d @E80 0p { f+^|e+@+@-0lM@0 0 00 0rS sS ld dEd XEP0 0p K,d $f+ +?+@,|||e+@+|@-`PP@ @0@s8#80U 0s8#8000@? P VU 0A0T0Ѝp00CS0 S0 S 0 /O-pTM|0x0?X0 "? 0p 0QX0P`0V0X B@B0 @040SD H 8PZ0S= S DV0  @P*iX0S eX0#S aX|0pS l1 R XaR 0# KIXtp uTЍ  ?$0000  PP,X0S (X0#S@DT|0S ph@"\K$0 V `|#L"0 0 "@B@f+e+O-@BMMV@ Al~?0a>0 @@0P`46 pP,6P<[6  BR  P5(50S5V % 0U LK0WU S00G00S(+ zD 0S+ 0 S( Z000[9  BR $5PP00CS00 5K @P00CS0 w0㠴0 0 {P8$ ap0,TS (400  00BލЍ@3@30S VW@@c3!J3 0p330S' U U# cT$30 CRKH3000+ [)[00E@ 0A>V0 `W4$2 22 =U[2000 p"00KT1#0V CR@U-[ 0S ,2  00 020 CRUT<10S@d@60 @S405  [ [P [ 10Sʶ50F?oU20S d10SX1p10S} U T U00T0SyT} dT([@ 0S10S 3/1V 0    0ZR\@\ 0YS P 9/ 10 XS P 8/0F?+ ,j+k+(f+j+e+k+k+Uj+!|8,D}& ,Vzlf+-A-` @T 哙 0 ЍAЍ/0p0$ P xJuI h0h 1Qo0@S LP 5/k+ } ,?+ <j+zmO-@sFM M`  @T T 0T0$0`30(0$ 0,@_W0P SUY0 0 3 Fލ ЍV0 @,Q(B2@@Ȳ@aGT   2 ~V 0 PD0P|2d KP `"`diB LeB0S 00S , 0(d ; UPP d⵶@0S00?o2 P vT0@67V6 D01@p  d卶 01 D0(66S0d00 0d0 A 0`PS 唘P P 00S t0 |0'P@ 0 @00,`@0?E+pf+,} , ,(f+w& e+wwE+E}Qk+k+y}}0O- WJMMsn0pFXv600S00p m 9PX 6  60 9PXJލЍD60 0 0,0]97S 60Sa 6 s70050S# 䵟0S5 Q S 5R "P 0S 500CS\5|s00l;0S P97S, 5D 58%80S 500CSX0$000(00000 1 PN 40000S40܀C XSX @4000C 0h00d0$ 0`0 P@ C P 38w!>\ 0h0d<` ((0#$0#c# $c4"$( <7$("", &R h3U0 R0S R3""44008'P 2Xp0097S0000 0z 0S  | 0pp8'dP820 00 0Y 0 iR XpP 087P0δ 97R` S㸁 0S [10S/ 0S+,0 00 0<0 1, IP8!81 R  t 0 ) 1Z&P 0S 0097S;7(0:70?70>7='<0S P0s00UX0 0Su [X  T?+f+4f+j+E+}j+ f+e+}\f+e+df+j+(f+} ,}}~k+8~A+~<~c~u~~E+~-[{@-2Bp`WLM LЍ@  pPk  zpe 00011 0S<0 ?!tq((00 Q 00SZ=9Q ='/?@#b!"/p8R0S R0#S 0(60 8Jpp R0S R0#S ޳7 p)p 90S0 00 0 0=< LЍP400f+4f+j+Mb?+0A-H`D0 82Vp  R`RBR RB`2b  Q  ,%?00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41  R>V >V >0 l!l! +>+>+W>+W> 0S000A/?+ e+F+HP+e+ ,E+k+ ,k+ , ,j+4,0,,,(,,$, , ,G-/PE`P 0U0/0@0T @`]~F+|>.0`5F1`dPPTX0p9V`@b@P X[`@P`0V0U0`.S00Eꝉ  _+e+Y+0@-XQM0MS DҔ@11S 01 ۍЍ0@ , @ P 0 oP 勲 D0 gPP  {01S 0 T  +p  P7P000S/-ۍЍ0k+<?+ ,^wk+00@-$M00D 0,LP@`4`$\4Q00P4@T D40S@ 440S@@$40SPp40S3pf 3 3p$Ѝ030SCP LPDhR `3 0 HvP@-(/0003 & dP@#R000' 00 08GP  t?P dd@P  H 2@K,2P0 S R0S S @T% 1Ao0S3 1o10S 1 VP5>PPKN,14S$]HP $00|S $P/$WA@7M0SR 3M0 SN $ [); (1RS ,1S $00-S0S : :$ <0S $ Eߍ0S x: 40st80su\JP~0000So,0Ss9 9 9T$ 9R P90S L0 S $P$00$0T $/00L0 S$P$T H90S<<9Q0SPPP=<0S!0S' Q+80S L(P 4 H8(|80sS|98  t/Pq00S  L$Pf@S,,0SCP 7 7 R0S\P,1SC$`GP!7,!(0L7 L7 (0xp(0-p 0: S 0'0'0l7 R,`7`'``I$00|S 8$8((0S$@|6,! x6 600$ ((0S6$6R P 6F60SP 50S 50S5P60S~ 0CS0<0S 5  (p(CQ$,0%p,0(0q(05P001!PLK0 SE4E00S 00(3/0(0,L,D0S4 S<Q  p40S 0 4R qp} X5%&0$Xp0opq,4P@$P  0e呬P$l勬<0S t0 0 @ 0(@\P` T0 0 0(0OPwdsl( 00CS0(3pk P @`( 0@#d>0 ? 0!$0 S0  , 000CS0 ,@ T @0S  @(>!, 0@(00@ U>,00@ J0 SG1(00@8 ~ (T!000t, 00CS0,p@ TD0rra+0P @- Pp@T Wp`W VL\ P  R/%O-@p`MDT oTP ЍOCT <<@DT#Ѝa 1 !Q@ QP ЍO 8S 0S P pP 0 P 0 X  6 03/0 00$Os]+9Ʉ%>q8($\!\R% R 8( -0 \ \ \; (R ( R 8( "\  \  0 ( ( !R0/\\\0^ (80\ "\0 0(88S08 S 0808]+<&p@-H0H@8D0 (8080$8P  Up$80+]++@-AaM(8S g0 S @ <0) P p p $8S 80pP\ UP 0S ,8S0g (8S 00CS0 0 0p 085 8$ 0p3/48S 0S 00CS0 S0  P0R H@ Ѝn]++Zu&.mmm\  \ P/@-@P$P  腇@-@@0s,00p 0Co@&e+4$0 00/O-tMM B0 @T(0PPZ@T= P  4 0 A0 \!`Z0 0P P@ !)P@0J04 3# 0 0#`8`Pڐ  #[3000 0f# ` |  {[ 0f 0H#`< k 000< 0gf0 # 0` U  S  RS00 "1f 0;#;Z0S;#;0 d*"?;#;0 #5;0?;#;0@#5;DED"X@d `U0` 0pPZ 2QV"0 P NP!!& 0 !!P 00`x!dYP 0e 04!P< 00@<e0! y 0$ @0S (P0S S 00d d@00 d^X 00p 0MߍP@ %U[0DEL(f+,f+`,.A@f+rN.@,݇Q! P,H,&0Oe+@-FX0@ R0D00S 80 00p F@@f+e+e+O-$M ?0 0 $Ѝ0-4M 00 000KFP4ЍO-pQMxFxV( "0p@&0 0P00000 PU08 RPU5"R e0*P\0 00$00S& (0s0S P l@!d50S` P%A`D5X05 $5  0dXd@0f$|4`4Y-IP 7IYڙ$@$壒I $f $2_`0 lğ R#3SPS0@ 18$0@0fE00`p`V 80pPZ`V= p i 3 0  0 "T3PT0@` 0P "@`0$% T+&`#3SPXK1d$K 00#50@0  "j2 @@V0Nx2d R@0p0,  0P0V001*x"3\?\ 0E0P"P@D2 0@p ~ (0S "%+0!P@`0U0!@(0S@0d!@t1 0@p JQߍ 0 V ," 0"h 1`P 0P  lP`< @0p<@e0 W@ Q`,H,@f+j+,f+p,H QD,zpP,Y@rX,Qr,!y!.A<e+j+O@~Nq @-D@6D@p@-Bd00` pd00CS01p ,P P00 @R0S"P8d`Qd00CS0+lp "P \Pd00CS0_p000S 8A0QPA p0 0 `V垇p0 c`Pd00CS02p 0@S P,P \Pd00CS0!p `V0 0 '?Pp@,D&,A-pp@`gP@ .5PP ]@P PE G+P@OoB@,O-,U0mMS p EPd C0S mߍ0P.0͵1}54PPd'0P0S SUpG Ph4P PP P0CSP  T  p- P P P0 PsdL>P P >P d0p dP 0? hÆddp P 0S d0p DP0? 壆p P 0S{0S df0 P P d00CS0&p\2\Ib P Q4280 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0\S81Pd00CS0p0 dL\0p 0 P`, ^0!S^0C0 dPXX qf+Q,r+ ,*7ie+oD}&o++e+k+@-0 @0SޥP  )P  0 00@ x0 lƥP T0 L彥P 00 ,崥P 0 D}&+q$ ,04< - BR0 R  P R p1A-0aS0P0P3U (P 00.S Ppd1l `L_)X1P@  H,W)P10T0!0!00 (1( .U 0 ! 0Aq000 00000P0 0 0pS000P0T h0h0 @U t0dP$0``j+(f+oAk+k+e+Fce+ , ,g , ,Kg$ ,lf+ qhsp@-@P M0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0pk+e+ , ,,j+4f+df+hf+e+k+ L0@- <00S 00 0(p Df+e+e+Oj+A-@SAQp0S `0S p 00`P00000S t`0S p 000080uT  Ape+k+4f+8,O-P"2 AM MR0xB p" R S4 P 04 S` 4S4P  $Aލ Ѝ4Sg1+-;004P/S +`-+\-PJpUp儑0倁 00g000000000S L1o$81 $1 R100CcSppW100S 0o 000000BO4SU00σ$@ՃPPTy #2P00 +f+,e+tj+ ۊ(f+<,,f+e+pS\k ,k+QA-Q0qS0`00@S Q`Ѝ0__P 1P j0 R 0000@ Pl00}S0s00T 0S$@,2_ j+(f+$ ,e+.Wk+D}& ,O-쁟a0AS000qSP4M Q 1_4ЍPF 1P0.0l1P00X1P" H@mP$,!0l20$A$000 0c@, m>1P 0 U@ P 0$0qp00P0}S0s00U 0S(@<^ >j+(f+$ , ,e+_k+k+Ћ@-,@02 嚬P,"A-`P㫢`p㧢 L|@P  8v@P $p@㓢9Pj@-@4P, 0A- 0@0PS0p`0P㬀" 0P 0S 0"S0x R S  p`"R"^ 0 00,j+(f+ ,,k+0@-M M P + @9Pۍ Ѝ0 Ph4/S0 @ oP;0@TP/P O-@P`pW 1@@Pp3:?9pF:9`ܰ0X1 00T@1`0 10S 0 SY B0] Q0a00S*00 0-0 ЍX,e+@-h>P0@0 @p TpP0 0SP0 0U>@Ѝe+ht@X,P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0CTf+Lf+Pf+Xf+@-0 000% &0S# R 0S0000S b0C("( R S             Ѝ D}&@}&@-(A`0S0 0 0 0!0~p 0S:S50P0S0 0 000 fpx0S:S5000h `0POpT՞00, 0 Cp(ɞЍpj+j+ *GC-@\ᄐpA`\P ^T1:00"\ \ L 9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR%0R0PMU20S2 2"0S0 C0GQ .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10N[00N B B ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0SP ^*0SPZ*@P0LG RX QP 0TJ*/0SE*<0 RS=*9 0S  7*+0S2*> @ S,*0 0 0GS$0P(0&e+h* ,,r,,/A-p`P @P0  T  `00T  =.0@ R   `FVp`00CS0 XA PpTD000`000 T00dru&C-pP` .@0尐TB[  00@)ax0@P`0 \寽BL00D P 0 Ѝ+?e+u&Ǎe+e+G-M@ ` 04P0 43`PT 2P #T( (30S+ ` Q `V` _p;0@00E.002 1P El"lp(;E@Xќލ p`0(T $œ p Tⷜ0q10@S  9 0$ 0/ 0$ pOp;0$S*F>C0S  X4 `$Q(00SZ=9Q =(/?@#b!"/0 0p4J;0S F;0#S Z?;0AS  T0 0000 0p 0S &;0#; 0 pw0LT P;<00& j+؍Rj+Mbwp@-@Pp@lp@-@PP` 6P 86Pp0Spp0| M@-@ႚP q@-{P똎@-@'{p P@-rPs0@-PlMQ@00 00 T  40S P 00 P 0 0r 0 PACcpW' 30S a,@^,@@` 5' L& &P ``PJ P }0 S8 0P 00P02  2 PP 800 @T , 8 P )0 0@T  , 8P lЍP 0S @P@E + 8  P@+ 8T T0S @P@&+ 80S @P@+ 8Tw 11@T  0P 0p`V4PP)}&000p0 0 0PhQ X^P@j+* rj+e+0f+2kM2u&dPǍ ,All!l+l,e+e++k+"w+e+e+,,7@-P; 1 Ѝ0Q0S 1 1P !70 CRhA R S0T!L1P 0S0,!S BP 0S 10S 0 0@ @%0 @0@%0 @%0 @%0 @% 0 00S 0U ,e+ ,Ze+80f+ f+xj+f+(f+m , , ,ɏ , ,ӏl ,h ,5K , ,H ,D ,f+00S#@-@0M, 7 0P0S8+|@@0Ѝ0@6f+2h-A- #,@-/ 0偽#,4,P `00CS`0p S00 P0S X0X /X⧷u&C-Pp@  l18C8S `lP 帾J0S  05`V   Ѝ ,p&#,t4,@-B44 ?p( P@ aP B44Ѝ44X0/LA%)P 00%T,Tꋐp&v&<0s@-@ 91`8C8S P0S & ) H%@0 >0nS 念Ѝp",p&",O",@-PMP Tt P H00S@0\A PЍ @P垵LB꿐,p&Ő@-@80T 創7BE 1",ِސD0@-|AT 0S i& 0 ͽd p& ,@07@-LAP/(0P00 A Ѝ0p& @-@0S S S 0\ \ \R@ R0 RG-P@ ?-  圀?- p ?-x` @ QT@D0 DЍGAs0  @T*Qs00!&zpG-AMMP`P%B  l2l h2 E\2 X^ 0 0 p&,",0@-EM,P ⡽PZ@P@Eߍ0 ,PP  庼 ᨼ굼 2x0 <  2`TPm埼 @ᰱ*@M> p&nO-`3MP@ pxxKt`2d#X3 T[UPE! `,S00CS0'p00 R0SjP!18C8S: `&eP22l18C8S  (꫐ 0 0 P`1 P8C8S 0 ` 0 = P\S,18C8S 0 ` 0 S 18C8S <18C8S tl18C8S 0㈱0wp1 ޻ RJX1P+ i V ,118C8S WpG(㐓P`1<18C8S0 喻 "ЍS R   R5NP0 UA0QLLD?",#,;p> ",",@#,p& ,#,,",,|p@-BM,`@P4P1 HP11(! 1 _PP?`14p&",v&P|-іBx 4h@-䩵t,@-@M h/- \0P0 0D0@10S - 10S0S@ЍoP  ~00S0@rP嗎 0 00S0S 00#P0P@0 S090+ ,<,^ t,", , ,zp t A-U0S7P@@P0Px% /Q4  \с`PPeDpMHu0S+ 85  05@,5 $5 5 R- + 5 400000@T ,P004@Ѝ0400/S@婷P v v vld0pxX,p 0SGQd0S p=0c p;0cs0S000S _: 0P0 0R P T3Q |30S p : hPX30S 2Q P 'o2: @wP 2 : oP 2l!: gP 2 : _P 2 : WP t2!: OP T2h,!: GP 42L<r> 0(4Ѝ0,p&@-`0S@ P8*0S 0000q20\ @V,m 7@-0Pl000@h R R  l R  P403/ Ѝ0Q Pp&&,zpp@-$A`1QS 0SP A$P00p00$0P $P0 $P0 t$P  ddg\G0H@H  "  \ pp&,>4d; m {v&D& ,00@-18C8S 0P F6p&#,@-(0(@ ۲0@ ",@#,",p@-`BM P@0 S0`018C8ST01y0 %0Pn00x0 ⫲BߍpB/ BR 0⾲00P y0001",p&pS#,", 0?o2 0/p&@-AM(( R ((0b0000@000  ጲPڶ0 q P 0SS WS BSr0 +lP  !Ts(0S  1@0S0 pW -18C8S ؀0S R     |P W 0@^S00CS00  S00 P0S",0n ,@#,,p&#,p@-PH@P@p#P P #P @p& 0/@-qo/A-@PP" p00CS"(s s s s s s s s `V s#PPU1P0 P00TA5 0S P0000 !0S0R 00 HWA-AP00C!SaXp `0000CSPu t pu Xu pu pu pu u `00CS`0p S X0 X 0 "S  I0S`00CS`0p SX0 X ! X!.ۨ0 0P0 P000 `Ǩ0"S0L0Ao50弨0 0P0 #,u&zpidQ@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 lG-@"P2 pqp =`P`(PP2 00PF 0P e; V @P @0S@0S400@U"PP?P PPP P 0!SPa w: #,Qp&A-@MPP\1 ᜧ Ũ@P `p崀  `jPu00u0ۍ0 P 0@ 0000S ֧  P00 Zp&Q!,p@-`@.PP 0 :Hp$!PB@p: s@-@P`  圱 R 啱 呱@T|卧Ѝp(R( d0PFP O<AP K(<P  ,f@}xt yt $,0@-@M@&0(@,0 0 W@P %Ѝ00,_x0 ƯXPPP8P0S %00@SP{ $,p& ,@-. (,:뤛$,@-@ ! lP  g0P3P xth  XT˃ 傯Ѝ ,xt yt Ǜʛf@0@-4MP4PX 1<18C8S զAh  0 9 0圃 LDR<P8 ,0E R  ;P! 71PP u0(0S$4Ѝ0=R咦00ESl~ ~ ~ ~ ~ ~ t冦h儦`\XT HvLp&" ,@v&.Q49$,# [?JYf@-0 帮@3 ,Q-@-ˆ0 R   ЍЍ/,%,-@-岈-@-i0 R   ЍЍ/,%,A-ARp`P@1T }pPV`@DO-dM@PÄ0P0㼄0P0 0 #8p800,@400(P@`@P p0p,0SX ,0S5TX L @@[ X  ( 0  0 ( (cBpkP T+o,00,00娂00T񟗾  < X | ؃   8 ( Q 0S0$S囆噆 0S dЍE 3 P ( 0C,0N@ @( QQ , 0C@( ,0u( Qh 0C@( ,0j( 0C`@( ,0bV@_ ( `F  ( 0C`@( ,0R( 0C@d( ,0JV@F @C ( Q @0C( ,0; @8 ( Q @ @` 0V @,80L"(3P6 <(240S!x ؄ Ȅ Є 8 R0 X (b0R040880P(:[8 8 (b0R  $0 2N $0 P Hx8 Pß0000S(Q:@SX (  P0C S,0( X@S( Pl0C,00 S( LꅜÜ,%,/5K]o֝ /O-lM($ %P"PU`` 8@ p0'" n" 0<02@02 @0` 00~K@P h SQ@` M`@0S( P @75 $0lЍH?@d 00 S @. @ C< 0ЍCG0 &֞@v&Ҟ p@-M4P* 0: S0 0 S P@` 000uЍp 㖫p P @TPH0 0000Te,%, O-0]M-SP M0S @p܄̬P8 00S0W0S' !0S"디` ⋁pPxh4P ]ލ ЍOv/O]ލ Ѝ   @paW ]ލ ЍO較0: S  SQ "PPDu .┬P 't60v: S+Wv$ 0P@`P咀  P p  0 0!0 009 0S0S`-ЪP`,`ުvH 0S 0` ƪP V ᾪP z{ R^R\ᔪpPS  Px!1Z[ d 0ᒪ֫?ӫ[up`4 0S!P0!0v0ᄡ P: v?b  0S -vTpPvuP-KY 0STp<b,%, &j@+:g$LxZ ǟ2j Ku&0 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ I!P X!IP00S D00S  40 /I #P@[@%,a,2,&@-JJ@-Pp@-P3@Wp 000/%,p@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@ 孠 )P@ЍpPU P 剂0P0 &%,vs @-@P @300S@/%,p@-@PPp00Spp@|%,A- `pP@P000 PP0 0A r@-@P P0P00S@%,@-`dMqPU> 0S; ]P2 @@?T/   `00@ C @ H00 *S 0 000?0`?ZP10HG>P dЍ膡 0@-3 Q3k?e =,0  %,0  z%,@-@(=St00S h00S\00S L00S  `400S  Y0(=%, 0 -R  UR +R  >Q @c?|0:S [?t0cS .S bS S@ @0,S@pS wS ,IP ( AP 3-xPt@Pp@Pl@P0 0  SxRPRP RPRP hP ^r3,3,3,3,n2,b0 &(4,,4,£ɣңD}&ףݣ 0/2,@-  01SP R t0 T!WP R HHks@08 ,@"P0 2,04,i  0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aR R S R0/0 R /!0 R0S //@- @P@ X 0#-?00&3?=0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0P@\@P, PP@@p4,A-P` @P lpP ` L@P  A< $@ tT èp@-Pl@P T# PpD Ppp@U p@PpȨh*R O-MM`p 0@P ⼜P0: SX᠓sX  ;UP  u@P> ~ލЍ R R R00  P P@  P @P  PP 0"SU T 0S0C0 6/ TP 0mS PQը@&,&P P / & p<,s@-P@`Z "0 00 BЍpA-@Pp4` R 0S p@@-P`( @p0` G Ѝp4,@-`@ (8R808Ѝ 8 0 CS  8 0C 8p4,x<,p@-`Q@PRpP0S  归$0Sp 峒p@0S S D0V@ ` 0V, 囒U  p@蔒,&8 $0 (((( 80( /p4,,& 0( (( 0( /p4,,&C-@㼀`p0S Ѝ @oP0S 0S 0 ( ((08x9P 0 PP 03,p4,7@-D@P@w@00S Ѝ0 7Pp4,@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08c9 80 8 00S08U9p4,&,0@-AM0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS ڧ 0`p4,&,@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00p4,&,s@-@8 R 0R0` (0 RP08 80 8880S Ѝp0CR80S 00Sʪ808p4,&,p@-p@XU N8PE`V` D0(  p8Sopppp4,,&(080S @-/p4,p@-D@0S PX* 8P 0( ppp4,,&p@-|P`@>l0 R(0p0CR0R: $0( ip00p4,,&7@-@@P@P  AP Ѝ00P$ /p4,0S/0G-0PS`p@U @0 pP0@@@ X  P00pp @ P00a,P R/-@-4@$P(0,0P  $8 p4,,&7O-0PSG` 8(hS?Pp $8SDG(R008(h8! 0S0S ] Ѝ0S08R00(hjP080h88S 08 ЍO`0F?oP20S `&0 S PpP0@S $ H d 4 0 0 0 | eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)0$h48VK"3P( 圓R( B( ( W(PV  UPPl>@lH80S 48PS8P o088~|80X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0P0J``` P Q`*ZXP@$ 0P3,p4,<,,&p<, 0 A-@P `p M!00 0 B R   0.S u3 !` P*HP T 7 Ѝ0 P000C/0 !GP00p4,0(8R/p4,0$P00 /p4,00S/ L%,( O-鴑MpW]$ 00! 0U R`PQ PPtkH@0PQSQ0Z00@P9 p BP 0: Sp  P)d0 R'0 X& ۍ@X  K 0G0  x*ƕnnЍ P00pL%,,&a,$ը8, 800S ,00S 00Co//%,%,%,p@-|PPF@T p@``mT0S S VS 7Sg@ @<,p@-@0S00S 00SL7P p@0qp  ~00S Rpll0P@ XP0PL0@p88 SP@W &,2,p,A-pP+ @`0000  "P0;0 A! , vA0PP     P  5X A$<,1p@-|@Pp$R0%S!S0C Sp S}H l H 0C Sn t 7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP l0S0pqp 0p@] 000Sp p@B0!S $P l$t00Sp$dP`p@&L00Sp7D00`Vp(V'p@4p<,%,L%,CrIOp@-`@P 0p@L<,A-`P0@@@p0P/00,0S W HT T A,0* ~<, h*U|=,t@ p@-AM0 70000\0  b0  ]0  X0 S0  N0  IP`0S1 0 ➊;PU0 D<<0 40 Ѝp<,Ydp| & |=,@-@0\&0PiP/<,< S /@-0 054 Ѝq0&@-@u0@ <,p@-x0@M@T 0S P0`P V@Ѝp`F0PS h2,@-@G0$ 00@S 0<,@-@@P@-@0G-e`lOl0h?h0@M0?000S0 !0 S A?0S x0S 0S45B0P P T?iP뜞0S P ?YP\0SV80S! s0+2R80SeVHZ0PS0S' /S S S[ SY U Uz 8=P 2Y 0S E:1$ "17S< iS0S P0 P MP KP 00y`P FiV 0FcS\  0   ( (  p   \  p l  l < < ` X X   D h  8 , d p    `   4      l    <                               P 0`E.U V``dP ePOP= 0S`yc 0SP0@_U0 ,0Sl U U000#=U00S `J V 1P+U@  U !UQ0-UQ00  @0#0QP P 0 a0CS00 0`1/P   00P 0Sa0@S @/P000S tVUP8  G2,00 @0S 0|) -P 0S.P +,a0ES000+,P .,0 /6UPUU0ES񟗚 \ p *U( @U6 !U[ Pq 0S US'70S# P W`0SL970S%,` X70S0 97R0<Q  70S07S ;07S 00#&ۇw/10@S0 @0N07S9 :<#0CSP`  k=P 0 40S e`0 S &0!R0+?0}50S  0 S %0!R0*?0c !R0 0!ıWL50S!R0 !R0 0!ıD A 4; 4!R0 0!ı/40S!R0W!R0 0!ı !R0*?0440S 40S 6`0 S 030S$ y0 S 0  V r8L!cR00 !00<0S0 !0<00 eSd0C0<0S 0d !0<0<_P0P0<0S 0!ı2 .5(/:p20S0S @ p2 D 1 H 1 P s1000!R0 0!ı|100p10 00!R0 0!ıM 0< `0000!R0 0!ı8q ` `<08 b,a,a,zpHb,|a,a, X&h*2M\%,xrb,ĪԪ%,tL%,d&@ =,a,&,>,Pq 8b,400S  qd00S`6aPb )P /  0m 12+!?P@H!R0 0!ıP ,P P !R0110+?P&!R0 0!ıP !R0110!R0 0!ıs?`P, aP?qp T2 !R0 0!ıu?`P!R0 0!ıP ^2`PBP 0`0,`?P*)P 00,00  TH30S?LVp`# *0u  PPl U Ui ?V "0> PrPY U UV "0 PbPI U UF :"BP40S %dPNP5 U U.P!0P.$% (P0 !R04 0S40գ?0/0 $0 S00C0 $5 !R085 0SH50գ?0/0 `%00 x5 50iS 0 |050S080200S/3,p@-@P/!pO-S`PpM``@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0i80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 60P R* 0;P0   80 eP f [0J0C3,0   /G-pȀWY+p S@05PPP @ (ZPPE0S`0S P B0 0R R@0`p@-`R P@ c0P @@@ 0ppG-@P `pM@?00C  RT0Ѝ ` ?i>P ?0 ?>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#8  0 a,%,=,A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ# 0 DPzdP fPP Q gR 0S 0R   R E0 ia,%,=,@- @ @=, @-P@,=, @-P@v,=,:G-(2pW pЍzPP) P0`ᅋpb@P 0pqpc Um? SZ c0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Ul 5 P @U(X0jP +L%, =,_p@-p@`PP<J,<0SV@` `<D IP +p=,_ 0 =, 0 =,7@-dP@ PP 0S  P Ѝ0=,Po/@- + ЍzpA-`QpP P P@P%U0P 0 P l @bT @P 6/Pbꜫè@-~|0p p0h hhP 0X X@0L L8P0@4 4 |&t&p ƫ֫  C-L1M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@%,%,%,G-@`M0PSS003 @ R S0\R% :R R DZ !Pp ֝P0H3/0S@@ R0Ѝ!P/@-ďp N( s* bЍ00S @  db*\0PT T J( 8<qp $zpa,+QsG-@P`)pppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(Vp0  S ;P 0F@@`&a&p@-@QP o0S R SppQ0 QA QR P/@ PRP/p@-`9 PPp@p>p@, 0@-M + srp@  ) PP  000Ѝ0%,X=,400S/@-$@P P@a,%,@-@P  %,P/ @-p@''0@-M@'uP00S@)PaP DP OP AP )dP oPis|0t00SЍ0 J0LP 00qpS00@&)%,ڬ &O-(M0S 0S H0@S R u P 4X ЍL G@j Pp 00n pPPP`TP DP  PPpP0S P``30STPQzPN ((@(!P3`00hP0`0 p`P0`0 4P T ( 8`0 bᦇPf& 20SP `JP   @( YP 均Y |2 pd T2 +D2p@20WF0b,2P 0S P (ⱈP# " 1P C/}&0S )/ 1X P DP Pd1 _L10S Q_ 010 (0 qp 000Sp 0 ;P s 0 R  [ R 0! 0P: l X %,%,3h*b,wX=,zpKh%,%,lc,a,T%,|%,%,>,X&a,p,L&P@- 0@%,00@-bP '@X=,h*A-P`XpVVPU@JTWlP0p, 0 %,@-yP@ @0 %, 0 %, 0 %,p@-P@@P Pp@7pp@-@`P*PpVU p@] Pp PpA-@Q`Pp g^^U:G-@@` PР @PUЍp pP^7BP ^8p0SkЍG%,@-W0@0S @y%,0 R/%R %R0 sR0/@-(@0SP00l=,G-`dd@p00CS0 7p PP 000 P U 0D IS  1[^p@P@- 0P9A-@0 0pR`@0S00 R0S@00`P0S U  ᄙP@00`&a&O-M@`DPp!Q Zo`@pW*p%pP` P` X kP UpV`PL`00@0H0L 0`*|Ѝ8KP Z@00`&a&$@-@+pFPPP Ѝ@*Y@V@@`H0H 0P0{]] @W] Ѝc#Qƞ A-PPЍ0S `p-@*@@\PP D00< 0`{W ᤄP)]계ꝉ P'@-@@ èA-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0Y@%,%,C-EMPPEߍ@ 0@qp `,+Pڬ嬐P ` P:T0S EP @  S0pSI`P  P@3,b,A-kX1@0SGk @1RpP? ,%@ 1P[`X`U``P0p000 0`00zW\밀P@<pW \pF\W P0S:\Ѝ \1\@L%,h*4+a&`&=T00A-0S@`@P0L z@p&`P \@\\L%,\@-@@P ,P  oh*3@-M@P Pۍ@ ۍ1O-0S# 10SPpuP 0 `|R@0 -R` hP JP D$@ ЍP PP L 0/z [ ` [V @T P uX%XP 0T@@P@T 000d0(@t`<P#@0Sc[a,L%,oh*`30A-`V8@PVpP0 PЍA#mPj`)@&#@@@0 `y+[)[@$[T ЍÄЍL%,-M P  @oЍ0@-@P0MSP @XnX ȃP+!@Ѝ0@T@0: S *@Wb,`&p&@-M@ƃP͡0 00Ѝ0@-Mp0P@u ᑃPh0 R\P0 R\ tu p0St00Ѝ0%,`=,X=,/@-@P P0@/R@-@ &(0@0T>$@a,@- 40 R\00S@@p=,\b,h00S /pp@-qp $qpP@ QPpp2,@-P$P3#0 R/  p=,O-q$M0S|10S%@AP`\\100CS0S#P`vu @@(P`0S00S($Ѝ|P`@n 0 R  0吠00刐 00 000 0 000000  0P0000`0E a,a,&,%,,.,>,O-M,2,a, &̮a,H00S <0P/000S $0@///p=,,b,Pb,%,'G-(pP@,`wP"V $10S1`V``ut 00S000T T0 00+`z+00Y J*0Xs@P W ЍG_"VS V 1%,a,pa,4>,a,O-M`JP P @/P! ЍO"qp@PV00SЍO0A`"P0 00@bЍf"pP@PT!p 0^!qp0 @P2,%,p,A-p`!qpP@VЍA!  0@6Ѝp@-@4P0SPp`qp @%,0P  P/&0P  P/&@-P@p@-@PptP 0S 0 0HS @ 00C0WWp@W  B 0%,&=,0/=,A-`Pp @T'W89@;0 "0UP00040000 (@0@000S 000 }PKPGU:YWUW@   0&=,P/P // / /00//000////0/0/p@-@4PPP W4Pp4/O-@M ؃d 0PsPPP000 0 0 i)@P*Ѝ000 0 0])@PT <P000 00 K)UP@=U@T> ЍO *O-P@4M(0X0 ,0ut@ P4Ѝ40SX400 ?Q)(@PPpLd00$0Jp P:P  ` V0/ C@p` P P@00Pἳ弃0v V `V@P,0S4 x3X4 @ P6L)X30pW0 0 `P20S Y Y` P P `V@Y*)P `@T_@ P0S x20S  P0 (0 S =  :&PI 20S 0  @ 1 0R00S8 P Pd p 4ЍO V000 P0m 0PA R TA 0 Pp``@P,1` !X$0r$0@P_ V Vj@Px P P Pr P^@Put$0U$0@P_{, 0S V V0$0$0S B@P O`0 pa,4>,2,p,b,>,a,a,4b,,O-`,a,4b,p,>,b,V =R+` =R-`8 n Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =gPV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` ;P `` e0S} 0Ps {L&=,q0&h*u&Q߯r.Z{$0 RP  /=,0 14/=,0 Q/P/"&@-04 ,    00P.,H.,X.,D.,G-P㌐剀yN@uNPT`ppP OT O  !  O O @`匀=,A-8p@0PS` 0P0aP =,@-@$ 0 @z=,P 0 R   /a,p00S/p@-`@mPPPpP 0S8@pPp  b,=,#u@-@P00Pl0 0  ;D0)(<'(8%(4#(0!(00}=,D>,P>,\>,h>,t>,P/0/=,0p@-@00P0 0R 0.PPPPPPPPPQQPQ'H'D'@'<'Pp P0 Q00=,D>,P>,\>,h>,t>,C-阁P0@SpM`Ip`ll!0 0!0S~0@ 0  @Pa00CS7 `PU7 0 Ѝ P -0!0S @P 0R 0rq0 U h Q H S  {PwP b,a,a,a,=,a, & &,0P$0 00S000/a,a, b,a,p@-L@P`0S0000p01S 0p'P=,Pp@-`0 p@ X10S P@@p(1@0PSP5P/u`P0@@S  1CP0 1C%@4P 0S-000|  0p  0d  0@@PO 1C[P 3,=,T.,L.,\.,@.,O-|C0M0dwvP1Sy0\P1 0S Z 0 S1C10q&QF 000 00PP20SI 1SF P2!0sr R0l2ap01UPL20SDXO 1R.sr0nS`J j`0F[J 1RKЍ1S ? 0C# R Y1S1S  ` 0kP  00KU1 0[0 `0S1& U F& 0R 0èQ0pP 0C001萄 S rI  0=,a,>,b,&,D>,a,A-pP`p00S HP `P 80@0@D@ 0@0TЍb,=,&,p@-P@8 02PpA-`p@@PGE$1S 0P $@@>,7@-,\>,D>,H>,=,|a,Hb,3,xa,"&Pq >,wJA-(BP`Pp P U = ClP  U@10S ! RS0QS 0`E0 0S$ l10S 0SB0$1 01 08P@0$1Q 0S&0S# 0`00S R 0S$1R0$QʜPP E E 00WT$@0O0$10P0 00S $=,ta,Hb,@,3,>,@-(@0S =500=,G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000^0 0C0S /10S0 0S " G >Y 0 0R  x00S U d00SX00S D00SX   =,&,a,a,a,,.,0.,b,<-0 R!  ^ !0=,04/=,0 R 00S P@0~0/0P 0/\!4 0 / B  0/=,a, 0 /=,qp/G-p`@PpP 儐u U 0 0W 00V@00CS7P P 0P@P=,p,PG-P0P`PpЀ@ 0@D~ P tV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB=,p,G-p`P@0@@0W  S #R0C00C0Ѝ 3,P  j tH 0 CpGA-0PP@q1k`EP q 0P 10=,G-1@`p`P0LL0 rS00TD`0PT@&,%,=,p@-@PPp P0S00Ep P"&@-0P "&80P/ R/0 0S 0 /@,00 0S/$0$ R O@, b,=,A-X@ 0S0dS 0p(0,`P` p U` m0@,гX0QH0H 0.4 00/ 0 00A,@,0Q,A-@PU  ^"04P4p 04 R0PU R4`40 0 P ^PQ p0࠱`  0@,O-1P0sUPP@PP0⸡p`@` V R0 SRA  0 V 0  W0PR 0*?PA `Y0 0 y W`@TP0 00  0` qp +@PPAp ` W0 0O0  0`qp @TP b,@,p,P0G-cpPU !R00 RS@ U W0S P*P @P P`@V0 0 0 0 00r  0@P`Pl`@W 00 0 00r  0@P`V@@,p,G-`;P@pl0Vs 0SP@`(P@tu TUP%,G-\@P0p`Pxx80@ p 00  0`P 080qpv@,p,800S/,00/PP//a,a,00CS0 S0 SSf0 /O-0P-SP m   8 hmpumPm@P0S,@ 0R S%@T ODEUmmQm=X   g  0 ЍO`P @@ M@ 0A $ -dE@ Oc#=,ƞ G-@P $`P( 6rpP `y w u S [ @yz  0Z Pp@ ;p Tt p@r 3o 40 } p@ O=,C-`Gqp pqp@@PP.Y T0 0 Ѝqpp 0  0a0@S@-TA0@S<0'@ Ѝ'P( #P  R 0Z,`,`,.Pp@-9 $P" 'P= P !srp: p^P 0 &- &P D06 p1Ptd0`c@P\0 L0Af&P,@m006p/%,0Z,=%,`,G-@`pdP4T#0 5T Ta0'0000aP0 D@6T P'00Z,@-o0@-MPh@P   srЍ08!P XD0 00&%,0Z,@-HP!sr@ 0! 0&0Z,@- | sr @@@60P&6 (D0606Ѝ0Z,%,G-6@PP`j>T6k.sq 00P6 D06PU p)`CP0PPЁ  G.P 0Z,%,b,@-P ,0 0R = %,<l0@-0`  ^ @^TSa04S '005S #%,0Z,0@- @P0QA 6R 000Z,G-[pP@P P`PC`Cp6W @0Z,00S/G- M`p)c@吠吐qpp6W @ Ѝ 0 z PU!P {P P 0 ca,80Z,h*U@-000mS Ѝ 0 Q0 >@P 0 S#  PPP0`0 S } Q0 R pV`PPp Cp00%,17@-PU0P( P@ P0 Ѝ000SB@PP B^PB Ѝ0@H00S< Ѝ0@: 0 0$04 L%,d|%, & 0 %,<07@- R P(0(@?@ 0 Ѝ000&%,@Bb,@-P M# @0.S Z00S Ѝ ,0S 00 00S000 l  a\P0@  0R 000@0,0ϴ00&Ѵb,$<07@- R P(0(@?@0 Ѝ0,0&&,@Ba,@-P M# @0.S 00S Ѝ 0S 00 00S000u l `P0@  0R 000@0,0,0&Jba,x@-@PP  @H Ѝ踵@-@PZP  @9 Ѝյ0Sp@- Sp00S p@t' tl0p`{P p@qpP@ 0p@ uL%,a,b,P07@- S SKl0 Ѝ0XP@T0PP A@z Ѝ0@A0 00 h0&l0&P/L0@-0@S !00 $0$ @la,%,ha, P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P9A Ѝ04@P,0  0 10 X0&T0&o,\0&Lb,zp0/0b,P/RP @P/;@-@| p l @0TxSPLHD@<8@kq0&&v,Clʶ<p@-V0dSK@S!1 CRJT" R&0CO  Rꨛ P P P P P P ( P @P3 @.A C#R0 P Ț P P x P P P P ` P P H  P P P 0 P P P P P P P P P P P P k C \ ,0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~a,ԷO-@<M`00PP*0 S 000C S 0  ? 0p00C/  0?ApU:X U :TЍ D0!R1@0P S 0,ST(0 @0D@D1!0C 0>,#&#&C-PMP M 0-@ݍ ЍC` @<0Sڐp吀吐 Q@0PU`<P0P A@ @@ݍ Ѝ =#&2>,v=#&HzpP@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000a&`&X|@-PM 0  0 x0  @lod P 0S>000D ;0Ѝ,0P 1h*a,a,P @P/ 0 /ី`%,P/00Sa,0/@-@0Sa,0/@-,@0S0 0p00Ѝa,0/@-,@0S0 0^00Ѝa,ܸ0/400S/(00S/@-4qp@a,%,P@- 00@ ^S00S00 Ѝ0X .(0& p@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ '] @a,a,3%=WP@-P A7 ЍRS+DSSS 0e C R꼣 ģ X X X X ̣ X X ԣ X X X ܣ E C CS -S 1 CR 0CrS dSWS ^S0Sh0wS     0  E000 0 FK N R WR Q S-00 0  ta,800S ,00S 0P//b,a,a,$0P/0 0 0C/ b,%,a,@-PU  @A Ѝp`@PppQ 00S0\Q0S 0S@V zP 00$Q00ꢹa,@-0 S 0*( (<\ Ѝ * 4\꽹a,¹@-#@ #>Ba,P/0S/P 0  //& oP@-/ᆴ 0LP/a, 0@-L   Ѝa,@-`MP@ᬺ0-S0p00Cp S T 00ЍU TP PTU $PT00W`͹O-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@093@!+P0P0U0 P @0+S3P <␺<9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P!  aK[  0 p0 @ =RP   R R tq000SPP000p00CS $ X 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S a,la,%,e,@-@PM @PU@`p0@ mTPU   c,A R  | 000CSc < L < < < (  RzV)00SS# P}U  U Ud0?o20RP 2/ 0RP0 VX 0 |Ѝ 0?o2RP0U U U7W0 0S00S00W 0 0S00S000ES\ RU U U , 0 S0R 0  b R U2/U}00SS 00S000 S000:S U000 0 ~ꔺں*=,s@-P`@፸000C S0 ` 0 B ^ ST00T00VЍp $`|S 00͹ 000S/P/@b,la,@-XP H0H@ 0S0S  0  03/$@Ela,#& 80S/S/ 0CS/$#&O-@pM4Q0S [= 0S0 0 Ѝ`V/$P  0P ! AAQ-P $ SQ@ S0 0@@Oop B0 R ` 0 0S Wp0p#&@-%P}P0v40&/-4M@20S4囏P 2     a2 0S 104Ѝ0! R0< "$01 S 10S 10S1 `11S(  a2 T!2 R (10P!000 0 o R  Rta0 000S P 10S 1s\ 1P 0S~ 0#Sz ,0 0S P  0!`b,db,p,p,(A,a,40&2,(0&a,@-db,@- 9 Ѝ@-P=;`@@@ap0 `CX ЍT@-@0;P  0:pc,G- @$p`P 0S(S%0 H P@@@0^3#@- d 0 Ѝ,7@-P@2"@? Ѝ0@B@-<0?B3c/ ( 0 0 `ЍMb@B40@-0@@T `P  0 80&c,=,@-@0@80&0$R/ $垼c,p@-,%,h* b,%,a,%,X%,5K 01T0&H0@-@@00SOoBv(0(01 0 Lb,la,g,T0&%,0T0& 0@-P P0P0^  @$R \0 P$@R@0^ @R \ 0 @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P c200@p@-@PT `0S`00  p`0@0000 S`@@@A-PQ@` 1 P 1 PP7`ЍPp0W"0 S 0 @o0 0PP 200㯯/ ⯼j2P 01P$b,o,A-`pV@0  ` \ Q(P  RPQ(SQ $0RQ? " $ \ (P Q S ^ U 0S P$RQ $2P 0S` 0 00`Q0S P \U 0S `0P 0S0Q  R \  P  RQP 0  0 U A U0QPA00  @-aoP/o,C-pPM@@8`0C`F!稀/<  AYЍ I/o0"P R  ? 0 Q   Y0 ? @o,O-pP@$M0P`D0L00SG RD L R Q R*H)  H0 0@000000 YH  )-   0S0S @ 0`00 000L0 000CP$Ѝ@o, 0   /o,0A-0@S :PT(`V0(0l00S@`p +(`.qp ڲM@00CS,넲x=,o,2,%,$1O-`wvB 1!0РS ЍO00S P@̐00CS& ЍOZ 0qp   0Z qV Q ሲP㪲@ Ѝ &2, &x=,%,p@-P@T 40@@@ @p `//@o,o,p@-PH@U p@\Qp@E(0?o2(0o,o,p@-P@m p0 0P !U@po,O-M,070( @40pep780<0d7D @=L70S 870/S 0Ï0@{t , (0P0s007S(00(00 0,00 `$000060(0, rs   T000S 0S$Ѝ(0S,0 000000C000 L0H " 800 000zy+  0Sqp녳qp0S`M00 00S0 @ y50S PIUPe U 0Z 1P40S 4L Hb04P4U 'V4PR0 QR S P PS P400S0R0S44L0SP`P HL0#PPUP: 0 00`hP0p`PL0 P* G 000 0`0 L0$ `L0 `    h  D0PD0$ T 0P@TX\P. . P ` @ 80<T0s00040T0PU$00CS$0P20S g000 0`0 L0e408 CGPPI h0S8 Z5 ` p J!` 0C Q00_0p d0S0' 0P a 00o0 R0S0YPPYP(1Up1. .0S0$0`P0S 0S < @B X0C  BSp aofZ0Yp0pP0&,%,b,a,a,p, b,a,o,|a,ta,Hb,b,o,pa,>,=,p@-P@_  04P !U0p P$@o,p@-P@G  0LP 0 Up PS @P@o,p@-`@V001P0S0 sr ^U00 s00 ' 0P p 0P tu !R0(P Vp00@00S 0Sp(0(0Sp pa, & &o,pa,o,p@-P`dU 0S0P@T 0P@|0 pP*-@Ӫ0 00000@Pp@-0P00o,=,@-驴0PPo,O-ԳPc004M040@0P 0 X0S0  P4Ѝ0  $0 0$0$0X S38 <|r utE T %` p 200@_ 0 rs 0Z0 @ P0s00P 0S/d2 c0  4 P 0P0@ P(200@_X 02X0QX`pP 0@` p P 048<00 0(00X0 0 00 0P|#sr(, R0S0tP 0 +qp@P *F`ut q`pu80<V 0 s00 } V0zHPu 0 7qpm @P`p0X0o,4>,0@-MIP @tu 0 kЍ0@- 0( 00S@o,pa,p0p@-@忺SP PP0 P 800S(0Sppp\&o,pa,@-$@$0S000R @o,o,$b,O-0 ,M"0Qp 0S?wPy tC 00#  `PL ,Ѝ4S0S (30S 0S(0S 0(0u0(0P+ X`@PJqp@PN뺯@PfR00 (PlBlb0 0 0(0a0S 0S D(20SX 2``FS iX1H1X`( 0 @Pᜁut0`V$@PxAut` }810S ,10S  g@PutXZ@P 00000 0 0)P@ 0S 00SJ YHSE qp QP 0S 00S1 o, pa,a,Tb,%,b,,@-(P$ 00000S@ p,`b,@-(?$ 00000S@ p,`b,@- 8+, 000K00S@D p,`b,@-@P x0x0Sd P@D L%, < 1A-@TPP 뽭3;ASQ-i 0@  `Pp{0S0S 0X 0?00a ,0 ,00SA薧p, =,&,%,%,a,G-pl0P`  @ eP 0S 0S Sp,A-` pP啧@ι&0Up0P Ό&p@-HP@T 80   p 0 )))`0&p,O-,RAMMnI`)V 0A 0効p0  P H0S0000AލЍ0!S  )ePA>04S S S ˦0S  0 [Q0幦0S 0  C  Q? 0   ^R000 Q\ S$R 0C 0N0P0000\\   0C R 0 C`0&Qp,O-pQpPpMW My@xcPJTpd3dC  \\Ls p PZ PUA (3T Vۍ ЍpPS@DT2PӸ@ и͸ @@ 0 h)X (| U@ (T@"0S000⫸P ;04P ST@ *2 Pp 0Q 1T VVP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S V PR? T0p0000,p,`0&u&p,D}&>PU!MQ0@-@DP=P |8P l3P \.P OPO`0&X^ekh*@-@P @P P P(@Rq~O-|1M0S" @`0 ЍObPp400 0 Ppxy@`00S 000S  0P Ѝ D0 000 { ' ' 0S @`p,p, b,b,0@- LLPR^0S @T 0 Bp,`0&0@- LLPR^0S @T 0L Bp,`0&0/p,0/p,00S /p,@-YNP NPNP"@-0p,//@-L@ p0 P㌤S0PЍp,\ QR0* /QS QQ*/0000/@-@P &000000/0S0C 0//@- 0#3P Ѝ@- 0@SPR? P KO`Q  &` PЍpA-`pP@T@  A-P`"F$@p 3QP ,0 0(000dPЍFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-@`p?PP@@%?0P0U0S P@s@-0P00`a0C@S                         PЍp  000@@0 0 0 0 0 0\/\\A-1!0 j \[Pa@1!0 j[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CQV 0p@]^S @p^404 0 4'jp\00P,H,op@-0Pt @R RP D D <@D@ p@: @D}&P,H,@C-1`pMQp@P0᠁ `0Y 0 .0PR l1@d1`0 Li\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . C R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝ(,H,P,],00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0 Ni0IS@P R00ۍ Ѝ00@00 S00@P,H,sO-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `hb`0V LP0 0-$Pp,,P,H,O-`M@@_.0 0\0.> 0h S \|.t>0 xh Q@  \  0   |    0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ YP  P 0S| @,Sv p0S 00@P 0S  00@[VXS= `, `, `, `, `, `, L0 `, `, 0 0 `, `, `, `, `, 4 `, ,5 `, `, `, `, `, `, `, `, `, `, `, `, `, `, `, `, T/ (: / 0 `, `, 0 0 1 `, `, 1 `, L4 `, 4 5 6 T6 : `, `, 0: : ; `, (: SS4 0 PS0@o0P0  Q Q* S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0 j0 P^S0@oPL0 R: L `0p+00)0800400S<[;8 00 [04 0*<0S H0SSP80S4PU 0`  EP0800A E4 0T P 0  004 0 0  0: 00z040 0H:HR <00s, z0P 0S 0S 0( CP2S 0 Hs` 0S0`V: $ 00@ t9@墸0S  0HL_ H0$P x0 0H$0?$0 S8`0V:$j g`000 00C 00P0 o`8 0R:P`8 0U `S p 7 P0   R:e ` 7B7` 9'1 01S:P` 007 |90 S0`(78 00 tg04 0<0S _P60800 OP80Sf04 0<0S  80S0p4  H⋫`P <000F400<0`04 ˩<0S V 0400<058 00 V04 0峩<0S `L0 R: L ! `0pP00pY R  Q $5 0:^4000  ~P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ 04 0 t  PQ8 p0V `XDcH0p0<Hp<(0000S s04 0<0S p PB"000Q0 0  0p V0`0  `0P  ~ P\   p V0S` 0  PX80S0s "5@p0 u]04 0@40P0 |?P 0S 00Pn80S0sp!p @p 4 0?40P ?Po P R00`pL<0p<R80SO4XL  0`Rl0&004 0V@*000H,,Ċ,r,8,O,@v&1&ht@p ,T`U!$Q(P,., zprz&,,|,0pW(p0 1(W0 P0H !  R 0{P 0 pW* 0$ (1 0X`pH0`0h<Hh`<x0h041 87<0 0R0((vQ 0{Q  r,r,p@-@P`Tp0wS {S sS 0p I?P 0 Du\0`@p :?P `zpG-`}SPEPU00S\p01@ R  pPVCG~Xpp0!S < CQR2? D? 0? ? D? 0  \0 0 00 00 00:S 0S0S W00 000 0V 0S`: P 000BS 7j@,Y`p@-P0@T P 6P1 0S-@ @ h@ @ @ A @ 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@,- 0@-MMPV>@P  P[ )>p4[+ >> PT>ۍЍ0zp}H0  BR R R6 /u&v&@00CS0 S0 / 6u&@-,Aʪ0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@/g,1@-01\ @T P#OoB\@T P P P QQ R P\ \ P P Q R  Ȉ-,0@-  `Ğ\ @ T\    %R    ,Ȉ-A-pA0 5S$\! R  (P 8!0  ,P !0  4PP6 AA㜋<0S 00 <ءP`p夀0U00S 000\P ᢫P D 御000 帡PSȈ-t,A v&x,Np@-@0` c2T  5td lP`PT p P000STt @u&v&,s@-@P Pb<@P @0?SP@P` p Ѝp/@P@KOP 0S S k@ 0S00Y륂 @-ڲ 41v&@-0@<TQ T00 40001S R0Slp@TX` T@0$ @H4q4T(8  @,h4,p4;v&Ȉ-BNWjt@-鐲 W4N1#v&7@-@Pᥲ  0S 0@T 00 Ѝ0葲0"S p`@-@ P  p ,YЍj<0p@-XPP%0ATp0 "R   DS " @DRAp1& 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,|0P01p$,X,01//00/00/00/00/00/ 0  /,$ 0  /,6g 00/ 00/00/00/p00/00/@-@⵬,00/@-@⧬, 0  /, 0  /, 0  /,/00/00/00/00/00/00/00/00/%00//00/A00/N00/Y00/X00/c00/00/( 00/ӿ00/{ 00/6g 00/mrN.gb@-0  0Ѝ@-@ +@-  p,q 5@-0S04c  +@-  p,j @-0,, @-  ,O( 5@-0S04c,  @-v @-0,, @-  ,3 @-  , ( 5@-0S04cz, < @-  q, < C@-h,< @-  `, < @-  W,  @-  N,  q@-E, e@-=`, e@-5., e@--, @-  %,  @-  ,  @-  , @- 0},, @-  ,  C@-, @-  ,  @-  ~, $0Qa @-, @-@DP d 0  I r 0@-0 |1K$, p@-E@ P < 0@ S< 00ppp而,T-1&O-,M@0P0 T; R0AT 011!0 S01  R01;aP ,0S  R3/00S 3/[1P  SP d0P 0 0S^`: p` 0 011S`@S0` $0eP$0pጙ$0P``Pp1U00$0PeUP0!S$0蹟000CAP PCڰDPA_A$ Q!@ Qʄ` 1  pP$PP )0 `p0C0CS0V`0Z `1Z0Z_` 0 000 0(%0 "P P V`x 0CÀ  S CUPPEPE_P0 |xP -` 0 0@0 P!DeP Lok1 0 [x ~ Q 7x+됷PgZPPt7000HDF! "1 "0S SP 1S b !ġ1S 0C" !8C8R11$PUPLf,rp+r0 wP (v}xc(`P 0PSY *E 5k0 k 6օ넥Y Pʀ500xPG qPD >P' dP% <P J SuP 5P 0CP  @@PV 400C`F V$P P P0S t400C`?_N}l1SS !0C B/!?1E^xP00 S11W?zP`PxP@a@1S4020/C(PZ( @@Py } |} 0@S} y P~ y { y P P10!1 NSPNQ0^ B 88C8 P P?@ "0C S񟗉Hy y { } | z XvPq P1aD P w{1S'ʰ1 D P  w{P w00P1 RE40S 3/Pg PP g P,ЍPR0h k^ 0Sp0W 0[ 3/pU P `D P v g `z{g00x00A<0 b02P !00P000#bZ{cgꀌ,T*v&X-RSD}&T-@}& 001/ဌ,P0 R0//ဌ,O-p`*@PP [ ! 0P @ Ѝ0呣00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @ꀌ,/P/D0 R/0@-A1 P f@< Gꀌ,O-Bp0 %W i0p 000߃ Ѝ`440S 0S oP 5Y000 @  S" S0 050S oP Y Y 0 0 0! R @ S0 0 oP X0S X00000 00` S P0PS PH0SPPo0 00o0S ot ?C S XPU  8l0X!0C0S;3PP0 PEXꔌ,D}& @VUUUO-$MHZS  R0P 0L`xDp@ :0Y0 0S 0g ၐh᝕P6o5o:o@`0p@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0ioX 2 h0  B8؂V P0{ P>  PN P P!VUA`E DQ@DP`4ah ^h [h@`"PD P AP;  JR !   ` D0)0@0!P`1 V0p00@  ` `)\8z`F`FV0p00@  DPE@DU`E¨` Y @ ῏ޔ@T`— R    BW00000S 000 0 0睏$ЍO0Y S ꔌ,ch t+D}&v&A-pP`Pp `Hn@Cn@0T W`P@ P P0000蔌,@-P@p 0n-0T0* ,p@Ѝp0 00X 0l` 0@ ?,@t 0凝P p H&,Pp@-@TP0Ps D` R :ZP 0S@@Q@pH&,@-@A0000蔌,0kꔌ,0kꔌ,-@-@00*  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-   ЍЍ/@-@@zp@-@zp@-pP@`M,0 0( 0 00`Ѝ@- ЍrO- M P`@p_m@ZmUkT0 0bP 0C"D0PSZ 0SW L00SSD囓PPL00PTP^y@DO@W <p YPRWpV`KЦo`0 S`K0 Dr@PD@0 <PT0 0P|00L0D 0H0T @Z  r cwccЍ00D R00S 0S :L0X#3pgx~rP 0 r똰`GGee @ᒀ0 EGqbP`GGF`|eeꔌ,"X-@-,, ($ *Ѝr@-P@`$0 0  0 00`Ѝp@- Ѝr@-pP@`M,0 0z( 0 00`Ѝ@- Ѝr-@-00c  4Ѝ Ѝ/rp@-P;l@~P(P'20S gAP'.Ap 0$!Py>~ X  $P 0)AT HPP AP p`PP 0q+Q Sp 06&V`T(p`AT-@p0T-:W@Q  R@4Q p0Q  R@TAP`003/P 00  h0S  R l 10!84@0AP\,$,,zp@-MM+@(S+(B+(JB+(u@PލЍBl@P 0 T @@@@@ @@@@-#'B(I?P r @'-MM+ +L ފ+ +0֊ :@P  +?ۍЍP r 0@-@M 1@@!#P @  P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*AP3=P/[P+W@P'AP# 0PI} 壇D=A}  0S 0_ Z(P @P4o0m&&)~*00\,$,aP P X-T-@-@M g0@@N?s#P* =@{  P 00*!R00$Q 4*@P  r0S 0` 'P%(7*Ѝ\,$,O-`M  0 0X#*0S ` 0 SS 0@p0 S00C `@10 S::PP@ B pQ %S0S iSc %S, dS n0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@ - T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 VD}&7@-@ PU `! -U00 Ѝ0ll4P X H!L  d( 0$[',"!!0 # $ PL  YP U $ t⡙P2P tAtJA0S TPU 8 -P0 #T0  SR ##1P  1 $V0I2g>0YC#0P0SP @ 0V0 R0SQ [徍0S8 NP /_yu  PS 2 ,hR&ptbtQ f@,,R Q 8DQ ,Q Q Q Q ,=8Q Q Q <00@-,M 0000P00 000 0 00\PPP@P DD@0Q ,s,Ѝ0@&d lR&v&R , -O-piMs?!0=W$P 00iߍOЍ/lxh@PX1P L!L0H0Q(@P jZ` 7PPW0FSV030#Z0S z00W"'R!` P Pp0W0RU80P , 00(P(Q,W!.R ER -O-p0MT@X   p$p左 `V X @M'U` PPPD@P ?H E0᫦;PU 0'SP0U*S/ $P )z [ 0@ 0 0H0 %P11Z w0噥p`PUQT ( #2S022SP0220C2   S`` ጂ,x$00 00( 0p|W  @0   (PU .d-d(c0U ; ]W 0X0C?o20S ]b$]-bdd'x@0Uk]]x00CS0000sQ1T0U Z$0S  r7oUgwi 0%S @SJ B* BD0 0xy/00L 0.RP 0 05PH00ZpX@P 0A0 0X3 4Q7g+Uw00X ('Sc@ⵁ0U cwz  0UX ~a]awoS PPW  WK0ЍO Ѝ/XR tR R Pq ht@T-u&OR 0@-CMl6PP 0S .Q儉@P 4⊄Cߍ0 P僄 ,,G-p@ 堀堐PB`AT:00Z W ,/Z 000 PP EQ 0 @R D}&A-`Pp E"p@ / ,p8 c"P @躎,A-PJ@Gopl  0S DQ0Q.SP @$ $ك Ճ輌, ,@-M 00PDP   0PDP y  !p@ ( ̕ փ "P Ux@(  Ń```p @(PPЍ ᄃ ဃ`!i,%iؐ,,8i(,}vO-8MXJ00@}=0읟`Q >d0 @=T400W0 ,4P40,   -8 4d0 w=C$ CUSTrP, 0.̟ Q(]?P 00 ( 0 0uPPPPP=@<,`0tD0D,Dq,{ \<J /  0p>0a Xvς 3PP\  3PP;U 1sS 1lS;"000 /]P p@ v ᘔ! H└dH Qp0PKP[P{1@+0~( ސP ِP  ԐP ϐP ʐP ŐP P0:4: @p A*20p 0HAvp H0Sp:K10d*dVMP 0H0 H0Avp ( AP:PH , o$U  \PPP@;uP@- ,)0x`)0w[_P\8 0\8UXDy0 yIT. ()0zB;F@PEPS*PN X0 ,\6SE p0 @@P: d5 # |tl `[7S'  H @ 8M(7@ P 0(ApAP\XP@Ps:4S 0 zP 0'APpwP 6H'X0b@Pal\804'8\8P$W 8a8 PP0&08P 8O8 >P0060&S\880\8P 878l0S \&8P 8(8] P000S\80\82P0S\80\8P@sT %0}M\8%0|E5T$A Q0:$R$ Q9ğP \0şW|t^H4   =4SP  0@?S @P ༀ4{ 0Q0:$R##TğR#$R#W%HR $ 3   Ts0S1 `P 2@T ZVHH#00S "0S 4#t&IL3S3 TE 4"P0  0@F0@PgxP$A?p@Px080Ca@,0,P p4Y0S ,D !X >0S@0 <X+4AS< ". 0 0S D"D W5S x!+o0 0S $ X㟆Xz꼌,R ,R v&R '{S S D}&R&d ,,R R i,R #RT [T Pq 6S W!,2j HS W a,,,MS ,pS9T fS S S S S S S S S S S T T S bT }T !T T ,lU F,U vV ,ؐ,D'V W W ̐,F'6W GW dW W W W ,W W W X ?X ZX xX %X P 01/W!rC-鿏P@,MpἍP3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ߍI X X X @-p`CM|@gPlP#d0RXPP @ W<0080 `0(PCߍI rX ,,X  ,@-@ @,@-0  0 P @0@ h28 0/P $  Ѝ, ,,7r 0@-0@XMP0  0@ P x x0 t0Ep@=2P0/Q   LL q12 0/R@, ,@gЍ0輌, ,,,,7r ,-MMYPӌP  ~~ z~0 00SލЍ\0\ \VP L0 (0< *0, %,a,,,,,X ,X @-RCMX6S AP \8lP XT20S HQ2\6S 8L2020"(2`Pr\8. x^10 eb:4S ![X\@10 O:4!SO *00 0 BDpAttL2@P) x1d 7T4L1<.0S ,!,'$!$#0S   IsP\6S  V IqCߍ 0 B꼌,َ Y F,6W 9T ,Y ,Y Y #Y n,CY S ̐,5Y pS\Y gY S S ,Y ,Y Z8Y ,Y Y Y MY @-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'hЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0\ P0//!01000/ 00#0//O-ap$MPA@T  -P00 ` J0S 0S0S$ЍP P00 S S, R ,0S R : 8 80R:P#3///@-@MP MCp! *0 `pM Wd5\\ SS=S 8 d3R 0 ,e0 `ڍ ЍTTZ Z @-`QM p@ -P YPP PЍ埊PTP0 p3P@$U@@tT @ @0 @3PZ 6g Z O-Pp 0@0M'"pPP _`ĐĠ0 R B PЍ 0L03/P 0 놁0   @$0S P @{ @{`X,Z p@-P`40@0S 0 p@l*T@-0MQ!p0`L0 3/P< 0t@T 4/@0p0 ᬈ 0ᧈ 0@o$0S @g{$0 @b{T `@\{ @X{@⫀0S0C@ ,$@ *ЍX,[ Pq ch Szp0S/p@-P@G 0000p@O-p@P|M Y\0P,0+`,P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p`*`P 1,0000U00 0P1 00 0<00000RpP ,0<<0@D(@0S SP 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0  @-Y P 0P 0Pp PQ` QTPQH "P <080P/,/(//W![rp@-8@Q0@P@DPp 1PpR&p@-P@P  tz 0Eo`YG_FPEQP 0000!S9PP 00S 3/pO003/No-P40P (S("&+"w b+bw`|P@``VBaV>+"w+bw3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3   Fw vw0 0~`PxqxxU" b ,`P  PbcP"+"wb+ "`P ᒅP# ፅP ህP 僅P ~P yP VxT v  v` (~P] X!,$,t BxP[ vXOwfzpa] ^oT[ 00A-p$[?p@` PAP0 @ p> C 01/@P00pЍpP@00003/003/$AY[ O-PUMM.Xh(@4P嵈.zⱈQ`xFiwU`V`$Z^  UݍЍT   70.07 00P00@P#Ppύz\40,Z^4S =(7h400C2 7\4=1 V =6h400C26\4=1 0 00  000000pp`l ( E0440a40s -1yv0 00 00000 0zhp` 0440?40s -1ଔV4 `v00/ htE "vd5@]^ =2,XL=1pP0Nόhph \  qv00$?00.Z000Ӧ?'N?@/&"`HhT( Z4@0S N?/$"@<4pW04 0}10  A u "u u4!0p  1$,01(L!!,H48> C6$ 1^(1)04 $,10 (q,1 48qHL$!R  p} \ z^x #@p#0"$1H00 4;$ 2P p> C  \ $10 0$10H00: 0 0G80 ,! [6$H(@GS  GPn<PM <KSI 0$10! A04!8C0(1}1S0}1$1S `4@@\,T-u&d YWzpR&$,,,`,r,[ ^PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0 H  P y Pp ,[*"(0$0 .|$(pP d4\,O ܍Ѝp 84Iu0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕 $ $ $ l $ $ $ $ $ $ $ Sn "Se S P0~  R{ <pWv  &P d0S P"8H8 ▔8Rd0S $"8\0S  "8c`0S !{8YX0S! S! 80lL0@ \Q\0S ` R !8[x8 WlQlhQ`Q`\KTQTPEHQHX @1R<;0Q0}P00P0)0YP0 U @' 'pPv 0Q  c$,J\ 6g eT\ x \  m\ s\ \ \ \ \ 0, \ \ \ \ "\ @b \ (\ $\ 0\ \ \ :\ \ [ [ A\ [ \,O-UM0M*a8V"e&m'@& tetX pW &0 X0T (Q 0TލЍ ; )qWd ^P FP&' #P % @P @p`H唴 XBT0SZh ` X 0S 4$@ 0P0000P FbfP14s10#5:$ T&R&P&0S K&I& s>Ly рP0@DPJ@ pm `V  P `p80  P 0 0 ,0ST0 S00 P0p800SS0 4 0  0x; 8:/P00400ST0(pp S S d d d d d  L Sc  SV 0 <0bP<0PL!@  PP ,0$  40|( P3 ~ 01PT $(P 0045S0+4^q14  t0 S r0 iq%԰ 0Ȱ 0$,I] y,N] g] ] ] r] ,s.,^ ^ ^ _ %_ 2_ __ e_ k_ t_ {_ S g] ] +# ] ] ] ] &] -] 9] A] ^ @b 6g ] ^ a^ 6^ ^ \ $O-@AMT MXp P`L 5@P`T $*P```[PP@Aލ Ѝԃd"̓C̳ @Z"3 (4@$80R"DP@<@T@X P \<"430$3 00 ."2 $02(408@Y P "딢娂  t20"8@d2@DDAT P2P"PPÁ$P <2 8&PI,2 $ *20)ATp !0 TP'!V%0 Z@0S #P 0St H0@4 000@0x;8 8/P6  %P !%@P 0  v @%%0 4@pW:p@X!_ \ Bx_ 6g DŽ_ _ _ _ _ m۶_ X!` ,I] $,zpx rQay0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  V PB,, $0@-@"!P(@,@-$@2S ; 02,O- 0 @P@B`P@   # PP@ u@p0Ec#రPU* ЍI HP  HP @BI    R0S  pD}&Bx@-@00 bP Q P 0pЍ C-PJMM pbぁ 8}@4PTbH*PhP8b Yo`GFWI }P 0 000!00P < 8<1P <08 <@XNo<0S0 0< 8`PX 40,0!= 01@0100 0A00000@ @@@x,U@f0S8 0S(8^JݍЍATP0 8`$!QQ@0RT<0P 0 003/@<08 S0 S(0S 0S8%(0S003/@<08 S@,X hT& 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> `oQ` 0@o/b0 !!/ ,10/|p@-@4P0 `Jn1111p ,O-P@p`ԐԠ԰0/ C !  !0  P00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ ,T"    0@-P@M/.1, 00 0d0@00 0T0@@@@1 0 000@!P,lߍ0 ,O-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+   Q 0S  m0 0P  P  $04@H0080pS,000TT0 0X0$0\0(0`0,0d0A- 0R 0  DQHa@1QRpB   !LAPAP*0 \A0Q     TTAU @@ ,` O-`BpX1MSL20X\1S,2\X1S \QUЍ0C`1Q`1Sua`3r1PS \1 XX1! 0`1V$ 1x C H0C 0^fP 0 S 0.S  l p `Z!X7P ^0X`0 0mX"~\!P \!~000: SX1x 2 \1` 0 0 X1 ` SX10 2 $ ell ,T&8 ,t *  p@-MMPpiP oۍЍpP@`+{l P*+pAl P*+;l P*h P P%8 p@-Mw&s@n(N]K`P7 =i<0 0 Tq P (^7(^ $i.^ <@P ލp_E` a,X!dd  @-X@01SP@0S01S0   ,  O-@MOP! c0   0p`嬢Y {pP 0 0 P0SߍP W%]P0P0 a0CS0S p  `cVp08Sڠ0S' R$ S\0  0 a00P 3p 0h1U0ſ0 0s0Z+ 8p 1`p [D0P![h!R( 00@P(O  00O0 0S* ?0!C  0  00t00 00S 0xVa0 4u` x d@edA,` ,o C-L1 @1 R0   A h9&Q   R 0<1LPDTPapH pLP pU `1DP1 pU `1TP1 oUP1 `1oUp!00, p@ ЍC/ X!X! ,X!r` @-M@ P @oЍ@-| 0S lP \0 T0T 0PP0kL004 80<d( Ѝ Ѝ.,` ,,7r ,c ,,@-p@Mp9t)0 0 0T00.00 0=ip $0t !Ѝ ,X!p@-L;@0P Ap@E+` -?@-P @  R ,0$0$@$jЍ0@ Ѝ/ a -a @-0  0K P L0L L@ 0< <@0 $@Ѝ,, ,7r ,,-3M M TDP0  4HxP Bxo3ݍ Ѝ䝉 ?-3M M cDP3ݍ Ѝ䝉 00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD@00( (0P,`,,Ma ,,,na c ,,,@-0  0 P <08 0440e000 0 ^Ѝ,pa ,,,,0$ 0!S/ /,,0$ 0 S/ /,, 0( 0S0 10 1/-, ,11<0@ Q !@-0 " !/ ,0 10 1/ ,@-Mn/.+{, 0l0d 060 P000@ 0e@,AߍT& ,0D D /Q/QQ Q/ ,T&@-@0@ 0 0\PЍwa @- @0S00,a 0@-pAMhPN @h  xP<04Px9*/m0Aߍ0a ,a a l,@-P@ 0P  Ѝ,-@-   Ѝ Ѝ/-@-\0X0@P (D  z4Ѝ@Ѝ/pSa a S -@-\0X0@P D  [4Ѝ@Ѝ/pSa a S b a @-4P P P;b Db Nb @-@lmP@ 8Ao@-4@vP 0 P % ,,,@-4@uvP 0 P % ,,,QA-@@1@#PP1P#T|p|` `P (B(A3b!!??5838ZAZT-,7@-@-P @{ 0 Ѝ0qb v&Xb 0@-EMC5P@ g lP0000U ($$0x:@Eߍ0l,& ,N'@-xM^pA glP1^ P0x 4!a  .Yz<$0 01P00 0H0 0 00 00 000PP`P$:zߍpb02$*zx:X J%P  (Rg(Y(J%b ,l,2j Q+ b  T&b a @-@P !0`RxzuP GPP exZP`h 1  T $.01G@0PQ@T U7Y Ѝ ,R QT&@-@<?$0@- 0  Ѝ0@- 0 Ѝ@-0@M00 0000 0Ѝp@-P<@0/SpQ uPp@T&@- 0P,,O-$M@p`P 0 P( 0 PP0 P00P p @0sPP0PySa00ͅ0݅ 000͕0ͅ$Ѝb -r,2j ,b ,, c O-,M@k$PSkapY7Pi $Fkp`V30S` ekppGWT X1X!XXw$ 0 `   $ 0VRR  S  R Dk 0B0EPB$k0! 0$000 0  $0 VSS00P0#02S `F 6x Ap?k @p$ j`,Ѝ7c Y! Nc A-`pP@P!x hPP 6/AG- M$jAP`pP Ѝ0 0 @`10 VSSXP$ j-@- 00Ѝ Ѝ/ᐌ -@- 00Ѝ Ѝ/Ḍ A-pp3`PMMP` pRp@uD F=V '(($$cp&  0Su 0CS2PJ{S0)  0r 0S8 0S r0S 0S QN@|LP$ 0 \0 L@nD2P~ 00b0C?o270 㢏0<(G90SލЍ!7SRsP1Q! F?p@F>od!H1P?0 D 0L$'  0S q0Sv 0Sr 0So QN@P  00 @PYF? Q. Q FHmoc c c c p,nc c `,,d 7r 1d ,T&EI X rc k,,d j =j -MM P  P  kۍЍKd -MM P  kP  VۍЍXd s@-`P' P\P K%Pz0S 7 6 6 6 Pu @D`BP bOv@TT&Ѝp pd x0|+R/ @-d|+\0XT0PL0HD0@<08{40 ,d H,d t,d L,o# p,{ h,x,P@-@ -@0V,p@-@M L(@H@u0 #,0H ,0@@0b@hPp0: S HP c c܍p,u 8uQ @P`@Pڰa <WT@@O8 1!t|8<DQi T1 08808PP oQ P00S nw < R t00 00000 00l0p@ m(yt(0Q!,,,,, d Y!'Nc , .,,,d O- 0CMSP0q `@g0!`W40`SPW!000 @ B@@3/@P CߍW! 000Z 0SX 0 @yT W  00 0  0S l00S \  P0W0 ! !  000,,X P,d d zp e ,-e ,7@-PQ@0 SS 8_0 000] Ѝ02S  3e =e O-0UMp(0 4Q  st#ß0/SCP3c0ԃC0P/UE_# 0SPMWC1 hFd  _PPYP$ 0RP hP *`^ 0 10S 0S7 0 1S30S kP`F %p2pDO2TT 00a 40 0 0R RP 10 1000`yRP 1R QA  1S Q00R /RSR UߍP 1 0000$0000 P1 PP 1 3T1 )P c ,Be P,T& ,je ;f @f _f if f X-T-,Ve ]e e +e e f pd p@-Ph`@TU\pUP`eP  Sp@\&zpO-`MMp`` `T  PP0P l  4*@ڍЍ P P dBP PP ZBP,>x+@P8,D @ ހ0f P0=S`  3 {P,,V P P  ꈠlP@ PP0@ ~a zp2f f h8/10p@-4 P@r0 Pp@@-G-`P4 yr@T$ `V! p0F&04 p0RSP prPp Pp40Su p rPp@T/0 R/@-`p0LMS@`aP 0S0L0 3/P (0 ! "!P 3/P 0S00LЍ 0  1/p@-@ P rP  p@>@-@ D(B@?A-P@p`p0S 0pp R/A,05#h00P20#X0 0Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-8lpЍP|@z` .p ᤷ p ᛷ yᕷ 0`፷UVú 偷t@ l`P\P LP K@lT V\VkVzVV}DVrf Vf p@-PMM`; p  @p rPrPۍЍp A-@P 0qpP` P  0QP`|d zd@@-PM Mp;P `J p  @0PRPU@rPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP q00/00/40@-\80S0 S0010\80S  0\\@!SR0(SS QU S!0$0S\  0 Y!1Sp@- l@$\ 0P!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X  Y!40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4  B(B(Rt01 408 00803/P,000403/,, H0 , 4 T 8 X  Y!000/O-0@p 4MPPp`314ЍO %0 L03/P% Ѐ0 \ p* D@ Z["H* 0*P T P , [p o8``pp 0S0P 004Ѝ0,O-P@4`崁崑崡 Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P p  0!"0 0  `0RPH P00P0 < Q Q  Q R ^ Pc X L _ HL 4L P O-0c(0M<00PSp@p`00 $ 80s!3r 0 jh0@l0|S@3` 0\@  L3R0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D002 p0 0iHL048  i0(0,(, 00 0iP23V 4u0p0P<0SQP0 N T00SJ0Sa000q p0 j0 W0 000000  `0 L0 00000PX 00808/a0 PpQXQ Q(00,0p 04 80 [`\p a X0S p^ 0$0p0 0(00,0  04 804p 8 0,X,g ,g rh C-F`0pSPlM^x1a0S\)a0 S !a0S$a0S a0SG a0SHa0SI`0SJ`0S`0Sl`0Sa`0S000$ R(000 "0A W(40S  0$S $SS $S)400 0$4 0h0E( _`0ST4 TQQ00<Q00S ,4Q ,4 (lЍC W3W00 p H0L0 i H0L0 b H0L0 [ H0L0 T H0L0 hM H0L0  PF H0L0@ 8? H0L0U lЍC6 !SH000050PpG0  d 9/ 000(0L0,~^ X Pc P ,X,r9h ?h Hh 4L L HL n Vh o a \h _h fh mh vh }h h h h h _ C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``D0 0pp07/@-M0@ 03/P 0 004000 %003/ލ@-`,MHP Y@0 0 0PP@00 RS THP pW hP00P00P0,Ѝ @T@0/W/0  0YH P00P0D}&h*0@-$M@D0X q 0P 00 00,0PQH0Dd$Ѝ0\h G-%p(M@PW dX`a `XS`OP0< ,`SS0 Q "S `P  P !X$U0'$U ` 0 +j0 00% 00 0 0000M0{PPVe(ЍM  Y!h Y!h L C-40PS,M80S,ЍS S S !S S @P `p䐟`;`X 0 000 00x 000 0 00 0 0M`P_Y!,O a N O-P@0p (AMP U  ! `<#B0!(p<#7UP <gP X00 P ]P QX0U0P0PX@!kJ 0 0 p `@AB=A0  0|!.C3 @0  T!$-) P0  ,!D`pf]P@!@3Q@_]T -`'jT@D@`0@@< 0 0K-j0 0@`0P .㨠嬰h 00@p `DAߍ!0P0RPNr, ,h !i EO-t5AM0DpP$YPQ 0@04`PF X, @0D ,`0S40  ,0 ñXT,  0$ p0pC 0$<0@0 0R80D <0 80 0S d42@@00]? 0 4@00 0A000 00@@@"0S8HP a0P40 0H03/0S,0@ p p0C @@0D @000`pH0SOP p1x'x0(1@P ! B B2@"A$,0nQ ,0R BcQ"!i, i  P8p@p Y0 Rp#p0x1Gx10q000AߍD0` ⇁0L03/ 00`0:x  Q * Bq Bq BQ B` B  0_h 0@ X@@p0 0,(0 @@@@@ p@@0`PuUߍ pv'0 pD`∀K c>00*80A-0<0@SH04 `pPcV09c?V090VP:0Ab!q0S/A-@P0\03/0 0    `0V R!  B B" P10C+Rp 0!"2P! 0 `(PPp !@` B"O000>000$0 01P0100A=w O-P@OM H(ga1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,pP5Oߍş[@P XşT0@0C0p0NC2 VH0 0$ 0 Rд V 80L0TX 3/P1m0 00H03/0 T00!!  003/P#%#& 00t80x 3/0lPp >g̍X 0 030x300 07000F00, )@ r01 SH0 V p .4t/` PP00P00X00 3/088q0X 0L03/%$& l00,0t0T0x0X0h0H0 0T`X 006/P `0d Q 10  0!s"D  V p0 BND!2 B"N1ᴡ0C100C0 f `V`s`V T00 03/P0 0D 2#4`0Z5 P0a 0` 0d0  p D00CjND!2 B"`N10C10 0?o2100C0/ !V ,Y!(Z!^ Z!\W 0=C0H0 08<P]$xU 0S  T0Pq0 000H0P0 F0\PT0S hx}^P 0S40Q00`Q0S 0L0 aA3/P 0P P  2/``dF  X!ZpBP0?\UP(0 Z [ Q PD @0    SD0 R8X)' a`0"$0$000,000$0%$0t H 0\x 0 \0  0\ 0(u 0\Ȑ 0 k0l010h Lt0hp/+H`O+ \O  Z`*pV 0 TMpU 00 0\TBp0 4T0 46,Gj p@-@P0 p@dzpp@-@P&@ 5opYj    @-o@-o@-o 0P/,0@-PM  0xPPI 喽@  0PPP{I@ P,P0Ѝ0@ӿ[!j j ,,@-&@GA-A0J?`V=p$X"0 BPPЍ p> C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a$,C$0pQ@-4pb #"T R0//s@-(@T@ЍpH0P0 0x003/@PwC5/@-tM`P @P0 p@@"P  20@Tp@tЍT0 @T|0t dl0l p J`P L s,j j j ,,j j j ,j k /@-N @ *k Y ///@-0@Q Tκ@o?0 \ 0P000@-P4M0 t[X0@T FW 0    @ 04Ѝ08W@0,,//G-pP@`ㄐVT0S0S WP$1H0PUW0 X W0 `p@j ,,0SR00/p@-@P0V<0P4`" 6D0# A@$!pX,,A-<`P@gWPp( I A0,@-p@-@M @Z0 hP0S X`P0PP0V 88 0 $܍pbc,4k [k yk 1G-1`PM@PN/1!1|  tatazp@Ph7PsP[pL0 [㸹ߍ BhB?M pP0=SBM?q@ B?``@zP > B!Pp@ip P 0 PW7O@ Q1O9a " Q82j k ,zpk k k 1A-1P@,PN/1Xp1T P`P`  P  <* O ,,d,9k k k k l @-0M02000`00Pp0?@P s@T 1\ 1T1H 1  P1 1 Ѝ% l Q:; 0@- SP ,C-`CM P@ `YAP pܐ܀0 `0`0S1 1 Cߍ5S  |Rp pP\ ``uX0S  @S1, 1,;l ,;{,cl tl l l l :ѸIp@-P@1 1  pl,1p@-P`b@P^0 p@$l p@-P@᭸xP f1P1   pl 7Up@-P@1∲1(1 MP1 1 pm U@-へ@=l C-@[M,h7YT[BP`ᤂrU U.V20P$0 idPZ d"0(@80ZPW D"(PU ( $6#Sp 0 LP` ;#S0Lp0 d00\ `0h0x00X P$`P`l0 (04H|000 00 00p;\!"p @-`X0Sg0 P\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S &0^ Ѝo \!o o o o p O-0TM00 0$ 400 ,00(0 0800P! 0` @@wP$0SUppФ Q 0U U H0!<01PRPp6LPUp<0L @P PUDp p0S H0L HLPp00D S400@00P4p S 0  S PS p0S ;S S 21+1:$0S Lͯ$0,  QB\X<X4RQ2ȠP,$0'$0(Q $L(0 S ! 0S H (v>80ƀ1 0$ 0 0 0S0 0S 0$ TЍXRX0B"1,zO-P0M@DTЍp`ȠȰ@D0S W0@  0 0 `P1/Y  S      Q R  0@0Q0 0`Pp1/P ,\!A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A- @P`p1S 3/P @`VTd0@@T0P0S@000S4000S(0000A4]!,,\!(a!g!p@-@4`4P0Sp@$10S 3/@,,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp `^$ 4R R0 0`40$ Rp `083/< 0 2 P   ` 000 0S0\000 d 00//00/00/00/10/Q@-@@ 0A0003/P@$# @ zpC-B`0SPEM;0 WB0pSOB0 S| GB0Sd@B0S 9B0S02B0S+B0S00$ R!000I 0``A0 R .0 00T `0:/P `00S0V0S 7A>V F 3 N &>0!C> f`<0 010@0`r^,X,q zpO-PMĬ0@0` P(" `b0  800 0Hp!0@0 0H!00p@呬 P@2xxp@@gガ 0 L!tHy @p0 $!j$o!p 0a`P0 R T; PP;Ѝ 0p!N0i `A `<;OT 0-00@p NR S3#:@`0r,X,Nh q ,4q ;q i,]Mq EA-@0`\03/ pPW@@P@=P< 0쀟DW  \-W0 U  .  ! 0 n/ 0 00$ 1 x    ]/  C\  0SJCT H0H HHK0B@@ q, (  Rq (]!yq s@-P,`@ 01Ѝp,p@-0(M0P,03/`ծ0@ S:000 00 0 0 0 p` ܥ0A0I(Ѝp0 T O-PM4,@PЍ pP 0p @r @< zL PZ0H03/0S@`H@`A0 0p`P p" 0 Q"d2d" 2]? 0 0 0A 0000 0 0嗨sႯ0Sk'"0 L0P 3/P X0P@T`@\0`0 S8.P 80S ,3 0, S001|40P ∡0L0 3/00 P0 S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV iP2Q %hЍ6P00SZ 3/@@OoBS h@0&0010@!Rt!@!x@|@pPpt@庠t0S|0X*@FP PQ 0!@x 0T:x0S@ 堪t@OoB@|0xT:@$,q B]!q \,, Rr08E $ ,4 Hq  ,q >O-UM< SD [/080<44@`0P +pP] Uߍ 0P00 P,QN3, 040S 0R@ <0S6(1SL 0L ,HLAP4#0C 4 8#H@; $彥庥 0@P⧪P @T "2B 00P 0S 3/P,00,02, 0SU@`PD`D@t w X2R入 Y8N ~${,H! L@H@<#7`P`T@gP &` 9@ 9,9,00 0040` @Ȧ 9   , 彦 9, ⴦ឩ940P1: 1 !  >E/ @0 000000 0000 00㏢p` DiD0U0 Q[T Y ljh0fv `],,ror D mnr S]!q O-/0@JM M`0PP+4P) 0S% 0l"`!`\r\/H;0P T  0CT *0C/Q 00qPG@m+3 P: G?0  P+0: S `VF>00ꨰ  _PJ>0@0/S> 0w+ 3 S 2P+ 3 P*P 0/S`0oo`bS 8p80&000 SV+tD3 P*+>3 P*-PF@+F@]&Jލ Ѝ 7r 2j @-R0)@-M @ZP(0  @P  P Ѝ0S:$c(#"c  8#8S O-M` 'PPp X`p㴠崰,P%Ѝ0S @ P0  SpLfP Xp0  @&r 7r .r G-|M `P`P PP<+2@P@~ 0 ᳬ@ @PK+J2DJ.0㖬<+J25J.0T㇬T-X 〬PP~D$4 wPPu$9+J20J.gPPe)+Jp2 J?` PPPN+JY2tpll40 0J>P 0 .1P UT 6ލ@P@Y+J*2J?PPp0J. @+2 P h lJ>PR =r Fr Qr Wr ar mr >r r r r r J] r r r ^&7r *Lr wr r i r /00/00/00/00/0@-0@4M#|0$P 0>P\ P0T0670 P喢 U@P 14Ѝ0X,x,,O-AMAd2 (000PB(0 0000= 80s#0(0`p[05 0>%500%`O0$0 0$0S000`5_` @@`啜@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0 SW`vp 0 h T$`0$00  0 0 0#4P00 0`0000 0c$0Sr D 3D0Sa @Z%S[eP*%0C?o2 00;0, 0H03/$0`Sp, H0LC +0V   0= X00;000P0 pX00  00 (00P 0 00 0S r(0 8DQ0v1;0 H0$0L010,!<1H0$00, `>P,  0Q00000S p, >P0, ,0 [wR0,4  >P4  Yp00p,0Y08pB,  YP P 0,00000;0(\cQ  k,00ZX,trs ,j2j D}&$,=e C-pQ|MW0PSSp`0 00 P  "  <" 0@T0 S>T2x@&T"@(@@,0S:0奠(0$"P@P  00+0@080s=0 0( WT W|Ѝ#!@&(q00\1 0<`!00 XTҴ@!0(PY R P@@ V0! 0 h0@L0 400t0S00XT婴00P0 4P@0(l &@l* @8q 3/PX,s fs s Nh s s s 0@-)M@d0p \*3 +@,P0 C*P <- 0 F  .0 0Ѝ0!0P8q0 S+P ,şP .ꛂ OE, h]!s `,A-@  "(0M@( 0PlQ2d2 5  L! n/ 0 SpU 0 Q$0S   $ pƠP9\ЍO*.t>3 P:0pQ  ,`VT` V 09 80`0000Y3(0S` ` 0 Rp`H03/0`0[   80s pȟ0PP000<  BR0S0SP 0[p08 r  *   * U0'0U " [P R 0S  0-9 p0 .0PP  P 0$ PU$p0p[0 ^[np0 PUp[h0[( q!P$:p0 0 00$0 0$0 0S 0X 8XZ 0 0P pZ$0 0 S)D0 0S 08 00#0 P.S 0UPpСZ 03@ D Z0)  Z$ RRp 0S  S0 0Q0000 00000000 \Ѝp0  ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S uP 0 0 , 0R0S00`R  l9P` e9P 0 Q ``T R T  R X `( 0Sl0L0( 3/P <00S D0SS000(( rT L0( 3/P 80<00S (0, S004 Q 0 `( O20PP0Z0[ U0s P 0$p$ PUp0 80sd0 : 0  U0 W[p㐁! 0 QQ 80s 0  00UPpp0  R 0S  0q7 p0.  0@ ,]!$,P,H`! =e O-`M,p@0 40PVY pGpPT Pp0Z:`PU`Jp?ERUA `?`/``;00#h R 0  80s0`F`pHU p W<h0S 00  80spHY pPp D<h0l0 0L03/, 00Y:pPp'p00P80D>ЍO p0H03/,0$$ (08RPP0$P(<00WS:< R4*p,0, 0$` 0S `0S< $`Sp $ PR( P`$ (06PU` P0 Sc@D S \0S 0 `p8P0VU:00S40000040,0(pWs08`<00< R:pp8`]p< p 00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0B6`V`P p0k  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P}0H03/0@08P0D00Z|*p 0 `<080sb00_ <0 0SY04 @0SD0  0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0  5 V00 400P0 00 Q40 pp<0Pp80s00  h0S l Y* 0L03/Pt !0 儐X09/Pj 0$!000400$00(0 00 0S(0  0 H3/P- X$ 0 03/p<  0L03/0p Pp$0P( 0S pP$ (05 W00 40! 0$!000400$00(0 0$0 c(0## < 0  00 H3/P<00`0<0l0 S04$( $ 0S(0  0 H3/P* $ %P 0 0X 0T80,3/00T00X S \ $ ` ( d , w ,0St P0 P  R0P0l 0$!000400$00(0 0$0 c(0## < 0  00 H3/PP80s_ 00\ Q W 0 ST 0 SL0  3/P@D0 RP RP0{ $ , 80X T3/00T00X0 0\0 $0`0(0d0,00Sb 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQBPp`,0 0UA:8A  0 0S$ p0p0$  S[p`P p0Pj"0RZp YZ Yk:PpW00 U0#S p`Ѝ茀 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0P00  8 rp08Hp0!8p 40X 00 0S 0P*p ` 880s0 L0 3/P 08400H0, 00,0+$0T00X0pPrm۶s V`!]t , 00 80sh p 8Pcp@-@P(M(0S8(`,`M0 00P0F0 P P`0(PdP,(Q(P(Ѝp0006,奔(E0,`(PT- R,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1\!S<1@100> C @t70Sp(0 ,L,0#0I@ 0'8B 0' <0 W &%, h0d80000, 0 0V0R80000  0'ܿX媖0B0H>H0P00T00LP (X0Q7W0 000p8500 %  % %P,  (P 0 %<  ]? 000000 000 0f00kpp [05P,0AᰓXpW( 0GSC(> $P A$ 00S H @3/Wv@DpH L0] YZX03/ 0 05@0L0 3/P 00S 0SpW+ WP60pH03/ 0! P7/P%$%$)@0 Q1PYK @1003/Q  01/ 0S 2"m5$Є  0:P  0 Hp0  @D@0 ᄀX80X> ?Pn㎕Kl,0S 2pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000$,\,rp408E,<,LHq Ct g`!t 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-Yp@P` 0< # 80s#   002m5  0 S R( 0S%  吁( R Q0 2O5T 0 < {+800 r"000S   I @40 0<0o- %"{ 娻 KP@T8p]? 00 0 0U0000@00 @@@@0,$ppK܍Ѝ(i(0S*< o !8 ;c&@@d O-`0@PMM,0d1d0p 0S (0 S> 9 H4 00 0 <0.%"@~40kP`0V,p]? 0000000 0 0U000000 00͐p`ލЍ,⣍,0S*< !, 00B"X R00C0C0000S0 0,0A$P`,d @-@-M40  !<$10(10,1P001.@-@940 0! 0O-,MTTpPP`0 R*,Ѝ "P9 @@5/P`K 4` V`G2 3 0" 00 0(0 0 0<`ᇐ'0,ЍO/@Z:p@-@Q-d@@@@@@P嬒 0 P奒40 P㟒 <0`p@ePP喒80 P<吒,0 P(劒00 p&Xt 'bt )*+p@-PBMH`@x ! VAAA B$BXBBBBBC@ChCPa 0(PX Bߍp`MP00SG0`B40P`<80PS<80  ,X0S(!$@( 0P \0 `0S @ `d0Ph0S @l0S @xp0S@ @T`t0P]lt 9vt :;=>t t ?ABC@-PAMH`@ё  V( D|DDDD0D`qK0 @0S    8`V@宑 0 P妑 0mAߍ(0S p 呴#@,0S H 凴@@00S ( }@ ]Pq .lt /1t 20@-AMP@0Q*EFFFFFGG0Gd   T q0`N 0S (0S  G   C ,`V HAߍ@  h  0 q0`N 0S (0S  #    ,`VP $0P 0 P0 P 0 P\0 PH0 P4 0 ch Pq zpt    60S O-@MV M<Pn 00x R# R0`^嬵嬅adDp80  @Q D0 Pԙ  ϙPD  H  `V8p00(0S%⓳$B00,0S$↳$B0000S$y$Bt0+ 0 p0B/⍙Ppὠ C"U0S1 `F` 傓됣0p⇞ 0S } y`,pYV o$ <i4`r 10`0"  ǒߍ@_ 0  0S  C `pV J 0  1 PS \; 0  0N 0S @0S@( ߍG<0040!00@0Fo$ 0DL03/00 Eppqr0S !0LD` 0S  p8` V0 a x Q0W 8 < RFO   Ȱ 0@ /,@ō 0  d R0Vp 0⯰  {u h*u vmv Pq \h u %zpu u wu -p @-x @.+0 @0p0厔d @|u @-D @.000(0,0000yd @gꐯu p@-XQ`0@sJM]/   0̊1S:UU(VVVV均Jߍp0 00@ @@0呎_(@0 (00 0(0000 0~(CP(C0P,@(P0@00^&3560p@-QPM,0$0`s@]/   0(l$1 SIpWWWWW4X@XLXXXdX 1$ 6PЍp 0 ,-,0S$0P@0 0ǯ0 000000 00,CP0(CLP@!^@8P@0P @00^&`,O-P`0I1P/S X(⤈0(0 00Og0SvU ( 0S `Pp ŏ00!15:% p ⹏P q Q 0, ($!p p $ ⥏P^ 00 8a4Q101T/t, -,7r rQ%w r v w 0S@0@-S@00 0S/ -d# 0O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X ?@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 pPP2@0S- $P* 0 x0D 0Vh@E -P>[m] -U8XUC -|Y$AT49@-P@ML d`P%<2P0S%  (P2 00 BP P< "0 4 P 0!x sЍH0S10S-  uPP'a000C R  R41"$0  000xpP0` 87/0P0 00 !`0A] U00S-  CP'000AC, ^ ^ 0!P^ X^ ,0SP\ $0 ">SL,d#  -Bx t,E -7[ H,  -Ox A-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 L, -H, -p, -\0p@-T00P SDPPp0AS@  1SAD,$,,0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S",l0\ Q0/\P ^U Q0000@-,0O-`GMM40X2@T]? 00 0 0V000000@@@@ 0h?p@c<  # G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K#,0h 0 t0@W 47 `4|$4 VH0 <0G, ,"B,d `,0@-PDM@T P08 @\ 0@  Dd  \0 0DЍ00S`,0@-@DMP/ P0, P\ 0P  0T   R X  30S0000000 0DЍ000S`,p@-@Q`P@M<@P   T0 0SP@Ѝp@80 @00 D0U@Ѝp`,17@-@SW4LȄ$<Tl Ѝ0!|P4P(P<<0"P0<0P0<0P0<04P P<0 S, 0<0P<0 S@  0"{080#{0,0${00000@-@PD {"x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp/( @-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P ,"0 $哯< $" <U~ 0$_P 0|! |Ѝ0$,@-80@SP`4Mc00 0ۣP 003/00$1U Ut  4ЍS0 000 0xp 7/( (0؉ ` 8mx Q` 0p@-PQ0M0@$ 0x`0 6/8 ⹉`Px1x1a1S0C€10Ѝpwx p@-@P 0P  垉Pp0S@}p P 勉Pp0S 4! B! jP  vPp0S hZP R 0L b 4]Pppd# x Ex x Tx x O-uM Mp0 Z-H!H0cS_ C0SSzB0S DPBؒ0SzȲB0Sz2 P     P x2@    PP2 HD     P 00002x @@K @P@ PHPP< , h@ ,D@/1 01P01P010R0 0K000 0`}p@  P\yZ} 0S10$1S10 0Suݍ Ѝ㱂P`H㪂Pj壂Pi1S |!R |㐧P  ^&`,H, -t, -L, -p, - - - - - -:N:$,,_@-@B00S @PYx,x @-@PЍp$QU0 `P PP> C  01/P ,00 H$L Q>$,80S @-0 /.`!m x G-`@Pጐ匠X0r2 S80S00 00S80S0|1 P S$1S00 0UOp@-8M`@8  T P $Q$00S U 0 |1 08ЍpP ၭP P Q 0 ᫺ P m ᶭ 4P `,A-M|P8 U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `p|XDD2 08 8/PD> 0!! 7#`  0 3/P"#"#00 03/p p0` L03/-ⱬ ,<` 0SWp`?`B414!44 0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv 0 |1 0@|`!.`! x `,G-`RM@Xr PP 0P`  ` UP P7  p  0S -ߍ<08 H(00,0 000040!04 04$0D0(0P dWP  `֪pJ @Ъp  40o` 0   U U U U U l ⃪p 0`?`a8SھPb 0  0**0P0 Z  0* ͩd@edAzd@RT +?A-PCMMPp`;8 np@P  P0APU00 ## CލЍ /O-PD 0,00 0@0,0<00a@08`00S WU 0L 5 w0U0Q0SPpW W w0P00`0S ` `{ w``P,00Y80@00<0|`P 0$00 0(000S D`gP`pkpvPP Hw$0S(00,wVލЍ` Dq0p<00008``#400S``V4 P0pp`00S00PP 0P0 0@5 0_ 0!$00(0080. 0<0`$0500D0;gp0PUP PPTPYP 0X`uPPT`,Swݞ0S 4 R 000 0#0P 0S ׯ뼀8 0<$ 0S P 0$ 080S0`P P`\0S0P 040 Q\8<0 Q\   P`{ Ad!;y h,{ { p,{ O8Pq Td!|d@-酝 0P 0Ph,x,-0,M$00 0 00 00 00 00 0 00000000 ^,Ѝ7@-@ P000 00 0000 P  S  Ѝ0C-@pM P` 0 00 00 0 000sS 0lSp@ 6P$0㓄( :p l@  P 0㓔) $p Ѝ@T@Tpd!C-`P| g!j| @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p,0 -08S^-/0-(%- p@-@ 0(  P0R0PS 00Si ppC-@`PNMM< Ѐu 0 ` P `P喌000 ;@PD p{NލЍv y ydG-xM` @pᜐ堠LP! |!0@P 0S PU 0 R<D1D!DDk 00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   FYZ( (  d| h! j| x t P\ O-`p@BMMP/0 ;@ T0P0p@ X h;   g P'  ʔy BލЍ jP 0 0  yg0/SX $m0H,"  m!14"So[ 1 SR 1S  RS1S1Sr`2pB@?↟0Q 0 STS "0SO[@kpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 0\뉨G00 " "io@ U U01U01XOMURXA- 0MHL`Pp p1p!pp-PHk@P( T00V 0R`0 !?020!20,02p204 pSlP0Ѝ 0PS" $0Q00 L03/P Q P0Q    R D0QR003/{ h!j| >0 -P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @P^U PP0 8^ @T ,gP ` ` `b` ` p Sp`" 2 `q`!~``Pa k00`U08pRP08}/ ^Q 0S`P82S011111111108 m2~/P/<`0Xh40S0St  P p2S222<040WP 2SX.| O-bM M 00 QP $00/;M0P0`bލ Ѝ$ >p y?`t00@ ,(<Z 2S 1S(2("((0@0 Ḁἰ  &      0S@p!?⪻D  0 eD U ; (KePVbV儒T&PRQ 0 p  W p!p'q ?p? @p  W p!p'q??p0oh@P  p e?WU E ,( pdj?W U `d@.h!j| Us@-RU0 ?@$`d0T `Š"; P0H0H`04 oЍp } h! j| !} @-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0@.800 0",<< . 00 -,O-P@dM0p4005Q 0 }Q Xg QP08B^  RW* ,50'D0Q   R0RS 0}υ^ @^TX 0SQQY WvpdЍb004@F@  0@TT0@ 0@4P SI 0`P P\ X 0`VBT`@00T04^21 SR8080<0 0Q"80 0<0$0 0,0q?Ⲡr?0(2 02S01 (0 , PO W2m`!R   R" 2S SP 2qrⰠs?0 Ȍ \ 00 0 0\ 0W82?h "QR 0S2"02#38^0WN dJ,0 (S$ 0 802o0 <04pP6 @0 Ē2Z02H[ 1P[ 0i 0L0S 1P0S`10T 80<q?r0 8Z o 0^Q  Rl0 ~/O ` 0( R 0C0#800 -(} o} .h!Tj|  i!lO-@|M40H0X0(S S|ЍS S5 ( [x8x(xx3D S0@ }(00$0,,QT@0S0(S$0000Q 00S 0[SX v?70QP"~, 4š $(( (00) 0P00U00( 000$00 00 U00040 080408 0,000, S 0 08BX6yu? v?( $R BT@2r/00q?`0sh00`0 ( R   T R,0S0u0<0fpP<0=X50~=\0o_P0"Ha``V PV gᥣ0( 8 u@0o/O @0S U SQ0-  R 000 0/ !o/ S㴲< $ 0 Z,0S00@P0PT000zTX2t"0S0 `  0  @D @0D`PpD0S0 00[S@PLpHP0K0000 0 Q0 R 0$$`PU PU0PPT04`o04"HW`PU q<PU fᚢ<@B3#H 41xP,02S 02#38TR o_PVPU P1oώS U 0\ ` \V U 0S^wτ0 8, R X000 -} i!j| } ,UA-`Mx@XPp08 P34`0 P(0  0!! 2 02U 0 0 9P" "#"#(1 0D0x0 P 00S&!003/00S(4`0 wPX`ЍX0 0  #1/P0(@#R 0P 0"P25/0 # @1/09-\!s@-@P04P00 o0S  `VRUp T0P 003/P8oeUeЍp@e-y (i!k j| @-@0MP M 003/00; ⛝pP pbd`P  eۍ ЍO-p0\M0SR `Ha@Q P0  P0bx0@>S@ P0 P0qbg0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\Ѝ$,G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/$,>0@-@0M 410810!`0 P0 0P0P`0 H0PU ! 5/ϸЍ0$,ce @- TI빍@ 5@-@ 0  YPr~ v&@-@@0sg,00p J`0Co4_&LP--$M ?0 0 ᡌ$Ѝ0-4M 00 000`P4ЍO-pQMEU$% "0p%0 0`000 `V0(08 0R(0`V0(0"R 0*`Pş$0(` 0P0  0  0 p0 S 09S .Ѝp0 S   000 00P0 PS @ h0  pHP  Ѝp@pq yj!j!  p@-@$`P]Pp0 @ `P0 002 0pp@-SP@`xM  wj0 0p@) 㯇p'  ᩇp! ᣇp  ᝇp  P  L0 . p,4;xЍp7 4ኇj!q  0 0 s@->@P`Jp @ p0 p`` P07p @ 40 pЍpj! p@-@PqP ( A01pP`qpG .0#1pp@-pM0 p @x p@pЍG-QM700ۍ _  Y t @`V 幆@pP`@-`R]00 Ѝ@PTp ^@P  Q*@ 0S0S0 S   0 0S0 S*R^P ` *_(_0ST  # 00000`0 @@P0  - @-@D@ j!L1p@-S@T1S#d1S.RU9lRUppbV:l^lbp1C^L10CL1L1PS^0P11C^T10CT1T1XS^0X11C^d10Cd1d1hS^0h12,P0C2bV^bp2,P0Cp27@-@0 PP" H1 0D1<80@ 8@   (   )     C A Ѝ0@ Ѝ0Q@-@    bP p l00` Ѝ@ Q @ 00z pЍ@ Ѝq j!# Q@-@    ⰅP p <00j Ѝ@ 1S/70|)^[P| 01@ 40> pЍ@I Ѝq j!l& @-p0M0@M0$+p5 Ѝ  j! 081/@-@dq(L0S  P 0800H0S S@ X(׀ ̀ B@-p!@RM Qt0 p ЍYp1S߀ 0@-800@@A P@-@p t10cSt14 Ѝ@E @d 0 Ѝ %Q7@-@  ,, _ Bp  P Ѝ0@ P 11P,|1@ R  |'AQP |`00CS`0 X}@ T0op 0< Ѝ0@z X0 X Ѝ0q k!@v&u&# p@-PD媄p44p@K @ႅpC p@讄R  p@-P@ `+ 08 l, ?U\' 0 0 008 , 81pp@ 1 p@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @C-`P.H0$:0@0   10 &000 0sD00,PQ 0a(!"4a4# 00 >Q & vPp W  g:080P040 Ѝ 0b"!4b4#@- @T0800* ~IP  : sIP%p@-8A` x7wD!\10B0H1xHl l<(x> Pʍk! Ԃ P- `  ̂ @-@ 1 ,_p P<1 ,J,c0,1ЍP0@D <1 P$6q k!' A g Q/@-@  0S@C-q`@ x @P00@ 0S  q0 Sx   0&@ Ѝ 0b pPt @P v0@0PElX  x PP 0S  Y$0$0> R>  **YX  0S 9@0 S   000x1  @  0SP P, 000 S   0| k! 0C-MM000@"0ⵀp<00BP؁+ nP`pQv07S 0 S W h 0 0\!`1 `Px1 ( ލЍ Pp P  R쀟쐟PU Wxx  x  0 S   x0  pP 0 Px1p  P  0S 0y0 P l!ƃ Ճ  P504Q@-@  \\,p|07S@Yu0 S q0VS@q l!A-`R@p@M PP UZ70l0h @ЍA"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *P 0S( <0 *Z 2 <0P |) 0S 0d !r 0S>0 P 0SV>P  *@ЍA1l!T\ y , O-p@`,$MPP   P 00A $ЍOxPy P000 pp XhTP     x0pG 0pG0 ZppIV3#pp pp }Yp#3s 8118100x1Z* }Px1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 dP  YY k p 000 0SZ81181$Ѝ BP  YY I p 00`` 00T0 :0G [W 000x1 Z R& ` @P `[` @H0` 0 00  WB W W 0S 0`0 7 0S [ xx0P 0S [{0 xrꖄ DŽ Є o&dm! 1@->@T( "44p P`0"@"44 0W TL L0 b"!4b4# 0y@> *t>0@D Ѝ耼p@-p1PSM"`! %@P T 0p1!V OU O0S X\{RP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   {0 @ EP 0  @  B.(0%p ,*l1S s zpl! Č  0 R/ 1/P-/A-@P 1 !  XSpR0 qP 0`0S000S \ \\RP0 S   00S000@00P10 paU0- l!G; i 0P@-p0p pp1q 00P Ry0 U  - l!; p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@P| p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@yQ@P0S 0S0 @@- l!; ʚ; @-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p,p0 000"#l ЍMb@Bp@-P(0 !PUPUR PU PTP,PP@PP4PP4\pQ@ - l!; P)@-0 0PT0/- l!; P@-0 0T0/- l!; //P@-(0( ((@008< D0- m!; @-,MP` 1U0@0$00 0p@000 0<0S Zzp,Ѝ8010C>S00@( ( 03(00@000 0<0S80 p @I- m!Y; @-XQ@P q{pR@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0RPU `0 P  S   p0 z00C0H}R0HPLPU0 P(P0P0V00 S   0eR0 S ,  0\R0 S 4  0SR@-@@KRC-@PM pbĂT0SY 00C01@0S D3/2"(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S* 8P% HLH R 0|S0       @@U 0 HL0SPp0S} `Ѝ\ P RUk Yh T0e0S 0S   PE  \P 03/P-- ,m!; @-8 0(@ x3p@ t@Ѝv&A-`M4PspM lz0 op@ x@ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   R<_&v&-@-   Ѝ Ѝ/@-MMP`@,p0  oR 0pۍЍT-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/<_& 0p/BR<_&p@-MM p xp P@;00 dSV 00@ۍЍp P0 4Od<_&zp0/<_&0@R<_&p@-@PPj; @dR RT kV00pp<_&v&Q@-@P; A@RP@-q@ w01p w01@"4y@-@M    0 $yp1$0Ѝip@-PM@`   0 T yp 1@ R! 0 p`Ѝpii$0 /H0s P/0 #:60#//A->PXMUV0P0XЍU700p@ `R޿0 PU B0>000 <0  ,> "PP> *갍 @-@T?@Q/ @-@T+@@0P/ R R /0G-`P M0(0S @ AP P :P:)`P 0!00 0   .08S0 Z00 Ѝ080 00S # `pP `P0P 0iS.S  `P04S 040:SD}&O-YM `F/@H9X0LP>Yߍ0p1N 0S 0S iPP@ Y P @T0SL0P 0@S0@S@p@T1S X1 ސPAT1S@p\1S`1 АP5\1 S S R@L1SP1 ⿐P&L1PC_oSRPU@!P08S W0s0P 0*81 T48#88 S R p ,S 0 S T W @@ 0?D0 p 0L0D0}>D0 @ 000H0PPP8m!?֍  iY 3 0@-@PDM QP@T 00+p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S Q 0  p=@P @-w000Q/Px1P/$0/0@-@PM   UP 0 0pЍ00 ;vi~iA-p X`0P M0 @R  RT T 1 # ,0@ @ QPUx!@T00 Ѝ S @u@-@ p !p !p`tȀ@$0R% -@ @$ A @ @   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`Pᆈ@P─@Ѝ ؞P\LLP0 q+P dpP HDm!A-PRp@ M 0S0T00 Ѝ/(P pP&`0 00 0  !0S TT 8PLP/00T 8e | O-P@0"S0Z"SJP Y pzpP w70p0 ЍT WhYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8mh?x 0 a1p\  P ?3@H0@?U ,P 0S UA 0 Ap H0@50h h050,0@$ 00 0 ,00,PYT j$@t$PpgW700@ A $C@4@AK0BAP@-@ 0A  Cp P! H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 I,0HS ?U H0P SPH0;00H090U ` do`,ZpP ?E`P 0$'&f CgGH0Q7;0UlQ P0l1 P0l1 P0l1 P pF0Pp1tH000U10H 2{bP0H 2s ZP 0H 2k RP MPH ] H000WH020R0hU3 | 00pP`_ 0 S;70=H0208H0603H0;0.H080)UT <1$8bhvl儒00 0 ~P000 0 tP0P0P@U0 <18∂hlfr000 0 ZP00 0 PPP00 0 EPp@0  @U =]P jxp <PWH0p000 SP0<00  !P WH p P  PWHp   P  P  pP  \P=WH  BmP  ($p 00w ,p 00pPk $E (B H,8>   P? B: T宁PWHk  B) $xp@ pP< (( ( H$8  \ P  B ꣎ 8_&Wm!R Վ  [ , H [ Ax _ Џ ɓ     & / J V c y v Đ Ӑ   2 [ Ց  x! 9 B e[ q E P  = @ В \  ! ' / 6 > 't m  f y  s1 c Wm!$ > ` Z P h m  P  , PW ,0-00 0/ F,0HS}  `PH8W  m/PP `1P`,0 00 0   nF,0S80L 1P01D hR  Y/o"B6 ($PM/P0HL P(04P= L6$ P! (0L&0 ($gP//P0HD H(0P D6$ H! (0D&0U% H0X UXH020H0 000H000H000H0 00H0 00(07600R 2 N *I|450S00T01=5 =50H0U <10@0P@(l6h&P n0S v4U H\aD=P\tU 81 800h (0 00 0 E(0`S, 5`( "4`4# ,,0<H080_0 PP0 0 P 0 0$H010GH010BH000=H0508H0503H000.H,';,(U&RH090 AK⚿O0\ U0` 0C Z AK'OAK➿OAK⣿)N<"U0 \0@T$X(@ `Pp  ,00E,0 S PP  npP0:0cP  ,00D,X<@DPZPKpP`p==PDP`CP4pPh DP6P'pPj DP(PpP f $DPP pPH l XDP` lDPi DPl DPb DP`Y  G   9 =lw X 6W  mDPc 4gDP DbDP` X\DP` lVDP` PDP ` JDP@` DDPh >DPd 8DPe 2DPe l +DPe %DPl $DPg 8DPg LDPl ` DPl| pDP ft gW ZP0$, ʔPP" BRPCP00CpPb T~pP  RU  RR 0,PS0P , S%00 0$0(00XH`  p ;@ R dZ`0Pr ʎJZn\0PkZ Z fU `P00,0 00 0 nC,pXjPP 0 p`_ 0S %]*?PX  0 PH B0P 4v`&6vaP!U;JH606H0"800H080 H07 00H070U- 6P0h2h2SH000H070U z`P 00`HpP؀G 8P HPVG lP |P1Ȁ0H040H030H, 4,H020U t0 9pHXAH000H000H0@00U ,0 00 0 B,0HSt U ,0 00 0 B,0HSx_ U ,0 00 0 kB,0HS(J ecBw ~ O-pУ@`P8 P P `kV<1T ЍO5R$ RZ4 ,0840 ЍOT ЍDm!H I0O-S$M04 @ 0Q`P  8Ȁpz⨠娰<1H0  00Cp0   h    "P U (   $Ѝo& dm!|-A-PQH 1`Sp51Sp:x1pS> X@H@\@hfl6S?h}@pft6S@pw@xf|6SAxq@f6SBk@f6SCe@`c@A`@_@ 1pPX@V@1pPO@X  QP T0 STl6,`0Cl6t6,`0Ct6{|6,`0C|6(@6`0C6m6,`0C6O-MPdBbX@ D3&7 D000 0000 0606}/ G000 0:00 30000% p dg +8 0 D 0l0 D+,0 P#Z 1H0E,>P0hl6 (8xP,:؍<Ѝ80Д$080,CaP(/p,h6p2l6h2lt6囗 SJp,p?x|6囗 SDx?0&p6l"&t6x6|6p"66808 p,20! ((P 1((pW 400000(0 00A:@(0S 0 S S0P\S @pp8000SS (38 P,,00  CP 0?o20804P0P$0p((P ((0S&0' 6 %PN(PI Z4 pPpP80,CP(0)S Yp Q0000@(0S 0 S S0P\S 00@ :0P  d h PP`(hQdqzPpdq P @P0S (P  P 0S (P pPP} 0)R00S P W400000(0 0  0q0S D:$ D000t!t!P-@ #t!#v! 8T  0Q//Q *///G-p0@0P `<P Y 0 0 `R:S@C@3@D"X HGU( HG3A-TpW0 T`@V0 H0HS @sP X X| |00 S DD0P 0RS 艖 0t! ˖ p@-P @Pp =@-000^ lu!i p@-@PQpWxu! C-`TM@ P `dp) 0 d ````d1pWp0`V& d 0 0 {`@ rdT  @TЍ00C>S{00`"P!@03@000C>Sj00p"P!@03@0l!pl!l!l!-3@- P kp@Ѝ0@ Ѝ/@:pA-@RP0p`@0S p A-0Pp`@S:0SS 0  RS* R0 `V1S* CP a 0@DpR: Q P u! ! O-A 0MTP`0 zy?@PAP@081 0S  up 0 0PĀ P P P P P P pPp0S p Ap `61@ R L7p 081#?P 08а00&&&p H0S& S% p D p L  p $ p~  pu L0S p0$0M0p T pc t0S@ 8111 r0x1Z9Vp K 3P= p> l3PG0 ddd$k幾P$ p) `l p,!p]Ht p 0S P wQ  Z T  Vp  #VpPO  PJ PE P@ P P9 X00S 2"Q`` Kp  Ep +%P B%P0 x1`$0  0p X00S!XppW" b a!<p%P `V%R  p0S0S" 0h 1SPq2:p@0~i   Opa 0!hpYp  D =pO 08! pFpP@ 1 R0S  P2 Ѝ0Sp pju! ׀ B̀   xu! r .^ ҙ ߙ  t!" %d  zpPq 3 < e G W r o p@-P@pp p@tRRA-P`@@pH0s  S  U@ p@@@dW0S R H R U p̀ BQ/p@-P0U@ST` 00p 1qP@/o@T:pw @-P`1pSMAT  p@lЍ T qPЍ@!R 0$ 0 0 Op@ |@aV 0 !p@k`P p.0S ltZ00#40  LLYD SP 6 0 (u!| u!T u! p@-PP 0S @0`0S @@p00p SU   \@ .S0.S0_S-S.00  @R"0T0 0D0pD}& @- @0P PT00Q  DP `00CS`0p S00 P0S X0X /XTu&p@-h1@SPpPPE @p .0.SSPP XtP HoP 4oP 0  .PPiv p@-@P'Ua 0 |/S0 l*S0 \%S0  L S0@/8,0)(&  #@       R0  R0  R0 R0 |Rp@ M KP d & . 5 = D O '[  e l s x  x 0(ƒ -\ lp Q^ ,\ ,@-QMM@pPYp000 'RQލЍA. !. d0h Rp`0SPE@Ep 0S:0@0Dꠄ z O-,MTPpP+ 4$ R R ,PX!@P !!!H P/ P/Q0@-0@0Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-P@`MpUQ:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  Pa70 0 _.0 I@0 0IU:D XN0 0 `TT  DSPO-`@P0p 00900W*0S T [%700 Ѝ!0 *00@KP  00T [ 00 P     @ \Jo"  & Z/Z#T [\*00 0000K@P\ZT [T [ KP|D}&v!C-RM MPLp`Hp; @:pE >Qp V=p R:4 -QpTG    0 tIp P; IhP 8I/   Rލ Ѝ   20TV002 0@I p  @pP0P@T*&p0S4 p`@T*T 0 Pp @ p   0#$$("( Ppm @  0d#$$(B(   04!c#!$c$" PpM @@   0b"!4b$#  H   .0I/P* I/\Pp$ 0S @00SP%@MPp00zp W  0\h NA- PpU@M OЍR` R ~00L0S 0 -0 0p0#0M0 .V 0 00 0NL0S 0 ܛ › O-4MX@p 0S\`d` (0S:0 p20"4ЍOk 0  ,   xp0,0 ,0SPCDU ,<\p 0"00L, 04ЍP V0 000!0   0,pBp000P!d `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  09,Pv!   5 _ p@-P@`P 0S P$`(0Sp,` P,` P  06X0@-MMP+ p P0@ۍЍ0;0 C@P ,P @- PΠ R<00\L  ^@-Q%00P`PV0 V=`V xЍp@@T   0x@ `D?PЍp`Vx1@P 0>0S *⭒P PU@P PP`/0P@-,0, ,{Q 0  @p !| @-` ,M00>0@SP  '0x Bgp `0pt0 0 0S00 0 0S0S|0@0|0 0  X00Qx0 xPT ,Ѝ0 8 0?0S d0xPTZ A-`@VPPFP|P2Xpx`Eh-P x倂|"x20 AV0  |20|2@-`@MpP!  ( (X( 8p WPU@ T700@Ѝ  i///0@-M @ +PPЍ0 3"Qp 000)00Vp 0000@ 0tVplp 00 " 0hVp< p  ! Ŝ ؜ p@-QUp@p /U-0x1p@-p@->`FMV 0P0Fߍp@PF/ E9  0Mt01 0 `0 HF?lVP 0> *s0 F?^V ii@-@MP4@ $nP P@Ѝ!Q@-<0< <<0SSL`/// !| $0 /Hp/@-M @ p000p0@0M00@-P@,M(    ٷ PVp 0 00S p,Ѝ08i(p@-@MP  `  ⰷ  (PUPЍp:iC-PQSM M 3 #  }T0S2"`V2"@p@"y0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0 L00$L0T@,120@ 2nT@@D@@0@L0 X:   @L0  SXH@L0   @L0  XP ;UPPEPP@ D$("({Sp`Sލ Ѝ E XH@궗 !|   C-0@"M 0 @@ 0@$@劵p P )PP @@  0{p `@`$+Ѝ00V :0 ( P|pPh ( XW 0@T*x0V*00+T!@-`@DM pP@  ^  h!> U 134  R2$ $@0 NDЍUi@i*@-|@QM  500p |2 0"x2TЍp@-]MP#Rp PP -R Y000S0S S SS wR0S Hyp;VP}S CQRS@ 0`  x@P -$0 Bp 0S$ H Q80Sq S} S00,0S  R000@0S  R00@ H @ 0 H⵵!>50H \0SpX0S 01S TT 0St0 0 000 0 0`eRj>S S^   ]ލpRZx5@PN _ GPD 0A H=STo90S6 HM P N0$+00S%i@! @-40 000 0 Ѝ!2S/2S00/@-@@bV002@-S0@0 @@TV0002S /!G-PM`p (PP(@P. PP`Qp<00 H QpP0S p  Sp PU0S Hp Q*@! (ƴ( Rp | PRp 7/PP Rp 'P Ѝ@6 ? qB@J lBpBfB@G-@p`0M00P U 6Q0S1P    P崡 00S V 1!Z0P00 0P0 PPP0PU:000000x Ѝ@-  ~R ЍgBp@-0M2S`P@x (wVP@0 \(VR^00ލp@ !B@-P`2@Sp0$M  0*00:%440 0 0p`wP$Ѝ@-@P )@)@-@pp Rp`~B 0`( "4`#/p@-^@P T00p``0@D^"000œ\p@Tp0,R0-0 \ 0 # R0 0QRO-M@@00`1Q V00ЍP0p Q :8Q@SI 딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 'P 0 B0 ] 0 S2XL00cSc@-@ 000P 0S00Ѝ@-@ 000nP 0S )Ѝ@-@ 000YP 0S  Ѝ@-@\0S n\0\0@-@`q0a`zO0`0@-@08\F@0p@-800@P% >Q" &T0x1 RpR 0S TT0Q  >0S , p@0800Tꁝ A-p`KPr&P@00<000S@ (0? @0K0cSc0O-IMⴐĠ@`"p0 0000KC=&PP d0S  FRV ( Q  R x*Qh 0 0000200> 0BS0 *N0 360 RS00~ T2 $0K^0pC90$0Q  DPV VdP h  Q `)$/  @9pHQG@0`$Q DQV R <0S @HT360 0 < @VB0HS80 0 @(1S p0 H0S=00(  (100@0SMfp ?0E0 S dO F KP81#<141817%#810op0F07spVg@4Sp 0 HS+00@$A @@4V0@B WeV M@4S8Vp0p 50ST 0HS300k s 0HS 7000  0 @ ", 02 S3 h6 ,0l& Rl Ip0  0HS20 0 DW@(1SWVp 000DKPZ*0W(1SG(, 030 PV:0BSTG  ,,S P R:(, "  PV: ART#  ,0 00D0C00s W00HS90 00 0C!41@?3S Y 0 HSM00?# ?30@(1SW`VrW08 2S  (8 "R0 PH  [:Q0 2 0000 00 @VP VpWE A5S 0 HS^00A% qA50@6S/ _``,0HS|00R Zv p6Sh@W08 2S'V0081 0 Z00 HRp P0@W00  ^00HS_t000@0D0D0 HST<0 0 "  2V0@ WeVb[@Q0000 00@y0 0P0"9s ޴0H R*0    @c0HQ0p00S0 $Iߍ0  000 0`r0, ꙝ cSc25 ?AН 7@-P\ R&@iP\0S x0x08  Ѝ0PP @ 40p <Hc& ̀!T0G A-PR1!#@ `wP0 p@ R1 0R00 0N 30 0 06P0 0:0 00,P00;0 00"P0060 00P00ЍP 0000t 0 00p0 00p0 000 ـ!r J 0@-p0i0 MSP`$M 1 !p aKp@0S i p ۍ$Ѝi@ 0 cPp  8QQ050 00{pPg!P( U u&$Tl ! @- 0080PP `V@Ѝp0S C!@P  00O-IM Pp᡼PHLL `PR h!!@P0IߍOn#0,0-h#600 0-400` 0 p00,0 PS2 V30a2@0 0 ,0T:`0 P :_@PIߍO`@:0 Px VT` 0X`0Tn:0 4`e:Pꚞ !(@ P ž O-@pP`QP,b尠,`2S$P㘀U`,@ ,APA, Q 0S ,9 A P,`0!Ϟ מ RO-00!`p@PT:p T  X ⢱00U *"0 p Ѝ0R0  ☿ @90 6Bp  9  *Bp@h Ii A-RMMt00@` PRp0F R㼀 b00 pۍЍt p >p @ H9 Ap 00CS(zp@- 81SQ S0 00 0_PЍ 0S 0# O-04MS@ h@@ `0P0_0 o0 00 0 2pP 3 00 y0 'pP3 0 0S0@0`ۿ00T0 @P0i 00 0 `P` 0 $ ( ZXXpP  ,⽾$(,8 6P`@ [0!P*"0 0P 0 S$)( ,⎾p $(,8  P@0Sh0` 0h0  f0304Ѝ$ e0 kRp( ,Xwtp 00 !0 pPp @ kZj $@ ,<,0pS AP@,0$S  S St0P !R "R hp( $,(),8& P@ߞ r O-P0M040@p0` `2##pp#ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,08h0噇 8l6Sp,0l0噇 p"R000, 2hvSl~l6S 7 0h Cpߍ00 `2$\p $  0 .p 00 `2(Jp$ 7 0 p $7 0 p(7 0t p#0}0,L04l0 440po#0n@0"04,0 40p`p`pgpn,0 !P ,@ 0,00lS  R, `"UpP 00H1,0,0H0 p 0 Y00, }R0S 0001P 0I p p  0,,0 !P !, `"P ,0 0H0p0  0l,p  < * Q i @x p@-PUp@0L0pp@- P# Mp 0` 0 ` 0@AHp$G@ Ѝp ` 03Hp )X` 0+Hp  ;00; U100HpO-`@p 0崀SPM$H` c000 0 0 `00`0 0 8Р 00 `  $6  0U0004H081y pHЍO<0 $6 4;000(4@0S4H000s$8040r6 (S 7000800S#l 3o840S'0l 3o 40S,d0S) $0P%h0"C6 00DS:l 3po 88 S0l 2ao 4$6 00H0S0SZ h W 0R<0S 0Sh2d2H000s8040 PD24 P028 P20 804 0@ 0R0i }0.0 0 p h` 0HP  P0dh0Ѝ0SH1H1 P0 (dF08    0S  0R`V >dp`bЍOtP 0GplpЍORꊟ ͟ ԟ ܟ ??  V $ +\,(9Ƞ   B !I A-@PT R0A s0p8` l0 R 0i0}P 0S <0S $15   4`0 F ` ``0Hp00` 00`8000  C 00 0$00A80%d0h0 O-0R\M@pĀP 0#P X0 #3P 0 RT0x` pp hPP/ eL`V` `@V@`#?L`}ZoF`^P X0 R2 R 0PUj?lk T0=d0S  $ P $[ <Y y' l2 0d208#<410,00000<00@0,0D00 <$P(P Q48pLPPPTPH0mDpa :NpZ 00PPP  0x 0'x1 08#<48#8 10 E00@؍@0p08#<4 0P10 0\0pw º04S#1S0810 - \ЍOt   0S @  0\Ѝ7S 9 !? zD\ CDC ¡  *@-`@pP`0 h0X \6S R @`00 < ` 3 0p Ѝ@$0  ǡ 9 p@-P@ $p E0 00L0p@  +p@-PUp00CSp@0@ $3  (!00=0L0p@+-  {L,p@-P `@p6800  B\000D ~0<0L00p@8 % F j + Q,A-P`@ 0h 0R0P3 081HAMp` P08!(0 ArP h    eP)d0d dO 0d 0 P0 $Aꃢ J l! h00h0 C-p@ PR0  R $ RP508Ȁ `2  i@0S PP  P0  lH81pppP( p"(1* (> >Q  0*)   ! ЍO|  ЍO80   0S 0 00 #QA  $  S 0 0 00 R* $p050@00S( gP pQP#  ᨶ00h0d0h0+ 2 R 0 00 0S:ЍOS 008000s  i pPqp 00 P R  ` a0 00$0C40 040800 080ꠑ0 S06 PUS RP  p x Ѐ& L0 :P8 ЍOD`0 l0 $0  7=0S 0S 0 S&$q0  '/0 <`0  @ R |0@ ^ЍO= H0@Ѝx!I ׀ L b !v cSc |1(90p@-800@P  Dh00h00L0p@F i^ף \/0S/08. / d R  0R/ᬁ O-0M0000PS`@pTQ 0 ЍOy> R*E|P 0S 0L6SDƛ PƛY  S/  pH!  Q  0 S:500 0p00 0  ЍOK Y 0 0Cs0n0S0 S0L00 0!p 0 # 0 0 0P0 <ZYA060@ 600 0p0 0 f G`P  0 S 081xiy@`6P :P0S0 0<S<0P0Ѝ0!0 0 # 0 0 0zP 6ZY7Z00Y[0S0 0  Br~  Brz0 tl00 0zP0 RS0KSK?305 % 060 Y0S0  PP   ЍOibi0  X4@Y Y0 $P0 0 0 Y  0  3@ $ 0P 0  S 0S0@00 $0DY<0<0818 ?  ; 0 P0CP4 000а 00 0 ]0P00 S*P *   p @ 0VЍO600 0<P0 00S * eP  p嵳`81 000H 0 000 `0`0A\0S   0L! YP 0 8 R @ 1ЍOY Y' Rr   0 P0Pd0 $Yk 0 =- t ЍOxꕥ  @ W s * ͤ   d : ! *x+T B q A-h0PR@- 0 DAd0BS`pbp ײ0 Am$ O-` Pp 0䐠x1@T ЍT 0S R T0S> R *yP  0 =@ G-(M@PpkP Q0 (ЍGPE ŚUV`0@SR ZO "448#8UH:`aVD0UA: ⶲ1#ĠČ Ƞ,Ƞ\5 U2:1 S/  0$    00Pp   ┲aV Q ppQp%  !V ,  L(Ѝ "448#8 C!B0.ꞁ! . @-` MQP\@M  0p000 sp 0S TH r ۍЍ 0Q`V \@Tq !$TA- p`@PpATPUt, 0 HAT0S 0A\0S 0A귁!K A-0 ;M0M`pp@P @ p0寱0<000C$00(00$0C,00@pV004p8  XXU0`$0 0><p ݍ0Ѝā!q   p@-@PT  (@x1S0pSq /<02p )<02022p R Rp07@-PX0D @P 0S$ >0P 7P7;00@0S02700000 0#0 Ѝ0@}MPa@Gcb 00 F@ 0 Ѝ0zDn 1p@-@P0( Uph0Spp@1O-@`PU Q Pd0S  0 <*[0(d0 V ЍP0/Q 0S 0P U+  08p|0 봐8 R0, 00C0 l0800<0  MP`00 0 00S $0 pWp:#<0 2 0 0 R0H0@S 00ppW\0H0+H   p⑰00꒦ ,0`( "4`4#S /0 @Rp@-s00p0`PQPE@ ` @d@$,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScO-` x1@TMT. 0S pW$ P ⿜ ኝPP@0Sh0S d0S|4|$||⥜d0 0S uPPTЍ|0d 0|00 00|d0 00v090 NP 0p8+P P 4 & | +PP$0 00 &PP 0063d8/dX+ PPm "|0d 0|0XxလU  :0S P 8 P  OU` KP < 0$Q S "  Q  ĜPp h % <  hpP@ t0<0t00 00 80adxQY X ᐜP ᮜ  U pP ❜ĠZ 0$8 0  h % <  $~0<0|t!* с!*6 c p@-P Ap`?01S ;0S 70S 30S  ]0 @T 0Q0 PSP 0U d0S0h0d0p@ꯧ !T 0dP/ (0/00 0S/p@-@T PP@0p!G-Pp`P@Ѝ0E @P00 4i@P 0P000000 000 ((0  =/$00 pPP'0 喿p0S p0 9P  0@R 0 0000@@!h _ʧ s@-@0T  PR8 00*:SR h0S QH`Ѝp$`  P (0Q,0Q  2 `P k800000( ,0CP!0S  0h dd0S  $0R  0h0d`0SH  0S/0S/   O-MD08PRH 0`xP00ЍpP P٭0 X@ XP R R R0 00Cs @ЍOP 0S4Y00 0000000Cs ЍOn4? @PЍOľ p    @@0 0&0 . S !h 0S/G-P@M T 0p `x\800 0@0 0 @^@ЍP/@-@TP@A0S   0:p@-@PPP 1000p P& 00p0000 S0 @00:S 0S @\S000@:S @P-D}&0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/Pc& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO4E`VK `0P0E@ 9 PP 00pCލ Ѝ@@ ;04pW p40(0= yP  0 `R0 :R`00Fd4@0  0(880P4 PF0 {0S 5O p PP ;000P>p 0S#0 0 0p8`@[ +  50P R 050SJ @@ 50P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ c5G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S 5 낫 00,  @ ` P D,0i  e,0@PEg P0S 4$ D0A00T*y PPR 0PP-Pc&K] @-0  0 Ѝ@-(@ P c0 0P-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ {0Pv Ps @ c Q0,P ލЍ {0P P 0@Pc0 PP U L,P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  P-D}&HI p@-@PDp@NA-`= @P@ d# PPd fw 00@^S0S:S_ p0 R0S@Ad PJ] \Sp0S:SH 0C^ 0@0LT1 0L\0TSpASBC\ lLl kDl4l k k k k k k k,l k k kǤ0`0000, 0P0PMp0,00@00`o`L+.pp A>0t@lTllH0SpW W D9P ^/P 00PpXA C9R񟗈ꠃЄЄЄЄЄЄЄȃЄЄЄЄ0ЄdЄЄЄȄЄЄЄЄЄЄЄЄЄЄЄЄЄЃЄЄЄЄЄLЄЄЄ0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0ӣ 0  ;/Q$0`S #0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 00C-.`| ڏe,`PPDAލ Ѝ, !H/P 0H0L\-Q Tc&;Yq b |j@8!\-\-0H0S/L\-0Pd /L\-A-HAP|0`S@M*0S'-0S S f-0P 0P@ @Ѝ -pW*P 0 000Ϗ0p .p1@ E`0p X0 T7/0S 0SP 0 P0@ЍA誏L\-\-Tc&OU G-\qPL @0P12C001b5R 0 0&0S  -h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R00`0S0PS &0S,P N,@GHL\--!\  0L0#0L\-@-p0M  L0@31 ^AP 0C! 0ЍlŽL\- @-L 0 0@11D ^Q       L\-A-Db@0Mu L0 @2# p PW%cP_  Bc p\  Z$0 HD@,X#10000 2R01   0 0S0" V00 S C ЍA X 1(4/00~X1威0 ᒜSV Q`ЍQ0S ⃎ЍA}`\c  Z㚠 l@l%0S Z 删 a0@0L\-!C-Q`0MS 00S` L@P: 0s%@Ѝ ᲎pᄐW   @婎 Ȏ0p0|0S0S %@Pp+p00FV@@+P 00T p@͍p\`W 0S:S* p Ꮞ0p0ppL\-\-O-`LqL1P0SU$,@T,P@P6 h0d 0B1 `P 1ʍh L0C R P!050%Pd @T: K 屍0 p[L0CY1T*Q@@L\-G-QT0Sj:\0`S& 2 c@Oop @d(0d$00@X1 0S. L0 P B I %Q * RB  ፟0=408@S 1:X 0p@D7C 0p03 c0?o< @@D@  ἍP  ڍNP ` @![0 a`2!! 0 00p10PL\-Tc&A-p0@@ `P PP0`0P P@l%Q *0S  L\-$00S:@-@@WL\-@-PP` U(0SP@P )@T \0@!T0T 4/< 00'0S 0 (( @)ЍpL\-Tc&r j@O-$M@PpD00T0SdS )@TPY P3@H3H 4/Y(0S p0dpY`WT0W @p pp0Yk0 # 30f*[`C`fQl: L@P7W KL ) D2 10Z 0F30 %0S6*0S  u0@P1'0S 0 0@C)$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@W0 f`[x [`K``fpP @P0p0 KF K0`F@  L @ދ%Q *0S  @L\-Tc&rԩ j@ \-@-M@pP,aD(0SWTP )@T: 0@0 4/0#880 ᥙP0U6@P  㿝'0S 0 |( @(Ѝm@P %Q|0S0S P 00L\-Tc&rB j@O-@QpL$M(0S@ P u`(W +0PT\\0T**P* 0`0  `?oo 0c `S, `P T 1q*᭝J'0S l p@`3($Ѝ4 T$P030#P0S X 200301S%T#2QZ E*0T00S  D-`P 00P`P0 0#  0|0S0S @ @p咊,z`0<0 0 'p`  Պ`P% 0   NJ%T#2QZ J*0T00S  DٜVv 00FP )0S 00@,0, 4/`PL\-j@Tc&\-ro @-L0@'0S 0 00 0'T Ѝ@ЍL\-j@G////dc&/dc&000/D}&000/D}&000 /D}&000/D}&000/D}&000/D}&000/D}&000 /D}&000 /D}&000@/D}&000/D}&000 /D}&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/z&(0 0CS0 S Pm0 /p@-P@,`1Pp@ Tp較!0A S010//ἃ!0P/!R/P/P/Qa/P/0000 /D}&P/ 0S S//@-@!ܛ000/@}&000/<}&7@-@PD@P 40R0PP80 _ Ѝ0rch ª v&PQ 0S///c& 03P/3r0 ACP 0AB0P CoSPS//00S00/N"8}& 00S00/."3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00z Ѝ0S/1>3 !/0S 000/\-0S*p@- @PO P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!ԁ0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ\-A-PRp `@P 0! 000A-@Pp`0 SW' WV00S񟗋꠭(((((84خ(((((( V VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"1 21<0S 0R0PP0S! !x000S!!!,p (gM0PA , (0 ,Pz&@}&<}&A-Pp0 R*S\ ]\ t`@BX T 6PڊP`c& R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00\-< 08 C800/`Q'Q!//D}&p@-P@0`᭓P@@p TpА!Q 010//А!,1p@-0@S0<QP 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`z&@}&<}&O-P 0R@M 5 P&  5 P 000Ѝ 0@  KLPP ЍO 0 PS@ ᷖ 0 00<00S*^Q000800R ]R00-R Жv0S* ]R Q-R\V0]Sj-Rh0 S{:0S00L6000S8\ 0000060S0(B(RcS ,0Si40Sf$0Sc<0S`(0x\ g 0(` pc0@`F p@ 9Uf 00C0a-R [RQ :R =R 0`S:  ~0Q00pS0p000-S]S0pS0p0x4 R*000`BV R:0pS0p00 S>*R; :R8 ]R500?  0` `BtP┳ 0(S0<B(R$ ?KP    nP  `$0  0$ 峠0S00pp0Q00pS0p000-S]S0pS0p0= i R:0pS0p00 S*R =R ]R 0S0 -RB Q?]Q< -Z00  V1 0S. V0pS 0p00S ,Z00V0S Z4 0JP   `hFh400!0`Რ40 P0S 00000 P  P (B( [g 0]S~`Q\08C8 0 0 EB#ЍO  z&\-D}&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@D}&@}&<}&C-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  lHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB Ht h ? 0D OX &(  RPSxPA4#X z 0   000`020%U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP  B   B0   B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S X^0<0S 00$000*Xe .X< 0e\-)>{^ ]D}&@-0@``P?Q $0A  R S t^Qn [Q \Q 0S Ѝ{Qx |Q 20V:0S00500 @0` V1@`(P 0 S*0)S  )o V 1L  0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030 0V:0S003000 <Q >Q x`P  &  R  #+S  *Sg 0S9* *B?RP {R2 Q/ 2000( <$,Pu 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   _0 S*}Q00 0RX}QR  Q +S ( 0  BE  B   B09  B~?S {Sz   B0'  B 0  B  B  B " A 0000S 00000\-D}&^ ]0S C- `M pQpG ʄpL@P 6W: ЍPPP P $PPxP @xP0 uPP 6   00|0  $ ( , 0P4 8 < @ D t^000G R:0S005000 S3:  G 0A0FP  00Q p0 P>3S! 1St Sq S <0RpQ00< 0o )  rSW S<0RuQp< 000p000Q S S SS8 S S4 +Sf >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  G0S GPR, 0E10S*YP 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7Kl80SD 0>Q Q QS 00 0R 10C/TUUܼhL\-Ee,1p@-0@S0<QP 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0UP`z&@}&<}&0p@-0PSQ@ʡ@80P p<0S P pP0@H0DH@P(00Ppp@z&@}&<}&O-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T +P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  TP:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00CD}& O-Pp`0,@Q V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. P`F`FV00@>N>0> \0C~>!0>#0 R@u @O-4M0\0( 0(0 000p 002   0 X = Q  0 R)  R # `Z X !,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(r P  @@ $ X1  RvX PYtt vb  (B( _V R  !    _X RG v@(@X 0x  v% YPt P I_Vytu xLt  _`V `R`V t@@ v(  P Px Ptv  O_XO 8@Y (@X bY0txPt- xt v  t v  (B(   _X_V Q ( X ,0 _X @itg v xx ,    R (ZS $X  $ 0` (ZS  P 00004Ѝ0S0 0x| @P D}&O-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 `800@ 0 WZR  D>sp 0 I800@ 0 @ZH  D>3 1> Q p0p-800@ 0 p$ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T rP0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  =PP:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00CD}& O-pP,@ W`> ^* +^` ^i ^O ^a pP ^o ^Y  !P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>00 E 0000S0R0SpG pGPt0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-3S SY S$ SVSc 0 F>s2 R >sp0 G800@ 0 >ZR  D>sp 0 0800@ 0 'ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R >sp0 G800@ 0 >ZR  D>sp 0 0800@ 0 'ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-P@pMD@0W: TЍ!>3S $ S S S Sq 0pG a>#RH0 0@000P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P o_QP R00 00_Q _P0 T (0B(R  T @ T P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R030   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRN RP R$ `R{ R>c0G`Z R 0 >c0D2H0‚0@0 00P0A@>c prO pRHHd\GH A T0A  HP:0a !R@ p0 A0 !RJH A @ >3  0GmP xH0 00@bPn01!># R 0 p`>c`1>3"S`F0>#2b ؀ D H0 0@000:P00CD}& O-lM`-PQ0r @-Qm   i        Q 0$R`S, 0pp WK,[ 4\ 8Y| <HZ01S0s x[RPR 0C1!S 0gt0p[Z 0000 ,@4H80‚!!!0C@T0P,5#"!0/#1(xp@P `p0X P 0@$Ѝ`d@P$$ꙙ& Q(\)\$& \(\@-PQM@(p,` U00 V Sp0`^Ѝpw`S0p`EP-00Ѝ00 r0`0EC00 r0p`0;0G-M@0p`W PV P%Y P.X PmZ PNx P4 P |jWf  uj pjV+  ij djY  ]jt XjX5Z! L Mj< HjЍYXZ-  7j 2j  )j $jkЍ j jZVY  PЍGMd$ P$ @$ $ $ # # # # X# h# # D# " " G-PQ00R0p`ᤔ00M 0 þ@P @0S nS a0CSsNU2  0oSm >xPN Ѝ5xPZ V000U000$xP[Z V070U070PxPZ V000U000xPZV000U000wPZU000V000zwPZO V080U080i0@q@wPZ: wP wP wP`ZL V080U080?wPo wP wPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000lOwP THwP " t! SHPPP PPP8`"`!P03 pP0  Vp, 0 {p@ {p@  Cp@@@d{0 P{{P{0 P/{P`Ѝ{00@O-1MM @PDP  8 "( +p C. `pX5@D;@8 (0Sl pp  ` ᰑ 00㨱$ %0!`p@ t0!0x ]P[P 0S Rr{001ݍЍk{0S 0K0S R Pp 08D<4! @ P0 0X0Z  0.0h,R <-1ݍЍ&p  FtHD    gt0@-P@M 0  PNp 0`p@ P Ѝ00 0Ѝ0@Ѝ0A-@@0s/ PP0P  02p` ``q0`0z0ppeX`p z``Y0`0z 00$>h5pC-@PCM2 /wlP4 $,pPC ` @z0003t3 0C.@ F P4D@ @Feq0S VS00 SCލpt@@0Sez@\0\ 0P@0  P@1:xz?00@rz00@3  p@-QMP4@SMY TE /lPB QP0s+ fuP IQaP 0`M2pG @ 0@rqp> D p7 ۍЍp+0si/1p0 +fy@0 P@0  P@1: z?00 p 04y0#S @y@y@-p@ y00$3;2T;2k %@:2  @-qP`O-$(X,P0p-S`@/U'W1 ? sZ0 0ysP : [#P?5# yq 42x2 zPWi@rUZ0[% 0@-DM@ P, P 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#(0`@S  R $ R &R  :6$4&60!$ 0/!!> 5 Ã111Nş P ą?(ᴕ咉 ?( /( R  " R,咜  )/,< 0( 08# L.:6,$4&60($ 0(΃ 5#111L4 ^ 9) 0()0"!/#0 0 ,僂 ͌0, 0 0^P0(0 0T 0T$0pn/`@ #)0`@00%$0S`@P# R"  " R,"2!x"$0St"x`@ `@x3p0P a:($^0\<P0W 0=R( Q( %0h00c @D0 0n"):60 0($0Ϡ! "(>0!!!0C 0 \ ( "Yx? ,`Ÿ 0/  "1? A  , , 0Y (Q0040 `@10P :P0 0<R$0h00c 0 0mX!):60 0($0Ϡ! 4!(>0!!!0C 0 \ ( Y? , 0/  "1? A  , , 0Y(  R0#/`@ #)YYqXXtWVLVuutUl'"""".%Q(\)\²`@  0 Q0z*0^s*rs!DP&T8<`@ 0dR$  \[ XQO&PT8<`@  \0C000 Q00S7PT8< `@0  0C0,000 @ 0S# 0 h00$%`@0 @0D 0 0h$% 0S 000000$0`@2p rp t t `@  0 R  0 & D%w`@D000 P 0S %i 0`@ D!b 0`@ ![0S(0S `@(300P :c 0 lX#):60 0($0Ϡ! |#(>0!!!0C  0  " R Ό "!( #Y?#"0/  `@ D#`@ D `@000 P 0Ss D%`@Q0i 000 \0S_q< 8 D`%d`@D000 P 0SL!D% & PA#RLP; R8  \Q,%8< &0dP(00 00% :60 0!$Ϡ0! !>%0!!!0C % P5!" ?.Q!Q( 00 #0BL00 h00%Hw 0C000 00S ^0 0  s 0L0^ }  C00 00S ^ 0 0@P \' R" !O-Mp`$q0lL0q0W@0 V3 0 2c1  ?80PP/ 0v> 0`0?d000P0?T0 080?4 <0 00$$%"˟$` 0000  000V @;0d0P] 0TPP dPN$`P0Sʼ Rʨ R ʰ R  0 0f 0S0`@dp?O$@T'pET0}Np0`@dp00 q v^D@D 0H080HXP0 00 PESQSp PQJ| 40 dhltxP^@S[R R00d@px0Ut0Zp0 Rl0Xh0 Rd0Ywt [,[8P0>C 0C 0p00@t0p` VP x0S p0pt0 00@p d00Pg xT( "ό R t0"! R RYv 1 ?)/!! #.ǟ/ B Y? ?.P  Pʉ 00#1?Pv.C BAQSx  \tp PpLp 0 Dqp 0qp:p0S@T`p VPy0 ?oR20S(p00ߍ 0 pd@qp@p 0Q   Q+10!pR@"NSp \TPd0 P0,Pd000 0  ZR 0S 00@ o0d@ `o0S0 !0X0ZS 0#0dd`` `0dP0? T00d80? <00d@0? D00dH0? L0X$\BZP ;@po0S= C-ßԓ"bY2&:##c2S Pm8PP 0 hß0dT09L30@p4Zo 00P ` d0@pP ?/( R ß&0Q| 0Z/0 #10">/ 0C!a 0C0 0"#0R"P#. X#0,lX10( #ΌQà3\!=30S 0@! B^ A 00 0`qp: @p(p=n#00n0S@@㴰p 0d0@p괰[0"c01 2c1@T 0 n Q 0  s!P nT00n0S10(` #ΌQn00@ponT00VnT00X}l_)\P(\ ףvɻ %I$@-@ LnpTat X00 R 0 R 0Q/  /    DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/` $  H  Q j.0 0#  Q/ 00Ɠ\ 0@-pPo> 0@" \ 0 /T A-@P `p@P@0% 6P PPA-\@`@P pjNP@0& P PPT A-\@`@DP pH@P@0& P PPO-P M h pP9 谟P n`P P @@ % P P0S d Ѝz T W A_  KT0p0SX A-pPQ `@Q P 0@DDB(000S  \pB@- M`pPPp) m 0 (0@0S m0"S" 0p000S0 7/ Ѝl0"S1Ds\0pT000S @ Ѝ1Ds$ @k ,\ @-@ @O-P`U M PP2SipPK  P@N P K <10`0;@P6 0nS# =^^PP00Q Q P R  \0  KB" 0 0Q@00oS@d000S trp Ѝ4 !gdb |?O-BMM@pYl@0  0SP:^PP  SPn00(^P PC @@`Kb&0 PPWp 0P0 0 PPWp \@P! H 0dSPkPU0 Pp` p}  0gP @PP0 PpS uQ P k 00BލЍP/U ` P =p@k0SQ  XPBލЍ {X0H0PP0 >Wp=  7Xk00 P 0`Xd! 0 &0 0k0<0  0MXk!0 _00'ik00 P 0&X}]k00  P 0XqQk0\0 P 0Xf | >? ? zd@P  < t 0@-@PM 0 A VPЍ00@-@>PM 0 A VPЍ00@-@?PM 0 A VPЍ00-,M 0 oKPЍ --0$ S   0/ 00p@-PWU@pj?( ( 0P 5/p@ p@-PLWU@pj?( ( 0P 5/p @-}@P 0003/ @-A@P 0003/Ld p@-P'?oU20S@ 0 0 03/p$ p@-P`1UV00P00S@p$ P05/p p@-Pm?oU20S@ 0 0 03/p0 p@-P`@Pp3j(@0 p@/\ p@-P@P p 0 0 03/p< -@- M  wp@(0(003/ Ѝ@ Ѝ/4 @-rwp@0003/ O-`$M ؄P @`0Sp $Ѝi0,P@@  4/ $ЍH$ O-`$M ؄P @0Sp $Ѝi0,P@@  4/ $Ѝ !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////h T 8  4 x ` L < $ l p ` L < ,   2 $0(- C^ 0CQ$ :$0S3 57 $05, 0$0(00 # 0 $0 0@-@$ MP#055050%A0!0%CP$00$0Ѝ0 $0R  S,3 5,07$050$0/S<3 57 $050 0$0/0S/, p@-R@pP$(ASp0$ R>3057$ 5 $ !PpO-`@VPpDM@P؆, gp0@ U p 0@P UK UK Vh,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0@V@B 0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S>3 57,050,0@q`V  FV")VX*0FSTRQPONMLKJIHGFEDBA?>=<;:98bV1 ?R20S/ 032 b0 B12 00@s 0 00Q,  P0Ç0,  0, 0Q @YfV ?R0@SQ  b9@S B88 C c3<21FV 0, 00 R Q05 705,5 0,0 5RQ= 305 7,5 0,Sf @ 2$01$0@@@0TS`VI2=0F?ofR20S00:FoFRQP Q P=V, Q05`7,505,Q,0 P,00,0Q  1@ Rf 0Sc @[ @ 0PW  @ ?RM0@SJ b9 B88R00F @00R%#jo%#jx%ju00@-MB0@ Ѝ0p@-P`M0@ 0 4/ЍpG-PRM[  `Tp~PC/a@XP @1000< pp. Ѝ80S&  1 000< pp F͌(1S <P|> F͌(Y *P}4> C͌ X Pp= JB͌8W Pc= ̌V P.\= ^B͌`,=@ 0S078 H0P `P P  P P` P< P P PP( QP PP (Px PDX PxP'( 8Q780H0x100C40S000C,0h0LP 0P( O(0Q0Pd , P `P X hU1q @a0T0 @T, 0X  p @dQYh`@0`@ 㱾P`'  V U `0P1A1S  ,000@!1S 0D 0| 0;?piߍ00P,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P`V ,PY 000 `,0匰 0[p$0p1`㐀0@@p`(Pp  W 0@0@S  P8<`@P(04 0R(0LPP1@0j0S@@X!(@L a0S00!$0P Y[TS0S0 0 K, 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  P U,0V00@ Pܰ封[ P@0㞽PP  U `X0pP @Y 0@X RzY0,0P0  0, H V 少[0D|A>`Fp1( ^\ ( `\T( \`( \m( \{ (  \( J\( \,  `,  B 08P< T$,  p , 0 H T0封1D|a=p@8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  PU,0 V00@ P封Y P@0㰼PP&  U `X0p8@ 0<X\P@U)[P,0 CT", 40p! ,0 H0T 0q1D|a#=p@P 00 0R6 (0SJ ,00p W! 0g1(0pS8 1@ a! @0T0P0 @啾T,00 ` @8L(!(0R1@pPB#0P@ T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @<T,000 @,0,0Q@@ఱ>P`p˻ PPA U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @T,0 0P @Ta$0V1@V T  0 0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a P姽U,000 P,0|!0RP 0P1` @70P` T  0 @  040 0R80000S O-pYM|C0cS@` Q 00L3?K͌ 0 00S?H`3K͌ 0H00S?pp2F͌( 0p00S|?Pl2F͌( 000Sp? 2C͌  000 Sd萍 1?B͌8 000 SX 1?̌ 0110SLN 1?41@BM@0810 PQYߍ 000Sk H`0Sv pp0S P0S 0 S 萍 0 S  10S N l$L0@-P@L0MH( 00 ,0 40Ѝ0 <0@-P@L0MH( 00 ,0 40Ѝ0\ <T0T 0  D@Q 0Q(00?H/ <|$ D0D @ 0 R ,  R$ 00?H/|$A- 0D  0 R  R' P?UH@0aaS,p10 0D C  (  \@Ty@T 00,|$0 00<<\ \0 0H0S?30 -88  D\$00D/|$O-0HS 4M4ЍpḼPH D0 0 0L|!09|@奼P` `0D0ZP`@0PZ0 T+P V@``@|:L ?3Q 4Q<  H0 00DpL |"(099`P0S R@,PR @0P 9 R0`S4ЍT `@004  0и`Ps @|`|$0 00^8<p@-T0T 00P0S @PKpp<0S p@-P@P5vpp/-H 0? 00S pp0 0 S0| DR0  0R0 SH|$0 00< 00 /XO-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n ;1Q0'0 0 0 0 nЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000h l4($x<G-阂pP@M |常`P @@d2Z0 @#0 ͆BBB"`@C @@ࣅCCsPV C" pQ pL 0p R] @B0 @@@p(P: 0 @@@e(P/ vp+ #p' p0 @@pQ(P  &d 000S :3S :ЍP p[B2T @T`^`Ѝh0S @pP_480 A-Z`pPp F[B2S @T0P20000 R A( A #@-dQ+ P@E0`PM_  S- 41#0!!!!v : !' !_ !| !o ><^p!* p!:! f0p Q R 81 R 0SЍQ @0 0 0Dl0T0Ѝ$0@0l 0̃ S/ᜨO-D@p`ᄤM[ +?(p($W 0CS0S43 P 4 0/$ % 0:̓xsăH pß|x8tdX`(PrHhÃP@弁8x0,($  @2101: R 0S 18p10S pWЍQ `2 0 0CHr'>ppGl`( T(@ T (0Ѝ>irp<d^av^8#[:X0'U#Rz #NH#Kp-H-E`_B|?o<p9r6y3z0{-@|*h}'`apx 8 ԩ!+!,%!-!.%#0#%of&i`"%{j%k %l%m<%nq%t$%u4%v,%w%x~#p#rd"ye"z|@4p@-,@'^@k( @LTT(PpؤO-`ܶ6 6M000ƟJҭp6 0000SVF ) p 8p PP[ O p?P4S S S|V0S"pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;06 $Q B q 0 ;0 'pP.4 S S040S$ 004 0r0  cR$`S 404#` pse0  ;0 p PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0SfpP 0@  ^ $@ `00 4S  20 zS 202#`2 p] p 0$ $P0 s 00bR40 ; 0⓶p@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100 ?c p p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100 ?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 0E-P d`4QAD ( p@-P@,0 0 P'R TT TplO- T 4P8 `0$Q@DMh v :Q{#R3Z 300S 8 0CP0@P@P@X@-@MP @MP CP-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o"(  O-00fS`PpMvpJP U0 pr(ʍ"(0I"Rp 3S(0$00 0+;PK ᐳT!;P ᇳ 0XSX%$ LT 0@50 85 2P4S0300SL p0SI 4SC 4S 0d$V、匑Tp"2 =PN 4p2Z LQU P P YP -*oL4Ytx2 PY $4x2$4X|2 Pm 3|2gЍH5S4S 4S0?o20 D p$l h $ <%$(lX LP Y KP Z KPp2?;~0p220P_0 r("(0H"Rp7XD  KPZ2Zx2X  KPx2?;~0x2V  KPx278x2Y KP<2|2Z KP|2?;~0|2V KP|278|2v1S05 4S1zL%R.pZVY  KPTx2!78x2|"ZYZ8PP!x|"t2OZV*  sKP%x278x21|29p2Z<  0 tlh Q, Tt @G-8S83P`@PZ 80$ RG V ʌ3S23pSoW " Rp 08 0(00P 0P 0 00@000480H000\1 P``P ` @ 〙P@  T  @`` P0CZ``(``@ P S00 0(0 0帡K?3$0 2[00Z2K 0STP- 0C (\00C;000T ,S  !(0   00C0X<Ѝ1Su[` Ph  0 Z  (0000 0P0Q00 ZUZ00T0[(80 @  0 0000 JP 0   0T S00 , 1 @01A 0 0X0 X`@0 0T0`F[ V@pV Gp@<Ѝ  1 AB ?[0@p`` @`HLP,D |帠8p@D 0Q H0T0Q (00^00Sq H0@0 L0 0DἰD 0R`D0|0pP  S,01@ 1A`pD00|`p0 H @ L Q Dm1S J0 (00P0 080 f h10 0S0-0 80 W %0/0 p@``(00P01  (C\00C00 T0,R001 @0#80 00 0 S 0C`C 00080   K ꘟxO-P,0M 1H`  06U1 0p @T% PE$ `p0(@ U 0_P0 0@  0@60 Ѝ-,0 (0 M0 Ѝؕ<- M0 ЍC- M0@\P(p, 0G`SLQoJ0 m@0@"@b``8 ᚚ 0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ0000 Ѝ0`00SZ00X0pXP@ T0`ER) VpPpV 0 !pP0   0T S00 , W1080 000 S0C`C80  0(7p@-`@P pp 0p@- M Ѝp@-@T T  M` @P p 0 Ѝp\<\0\0T   81S 1S @0<@0/6S/<< <0 0001S 00 @0<@0/ሑ<P0P 00008!R !R @0<@0/6S/8,0, 00001S@0<@0/ؐ\0\ 00 X0:20(Q Q @0<@0/6S/ᜐ<0 000@/,<X0:20(!R !R @0<@0/6S/0 @ /80A-p p @P` P D000T d$000S0蘏x@0@ 00 0PQQP0T//<80A-` `" QP@qpp PeJ 800PU ! 000S0蘎x0 00<Q0PRPT //,0, 0000P/P/ግ,0, 0000P/P/PO-\3`Q0 P#@ PU <#00SPH0(SPVpP0FP0HS`HpHW, 0 ^  1  !!d4pGPI@Yep0S a[0q SV,0 0D |000 P0pP`fo0IS`IX`a,1 \  0  !!4pW`Y7p0Sa-0 S*,0 0D | 0 00P0qSpI PX 00C 0HSP 0YPY0 0CPvYTXL00CS`LTY0IS`|0 00꜉<p@-@PpP`0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@///// ///O-1!000, S 1H`?c`` APD A @ P)@ 0@p0@!qW0 8 0| 0p@W0 0Cp0 00P<T0 ?o2R0S P (1  //4h4-(^,0R0^Q!R@O-A1@ 0QM4 P`p, @p 0S" Ï#SÏH000C  ```P  (0R0 (00000C00T0 03/p 0PS@  Ѝ3d3(2(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0Pq (0@SpP0@-0^ @ 0 Q@R01O-`P M@ VU``D0S  00C(00P00 T0P 0 S `&, 0 SPp0SᴀJ`Dpᨕ0 `| 0hpP Ѝ 0 S RR Ѝ,P e,00P 00X p  ``F , B,(`aaA0  U p0E`4P  Fp`,004@ 0U` p0EtPT   PB  0SQ 0 0PC 0$ 0\R <PT 0 BQ 0C R G-l@P 0Sp: P PR E PPQ"X P ` `R F `0`SW0` pk 1 $p00SC PEPUP0`F`V`807`PL! R@! P5 4! R0 $! R+  R 000U/Q0-P00` 0S0  0V&W Ѳ`F`V`0 @p 0 $pXP\0U0P`W`V`0PEPUP 茀<(PQ8 0 /$ $\/ P/}PQA-a@`ؠ1Pp0$ TZ 10 0 QT$ D 0R U ESpM D10 0 QT$ D 0R U EAp; 0D00  Q P@$ R U E*p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q}<(PQA-`0`p0*Â@$ PP q@D00TU 0Q{P/ 0S, 0@- \$@T\8x ƌ8 t @,0A0@PU 0P0U00 S00/Q?XA-$@0S00â?P2 0\-@ 0T `ApB 0S#0^ 0S0X F@@ 0 0 04@U/80Q@0@080/A-P  0 BS0@( p`0,,0A0C1!0 0L0`S@( X0@-8  PE? J0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M4~ڌ`ۏ@Pw 0㈰(ӏPp,o PP0b Y4& 80!S0` ``pX08 0 T``0a$ <@0H0|0L P08 0!\08 `0d0h0l0p0 Ѝ༐P4/ 㕏P) 0*Q! Q80 SpG V P  PʪP Ѝ ᾑἑẑḑ@ᴑ A-0QM@PP(C p`QAR   B P1 \.X) P$,PBPP H0 DH00R00D p0$`P!b@0SЍPЍ|u@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI 㱑L1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @s|$(0@-@l0l 0 \ B/oM "0  mPP 5Ѝ0q<@-44@M00 RЍ4qQP-D00M  ( @0:Ѝp8 /00@-MN 0N00 P@ 0 0E DЍ0O- 0<000DH00 RJ $@#<000h0S80@0801 H0$00 S4(>( P0@$0, 0!0 8C8PT) H00:  @HDHT,0Q0 $00S2H00Se $  R$ ,D  HD S400,01  00Q 0 0P0$0AQ0,S$00,0,1 0000 S 40p0HL|@0H00D00_p 0SL01H@400 0,00006,00 0Y0Y> 00S 09` S0F 0R4000,00 1 1 01IY0Cڸ/o<"L\ R Y@L0l00PP 0 0 SP P+0 0S0R0S 00PQ ɟ`V0 0CS;  S<\p# 0 AS 0 V P0P ` P R  0R_  `9(00S*< Q0C0"  0Y00S3 80 v9( 0`V 00P0 0CS 80 @@ NN Œ Č Ȍ N LL\80ɟ`V8 L0T T<00D R 0 R PP,! [R  [ $R  0E0 p0  0E  <000$R ( x7  <0@00!R ut\ 4000Vr0 0C B 0,0$ 0S$000,0 0S(00 R, 000:3s D  RD  K@6( 00S70X *1h"0U( <60 0 @ `40 , 0U Pp$t000 @0p 1`11qW 00S<00 00S 0X *1h"040V @ 50S 4( 0pQ0A'0 0C02ꔄ 1C0K 0 S P 1 11RY@Z1P RRQ 0    #( R R$ !#`FPA p0p`P@ !?3 pGWaFP `/0 < p  L  P 0P0P00 PP0P0D0TV H00S $080  400  H(H20 p`\Ѝ $0 0|H000S1( 0<000h0S$0< 40H00 R d1Sm\Ѝ4080 @0 80'P00C\!H00^ʟ00@ 0C8 08 0 t0S7 p0( 0, QA@` `4! ,\)@XP p(Z(||l x eppX@P P0@, QJ   4p@,@ APWp@PT ```TPp P @0`, AV4TDP q@DH P! X @   \`Q  ABQ`P P4 BQO p @ p  ,@0 8 R pP p , [!, !`k @@[`c |P p0 WPb   Q   P p,@08 P LPA\H0$00@`0`, Iy8 @A[0,  \ `$@00400  ]40Z0 pWP p p P  , BQ 0` W G 4 DP @P | 40@ PL0Y0I D|  p0UpP:W W@ P ^@DT GpGGlE@P0 0: 40Rpp0,@0C 0B0W,0P 0pp000E,0e PU U R0a R  W R RR.0 S0@Z 0 RAA 8 LD@ ,　H@;"X LD 0B0 B 8 B!!*" 00C0U40P0P,0a0 0R0d400,@\@ `*`vQE RB dP?  (<P d1S ( 7 % 0E0p0 0E  <000P |8(  <0@ 8(0 [ 0,0 0000S 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  9( @` 0 `U( <`@0 0PL5S 0 0RU d>( <@0 0Lx0 00 "<000G( >@ b0 `C0`  <000tW . L0 U<`? 0 0L<P6Pj <00 p-U `ʕiH5Sp@TL 0 `P@@U= 8P8P ` =` 'tƒ /A\  B\  ^tƒ    /$1P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/T@-@P@M&\\ Y #3t P P 00 H000 0cЍ(p`P -P\P Y͌# /`@-00  |00S d d0 8=0!D00 R L$@-4!41 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ !A\   0$ 0 000:h/p@-@0@`P0M*l"R R`   P H00 040@ 0 @ &Ѝppp02C-00$RSP@ M "2` @  "0S 1#{0 Q  l"R. R !`@ '( v@ Ѝ1=00QM0SJ\1`20$L10 0?0剑Q:20t1=00Q!0S0`20l00 00剑Q:20h00 00`0`Y0!Q 00`M0!Q ,p0 000/p@-x0x 000@00CS0 S 0 S P00( pݘP00p@-0CS@0 S 0 S P00 pῘP0p@-,0, 000P5y@ pp@-P+y@ p@-|0| 00@0J0Q P R, !Q0000,<0JP\@-\,AP /0S/ p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0`PQp@ xP 00CS 00$ЍIɟ,0 1A!R 1A0 CP(`V01H1aH1PwTPP  `FTPE  P0 00?3[0P`0P` &uPPs  U   Q(0@ SCIP@C00 (0C\00C (T0 S}80 A  w(1 0@80 @D BT fp`$Ѝi_a X@ @ Pp D0|0up H0@D002 T `V ` wV `7` pP @V``0 00 <p@-@Pppp@p@-@80800P  @ppp@D <O-$6dM0$00Q 0x @pw`PuQ Pft0P0K W 040P0[000P0@SWL9.SR`0XP0P00PEPUK000 00PS0404 00 0`P0p @R@+40T R80 % 4 uw$ 400Pp WpG`0000C?00_wP`FZwPH` 0p`0 PP Y 00 00 E 0 4,QpQpP Qձ,pp( X4 R!! B qH" R~U` pGUH04 S0 0 P` 4,8p 04,0@,@ 0<8PU 0 4Q00C z 00 Sb 0( 0C0, Q0 00SPl 0006000C?00vP pGR0H`FivP 0I p_ v$ l10 P 00  0危 0 K00000p0E!q X{ 0H 00 0ᰡH X!D0|0pnudЍ004 p` 040T pR0`40 00 0P} 0KPPu%dЍ`Du 0 00 h<p@-`@Ppp p@Z X00 P\<p@-@Pppp@ Cp@-@@ @  `  @Ppp p@-<p@-@<0<00P  @ppp@ <p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``LO-MS D@HP 0Y 0p`@ 0 0[  F4/ 0 R = $R0<SX10000#10#.Q00S0> %P 0 0@0 0x00 P  0H8#8 S R0 0??P4/[WЍZ  0H8#8 S R@0刀0!pP4/pW@<Q" @-@ RM !R "R pPĜ\  00@[Ѝ/0Q " @-  MS S PpP$R (@2Ѝ/-4M0 Ѝ @-@000M, @Ѝȵp@- 0B\\@S ^\1  @ % e ,\'\ { d"LB!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\ "0  {  \ @ o% d  + {o\\:\ { c@QO-M  p0PP 0  &  0 S  s `\@u,\    @ \ .  QS%\+ L GRSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8   RWrX 00PЍ%@ i\@ @ `f` 00#1.Q0*Q 0S k@  RP %p0@ %dd\  @ @   RP% p0 @%@c  RP p% 0 C@ @%+@c     R} 0   @  Rj 0   @TY @ꄑ 0 0   0 00< 0   0D @@ @  T0 S\R [$ J00 S $0<  m0>/ 0 0S0\S 0 S0 000<Pp@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0|A-@0MS0D0@!0@p0S? ` 0"1Ã!1P!1"b2cP@AL0L  00210B P0 pW$P@WP 0fS PЍЍP 0ЍNPgA-@0MS0D0@!0@p0S> ` 0!1à ‚P P@0!0A1 0120B P0 pW$P@TP 0nS PЍЍP"0ЍpkL>C-@0MS00! 0p0S2 P+ 0D!`1H $@0   0 1$  0H $$N04!b1cD$!b1c  H0N 0 00ࣀ((!h!b∀C P㈁ 0tS0cS0S㸠 0 @00 h@PT0< X 00k unNgݔkL\>-?L*Std A-@`p0\ %\0PpS sS lS@ 0\TTW G 000P1CP0@CV` 1D!6 00O-餮pQ qM PP- 00S0406 `$   0l@H 0 0S1  RS G @T l P p 4 @@T %T@%T400 R,:PmP 400P,%0p,08=0,P0(-(͟00:T T) `DV%?#"< / XT c`D`Vfz t``` 0`DHlQ 0>T-0p0  Tg@W -@@@C?T@^ >Tp A0D =R=S3t 1CYbewV.`^`0^@ C @00! D 2d* R:0\'TOP ͍R'R ͍T0   R'R'Rp@@pI@[jP 00040jP, 000p^ Q1`!RZ 0BS11`W PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#{1S 0C-11@ Q 34 00`Q,]*P 0 p 40P040`OU< 01 1`0@1O1S  0C-11@ST 400 Q,%*P  4 @@8AT @D=AA0@a DQA DR3@D1@ؕ% R ?R ;RM  pR 0%R 0@a0D RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP OU6 =1 =10@1@10D R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@pr!R =1X@ BT! B4 Q`!`10` Q,0*S 0 ܉p 40040@L, 40,qߍ! 1I4 00@QU PE=1@Q@1OU =0@01P@ Q#-1 1OS 00P+jP 400P,V 2 jP 4 0,`V ``&``VP``P``Ê`@oobP``V} `y`@vs`pQ AQ AQU PE=1!T@QOo1BV 2i0PO 4 0,0R@p00@ 0 m00 @00 ' V8`~00{0&@DQ0VT$"! y p]K5#0@0B!@DOo0B000@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/yA-pQ@PM 0S! XB hP `V! 0v0* V U~ ``ЍYpP0U0f ``U X8 0 0 R U JUlDP0S U8 5 qp 0S R 8(C8B((0 000SU00P ji0 8C8(0P ]i0 8C80TU@4^ `` h` _ ,` ht@w_ _ h^ t^ ^ 0R @-ME0@S  ЍA-pP*P U) @`TV 0PS |@P0DV  P oO-PR M `Q 00 Ѝ@ pPb % Pb Pc d%z0 ES  gP  P  0PP P0 S    P`0 S  `  0Sn  0`S  0PS  |`V$ `P nh$`%3gP !,gP%gP Y봰 0$[PP " [ `$@ D (B8BBXnS0 sS fSU/o0"S R00000P`h&h V 0@:  0S  C("(  ` P0ጲ  P 0 U W PpU 00d P`Vl Q`Fh&hVPb    0 SPW  P`U= o᫲ 0p @  0 ` PEX%XU !  X * `0 @ p0 00  PR0W00Pc0X0  0P/W  R000Qtg  :fP$% oP0(C-Pa@!`pM0  P T00Q0S@ PЍ`P + P0 p  R 0S 0IPP   PP004PЍ  0 P  @``+ P*?`PꈄW 4O-M M:S&0:SSP 0`S:Spp@F T R!*  @ 0  tDiP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`tTP) 0/SI P5{GP 0 ۍЍC;0P p! !P20 ۍЍCl%0P 0S/S TpP pfX y0gfX IP 70 ۍЍC0 PۍЍ p 0^>fYW L0L 0 $ۍЍ404 0 $܁$U U T T T hT PS $S G-p`@P  X0@fT  NP @\PPP P @T  @0G(-@-@ M00 Ѝ@ Ѝ/G Ѝ@ Ѝ/@-@eee@ee e0e@ep@- 0@SM 0  ЍpP0`0 0 0 0` 0 Ѝp 0p@-PS@:pS dP!p+cC- `@V M pPᤐ0fU@@`V  r 0W nU sU g `V  0@[00 Ѝ R@@@G- PMU# `pfSPU @ ?N P0 0nS sS .PU# 0 Ѝ 0S00("(ЍPA-P# P 00`pp0,SS00 0\,\@CbP   p`p@N  C-p M@`PP(>pWX*nUO sUF fUH0D Y)RA @cPK H0D@ pH0@0 H0H0nUp@0 H P4 sUG fU? L00L0 Ѝ@P%  @AP80W D08 400 #b 0S0008  @H0R# ,0 0fH00H0H0@ HH0@ 40 0TH0@04 H00LH04 0H040, R0 0?H00H0x= M L O-0@M0`[  Z p p(080H0aP; P0  `00 ` ἀ[`   ` p`Z `   ` ` 0@ 0@Ѝ@-0 000 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\A-`p PPU@M"R& bP !0P ᴀx0V00  pm   0 0 0ЍPЍ` pU  O-`0@ 4M 0 1P p;cpZ6 P !PKb0P  0( cpP|@P P@@1bP c 4Ѝ c b0, Y 0(0$0,0& PP@,p , PAR   0S00SPu Y  T㼂 P" b L@PXH @ D L F ,p P$fU8   0 P+ X9  BHDXDnUDH sU  "0 S   ,@  Pyb 4Ѝ y B P$ib$aa@RD D A-Pp ``V@M(R, maP$ A0` ඀G000 P>00 06 0 0 0ЍPЍ_@-0P pW@` MR 1aP 0 `  00P 00 0 ЍP Ѝ_0O-LM< <*, 0 $0`P |@P0|0PP* 00|zPzT P)P:PyP`P  P- U $0+T $0, PPG $0 P10#0 p(000K{e 0s 0P^ , P) 0S& ( .S  ROSF =<`P#7@PZ `XEXu 0n P DyaD0 0SP PC$0 ? 0S u0 @$000  00 n0 gPpAa j LЍ0TS$0   0 400 S,0'Z8 ,^8 0S!@0@SI hFhvP00$0 0f0 $PnWq ,pP@U 0 Up`e '\UQWW%P^UPg P@U 0 &0FS;{  0tP ,p80 EQE E/RVTSRQPONMLKJIHGFEDCBA@?>=<;:yl76ce3210/S-Q+*)_d` pPU@ U\%00P  @ P00@ %00    P`P pP`,_8 <04 $nP@0f  P +P p P`       04 $9 ?U  #u 0 S00P{p0pP@`80 L0@\0 00 $04 W80S0P@ `UPPpP`O 0$0 000000 0s0P ,p:@hFhvnXEXu= @0n  8P% 0S00 #PhqPQTP P0 $Z0$ ,pmP00E vPXEXu0k 0@s 0 P0P'0 $zP`_ LЍ0$ m $g0`n0 $\p$< V p `Kh8= H< ; 9 `: 9 9 8 8 X8 P/N$P00//@-M@0 0!1l!1"b2cNL 0@@0$@B!A@C0 PЍ赁Ng P0`0K?//@-M@0 0 ClB N0"0L 2<@0$AB@C1dKPЍkL>$0P00?//0@-M@0 0C@N $@L0B!b!bN?AA4 1c1cL0P0@$$C!d!b8A@C1PЍ-?L*STp@-0P0M`2@P 0ЍpZ, 0 0S Q20Ѝp8G-1!0  aP P@4 04 S0p0p2,0PP0  |Qp`  WPeȄpEQ  W| 0 ȇ0H00$dЧc@-@P ]]] ]$],]],00!R  !b 001/b001P//hb} @- M`p P0P0@0Ps P 0P Ѝ 0@P ЍإhC-@P,MA!n`Hp@\ yf"RDK8d$7$rQ>*:eRZ>t [~|iUD1Pot{Yo"SRQPOLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!   X" ;T<"!00,ЍPM P :0 00X0BP P. ~P d* 0X 0 0"P 0cP0z:0 00ၭX P 0cP090X 0 0"P(:<:"}Pi 0cP0Zh90X 0 0H"kP^ 0cP0K$ 0X"  YP@ cPc  (:孬X`pF"(9" 0SPf9P* e0cP0d 0X" v DV0cP0080X 0"8"P D0cP070X 0"`8"P 20cP0 ʨ70X 0"8"P  cPpdX  0"P% 0cP0 70 00 P88<8X"h P 0cP060 00៬X@ P 0cP03p60 00ኬXW P 0cP0 60X 0"|6"P. 0cP050X 0"6"{P{ 0cP0ʘ50X 0"5"iP| 0cP0yT50X 0j"5"WP\ 0cP050 00X" EP q0cP040 00X" 3P _0cP0Sʈ40X 0A"4"!P M0cP0DD40xXB 0 P <0cP040X 0"(4"P *0cP030X 0"3"P' 0cP0|30X 0"3"P 0cP0830X 0t"P3"P 0cP0$20 00X"_ P 0cP0ʰ20 00X"H P] 0cP0Pl20U 0 01X"= P 0cP020X 0"<2"}P 0cP010X 0"1"kPD 0cP0Dʔ10X 05"1"YP 0cP0P10X 0"L1"GP` s0cP0 10 00X" 5P a0cP0R00 00X" #P O h/ H/ / . . - - - ?, p, , + ,, + T+ * (* ) T) ( ( ) ( ) ' ' (' ' ' 4' (& % % 0& % $ # " G" " ! d! $! x | 8   t `  d    p   L H   0   H `   d   8     p 8       ! @-DT h ?0cP010 0 0㗪X P] 0cP0T10X 0"h1"P cP!AʜX  PW 0cP010X 0"1"tP 0cP0$ 0X"  bPq 0cP0h20 00X" PPk |0cP0ʬ20X 0"2">P j0cP020 00X" ,PW X d2X"!00NH30P30 2X"$!00>30 2X")"00130 3X"i"00$30[ H3X""0040 0ũX!00L40T40 P33X"I"004044040 4X"8"0040*40]40 d4X"5v!0050'50 4X"f!00H50P50J 4X"9V"0050+50 05X"C!005050) x5X"_3!0050Q 5X"&"00~(60z0608 0&X"!00ht60 06X"'"00[6060X!00J60 0XJ!007XS!00, 7" 0 PX"00 0˨X!00 7070 7X"["0080M 7X"(!00080880a@80HIP" @8X"k!0080]w"00r!00m"00}PԘԈ1!( Z!00U"0090M"00H!00S?!00:"005"000"00+"00&"00~!"00y!00t'!00k@(Z B1}P  L:吧@P 0vP p:"0S:!00J0SX !00B0Sz !00:0S{ !0020S| !00*0S} !00"0SD !000S !000S= "00 0S !000S "000S !000SN !000S !00PS 0S |!000S t"000S l!000Sb d!000Sl \!000S T"000S L!000S# D!000S <!000S 4!000SW ,!000S $!00|0S !00t0S "00l0SW "00d0S  !00\0S !00T0Sk !00LH& c@60N"00A"00<"007"002"00-"00("00#"00"00"00"00x 0)P <5"m 0P"5" 5 0 04 @@0 140 040 0wl4 @@h0 j84L0 0a{4,0 0Xz3 0 0Oy30 0Fx30 0=3 @@\0 0P3|00 '%!00}3L0 02 @@90  g20 020 0|20 0X20 042|0 022\0 0g1<0 0!00#10 0210 0gl1 @@0 81 @@0 %1h0 0\0H0 00(0 000 0yt00 0pPP00 0g',00 0^^    H  4  <    L D     D h      4  | @   8  d A-t ANL\0@Po>\DQ; 00P \QHTL a`0 ᇤ 0ᑤ46 0b0#6(7(0a` l 0v A03\ \ ANN1 0QU^N$/|2G-0@P Q0>A L `@/ƌ@0pG/p0PϠ B`@T 0 P\^\4 0C@PU 0. ^\!B\A ! QK%RL:     b3Ό2@XX 0 0幛P t` 0ȣ 0哛P tP`P@P056Q 0ˣ 0ᮣ 0ᷣ 0CYn?P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BT@! V @D 8,0400G0, 0 40@( (8/P840,0S00 40Q 0 @-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0000CS 0S H=006c@ Q,=00 C0 0,0pS P<`@@e0S 0,SV [ 0PC0000 00 0 0 0 0#1^@0Q 38R0 4 RR  4,00 PUSY,, < 0 40 30O <Ѝ(0 S0(0@I; 03C`;0U 0PEd@T0S` ;0  R S R PQ0 P 0BS  0 0C R 10Uk 0PEd@T00  BR00S  7P 0 S0f8&#4<f4#R  \:00P:0 00 80B4 R,5@0 000 000 DQ1  P !ADL B \000D0S909 UR000 0pP <`@@n0*pS0 ʈ  P<`@@ ;TUS 0PEd@00 S  SL S5 8a@D00@T6c0PEd@T ULQl80 R H0A S00 CR*ʈ+R~ D800$80LQcD0ʈ;80\0T U 0PEd@00SQʈ@6c@D 700 $ R40,0000 700gUw  PEd@T  [ !RX 70Uf 0PEd@T:ʈH ;0 H @D;6aUR 0PEd@T:0ʈD+1 0D0@D6a+D`60[{ U1 0[![4 0 0C 00  00D0 PE 0CD0 p0Dld0h \ X 0!PU 0PEd@0S^6c@D0l0\ 04 R! / Rf<500 Q 0SU 0PEd@T6 0V3 400400 C`l P[T U 0PEd@00Rl @Da0C T R=0 U 0PEd@T40F?o20$0S0h $3$&$B0#22cR]0S 30T0PEd@TU|Tj0PEd@TdUp  0t$ R R& D U1![ $Q P LQ0Q 0 ! B00  0D PE B pD R=0 D l" 0$ R D D" C$ R$," 0+0;6cD@D10 R   B0 D  010$0S  &$   0K` `@U 0PEd@T$0D`S` 0-0`@+U G$ 0R $P (D R2D507S U     0d 0S PE p000Xv =?>?N?P?s5? M? Q?H?A?L? J? ( C? < B` 9?:?;?0@\,( @Dʈ+6nM2a@D0 D0B$0S`0  0`(3@0W43&8#[ D30L3HL0  h300@S|3D0z `o0aS 0X00\03@D0P0;T0300 C3a@D06c0D@C c P8l01r0ರ^l[PEd@[UsR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0toP 40s0 (CL @n 850c@ 0`0P50G 00`_t50R|5l 0Y[qPEd@[kU 0C00Sq 0 000 (1 T*U $((U_ PEd1岐@^ $( 6cQ0D6kD @C6c0D@CaC6L0$ R&400  0s@ 7`0> 0cV`0@+KP6c@D\ 0ಷ@D&a@`7l000p 0 0P0<`@@0 $(C 0X0S>0p0P0 Xtp0(0$P$(0/ @80( &b0R0S(0l8@D0QSR: @3 0@l0$8@0@80t 0c \ p T d \ h WP ,90B0 `C40SP90*p@-@LPP80S ($03/$0(3/00pPA-@`4PP@p0 QR 408 BW4 08@QV000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0DP,040p0 x0 0 0 30 Ѝ0l0S  pl0@@@ ܅ZS???HXP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPZP 0|!(`3/@PW 8pW8  ( 0(3/pPH 8 $!P S>0R:oRS B P T  B T p W0Bp$  (08#8p@p  BS>00p08 ` P S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰX 0C0 0$SQ $Cp0`0 sRpW-0 p  p0 Ѝ0` R`V40sDJB 0|=J^S30 b6 08#8^0X 0 C∀0S 0SCXP! P( 0 ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 240%R00S020,0@0000,004@0D?o280(000 0 0 0C$0PU?PU@PUAP0UAPR@oPP 0CX2p0;(8ӗ1Ӆ1&=tPxl0fPPENAxtP N0NPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPP`l h\0S8 B0l0\000S mMP`-0S P(p00F S$0`0!h0S:l R1#P0 6SM \0P8 Bl0\00PЍl08  : RƃPƃPƃ !hP\0P8 BWl0\000SЍ(A O-pj P,MXt \l@80H00XT 1#D04 @  QH0@ ,0 DA?C0CR`Pƙ Yp0&0D8#( ƙ#<0ƙ@30 B0(1I>RP30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80X`TptP` l H 06#0H0Xl \0P8 B l0\000S,Ѝ80&6&6 &!9096tl L Qtl \e 8t0 S` R S9 Sl@sX 2`o 0D 0 4 @0 0A$H0   @`@ Pl @!0P PH0P `   @P$ll R1#\ Q \P80 B0 Gl0\0w0P,Ѝ\P80 B0 4l0\0d00S,Ѝ; O- ,0PK[ M@!0 ДP0pUp/oX" Xp zpHor 030 #4 B %B B  0BVU2W0>&* Q!M:l`\A `Fp W P!P1UP! U:XUppU`10\ 8  \ 0PE0 000C00U00\   W 0 B0 0 PpU` ,8^v0 6A,0 l0&\0PpU`l0&R65V`    R\S#` Ѝ R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 03 0  0#400  0 \0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000* R0f9S /0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH I0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 @ R}0ES IS= [S8 gS8 00S0CkWi D8 RC0SS@ S   00#  #800#"0    ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0q0S 000#40m0q00Y0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S+t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0800S=p#  #800#"0 00]*B  00c*W6F &R< \ R80l0 C;0,0|h 0 00 0000 B 0L0DC0C Zt0S*l0\06\0l S 8 B0 l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC 060@! Rppp@-@/PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ ‚2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&-M 0 0 AЍA-P?PUPb8 ` 0t!(3/@PU \!@ 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/ EO-Q M R x 0 R 0#01,#0Pp4` 0  0 + P%*0 @)0 @$0 q0B0PQ1;`,:(9p'463041 R P%BQ` 01 0 0# Q#4,!!01\!#00#0#\#4!  01Q #0P%0%| 0S,!R4T0S@S QS,T%@$@N%, AS,D$ S$, AS,D$ S$, AS,D$ ^$,00B00 R  0 0#01Y,# ЍP0#20CS!B1PpuDIpCDCCBBBA C-PRp ` P  0!\0 0#@B .P@18R0  C @$' A C-PRp ` P  0!\0 0#@B .P@18R0  C @$'0@ @-@Plp`hPp@` 0!đQ0 0#B  X? @-@Plp`hPp@` 0!đQ0 0#B  > p@-P04`^00# @L P%!p G-Rx 'xh Q RO SRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#7&c2pG0N 1pW|GpG1^NNPV=F10C>@@P  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0@0C 00 pQ80'7b"c2pGNq&R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/ဘ U/0S0`0//p D356@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-0 0@ 00 0pL0 S[Q 0嵟  !  W X SA  ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0P 00Q00S@\ R 802^02N00 R0@\<ЍW@  yP 01LX 1R 6 G2#6pP^p N  p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MV00R@ʀkf W !.⼠ᾐ5 i8R#8% P000P#406IP0cZ38#8V嫞⼠50aS)0P⸐0P%TPVAPeZ5) B("(Q1P8#8000P#406cR!0C 6V V0T@R p` PF_oRRPU RV0W RB+pᰐgZ5P8#8000P#406pGp0cY38#8 WvAP78p#8k.00P0p#406VPcQ 0C6C0T@ Ѝ+}ⶐpi58Z#8PPI0 00#4 06P0cWs8#8 UVZ AU0pX%Xk.PPP0p#406VPcQ 0C6 0g0bQ^`徠἖0`j9Y8`J#8 0 00#4 0编0iQ8#8  R0἖`2006.01 P V+ B("(5VPk.0V0o B("(7k V0&0`8p#8;O-ʀ6knS㼖0M $P  #  # #  #  "A @b98 T#8@p000@p#406 B0c^8#80἖&R @ P$ pḀn98 Z#8 0N 00#4 060cX8#8qX tq@DH$Hph>W8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಐpi>8X#8000#406I0cWs8#8 0@弖^| `D B("(9@n8 T#8@@p000@p#406N0cR#8R0἖\ b98 ^#8 @Pk`0`00@#4PP0 B0`Q8#8 k0&Ѝ0἖10἖->>>>>00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&A-Pk΁@`&8#8 R   pp "$ &bS0  Bk>& 0  8#̠  4##<V0 0 000*60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-k6 S#("(00@P P 0 #4@@06 c\  ("( 0Ck΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@PP@ @"$PP Ɓ0O-0 QR@ M, R 0p&]P+(+0N  q/ ! RH@P j   Q&Q3 "[r&k R0D 2 8#8000 #40&0bP8#8 Bk0&N.V }0G. 0S0 0xS0   0LSI>X&&&&0 Ѝ(  \ P+R +R ,RE R  Q ,^ R3 "&][Pj 0q ЍO R \3 "[kΆ 0("(1 Q8#8000#400aR#8#8 A+ QB Ƞ(,Ƞ!k>0#400a\38#8 A Ƞ,Ƞ18 Q#8k000#40缦0j\38#8 J Z㼦Y@ Ƞ,Ƞ!k>0#40缦0j\3! J`M⼦k> / ! Z! ! 缦jR!! J^ἦ    s Q3 "[6@!:!18#8x!28#8 6 51:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  /p@-@P`h0P `0P @T @000@pVpC&@ pyaratcid@-M @PoЍ@oЍ@-M @PЍ@@Ѝ@-M @PoЍ@oЍ@-M @PЍ@@Ѝ@-Mp@P `P `Ѝ Vp@ -Ѝ0@-T `0p@-S P@0 C`&0@_VT @p 0 p0A-S Pp@0PC`%0@CVT @g00d0p@-S P@0 C`&0@'VT @pK 0 p0A-S Pp@0PC` 0@ VT @/00,@- MP Vp 0S @p0@C%`UV ` Ѝ0 0 Ѝ Ѝ@- MP Up 0S @p0@C`UV ` Ѝ0 0 Ѝ ЍA-Mp@P `P Up@ , 0S P0 C@ UT@ Ѝ`Ѝ0`0Ѝ0@,T` Ѝp@-@PM0PPptcidp@-@PA$0P p 00ploobp@-P`@P  0@6p@-@@@-@@@-@@@-@@@-@@ @-@@@-@@7@-@@O@-@@g@-@|@@-@v@@-@p@@-@j@@-@d@@-@^@@-@X@@-@R@@-@L@ @-@F@@-@@@0p@-P`r@P  0@pp@-P``@P  0@pp@-P`N@P  n0@pp@-P`<@P  \0@vpp@-P0`P(@P  H0@bpp@-P`@P  60@Ppp@-P`@P  $0@>pp@-P`@P  0@,pp@-P`@P  0@pp@-P0`P@P  0@pp@-P`@P  0@ pp@-P`@P  0@ pp@-P`@P  0@ pp@-P`@P  0@ pp@-P0`P@P  0@ pp@-P`v@P  ~0@ pp@-P`d@P  l0@ pp@-P`R@P  Z0@t pp@-P`@@P  H0@b pp@-P0`P,@P  40@N pp@-P@7(0P p0P 0pgntsp@-P`@P  0@+ pp@-P`@P  0@ pp@-`P@<P pUP U Dpatadp@-P`@P  0@ pp@-P`@P  0@ pA-PZ@ X0P p'`P  P `)gntsp@-P<@ (0P p0P 0pgntsp@-P`%@P  0@ pp@-P`@P  r0@ p@-@R h0@ p@-@ !Pk $0P p:00ploobp@-P`@P  !0@` pp@-P@P U!0@Q p@-@ @@-@ @@-@ @@-@ @ @-@ @'@-@ @6@-@ @R@-@ @j@-@ @@-@ @@-@ @@-@ @@-@ @@-@ @@-@ @@-@~ @@-@x @@-@r @'@-@l @6@-@f @Kp@-P`@P   0@ pp@-P|@P  0@ pp@-P`k@P  _ 0@ pp@-PZ@P  0@ pp@-P`I@P  = 0@ pp@-P8@P w 0@s pp@-P`'@P   0@a pp@-P@P U 0@Q pp@-P0`P@P  0@= pp@-P0P @P / 0@+ pp@-P` @P  0@ pp@-P @P  0@ pp@-P` @P  0@ pp@-P @P 0@ pp@-P` @P  0@ pp@-P @P 0@ pp@-P`y @P  m0@ pp@-Ph @P 0@ pp@-P0`PU @P  I0@ pp@-P0PB @P 0@} pp@-P`I @P  %0@k p p@-P7 @P ^0@Z pp@-P`& @P  0@H p p@-P @P ;0@7 pp@-P` @P  0@% p p@-P @P 0@ pp@-P` @P  0@ p p@-P @P 0@ pp@-P0`P @P  0@ pp@-P0P @P 0@ pp@-P` @P  s0@ p p@-P @P 0@ pp@-P`t @P  P0@ p p@-Pb @P 0@ pp@-P`Q @P  -0@s p p@-P? @P f0@b pp@-P`. @P   0@P p p@-P @P C0@? pp@-P0`P @P  0@+ pp@-P0P @P 0@ pp@-P@ (0P p0P 0pgntsp@-P`~@P  0@pp@-Pn@P 0@pp@-P`c@P  0@pp@-PS@P 0@pp@-`PM@ <P pP U patadp@-P`@P  W0@pp@-P`@P  E0@pp@-Pp@P 0@{pp@-P@P o0@kpA-P@T X0P .pA#`P  EP `%gntsp@-P@6 (0P p0P 0pgntsp@-P`@P  0@*pp@-P@P 0@pp@-P`@P  0@ pp@-P@P 0@p@-@Q 0@@-@R 0@p@-@0 P %%p@PP0S {p3t0d@-$@@[2$P 0R @-P Q o// ؙ 0S p@-P`@`PPpoP p@H PH P ͽ0 o@-0 W U ,U @-P Q @踽@ @0@ a0 B( (0( b0 9 U T hU T 0  @-0< ),T xT mA-P`p "@P `P `ppP`  Q$ `F$C$$d}@- !@P $0 0 0  A-pP !@P" z0 0 0 P!`P  ` P0 000 ,0X ⰿ@ԥDS R @-@P @ xi-A-M pW $P0 PjB@P!`P  0P^B ZЍAЍ/ЍAЍ/ 0 0t n< R Q EXJ @-@P @ 6'p@-@P x0 00R0 PJ!0P Q   p@Dpp p@-@P `0 00R P(!0P Q   p@pX0 P/0 00R /P/<0 00R0/P///ᴢ 0P @-od  QP  QQ G /T0 P/ 0 00R/ء@-@P \0 00R   0P Q  00ꠡ| P/00 00RP///,< A-PPM /o000"P R Ѝ R0 p 0 px `P 0 S  R H  VA pP` "  00ؠ\h L @ A-@PM 0 00R ЍQP 0 ჲ 0p= `P 0S d P A pP` "000( (0( $0 g p  L TL + P -/o<0"00^ R  R/ܞP/D0 00R /@-P `oꌞ P/D0 00R /@-P Io0$ P /ol000"\ R RP Q + Q# /Н fP 40 00RP /DP fA-$0`SM"P@U Ѝ P0qP pP 00  0cP S ! o@P d0 0 0 @Ѝ4 PRP  0L$< 0 //p@-PQ& @R 0Q: Pp P  `0` `0 *L0L L0 "808 80 pI HI \I (I H I p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ PpJp@-@<PEPp/>P Q 7P Q>/P p@ ) 0p@-SP` @ 0S P@p<P QQ P/P >P p@ p@-\@<@P(@Q Pp$pP p@ $E $@-@P@E @-@P  P 0, 0a @^ A-PQ`@  @ 0 S S C\P 0 S S C^\<S>0S: !S#0-S50F?o2-P0S-0S'S% -S0 -S0>S  0/S^ p(p 0 S S0` ` S S /S >S S 0 S S0FU0 R᥃P0/SZ 0$00>S] S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p 0 0 L S =S`B`0"S0S  0"R "R RW0$00>S` 0   0C  >Rr0`|B A P\ @-Q R$P <PG &P@aT lT gT, qTuPoP tP;P"tP @mT pToPsP;P';P<tP;P>@pT@;TS0S/Q /@- ὂoO-\1MM0(@P00 p$0` 0$ 0 0[ Q` $ 0`;/0 `P Mߍ 兂P 03/P 00  $ 0:/P 000 PMߍ? XG-@,FPPM DaDqD`p@0 S S   CQ R@<S7  (ZP#   "ZP   ZP)0 SS -S0  -S0>S  00 >SS @S @@MP@d> h> t> DA-`RM\PPp2 0S/ "@0U  UO 0/P B 0CU/PU  U0 0 B/Q L!0C@T@!  ;@04D.0 0 0 S* p@  GEV PzEFPۍ?0000S0ZEp E`EDEp XEvEpǻP < C-`MPa@PO ,)Ep`F FpF 0pE eS>#0 ``00!Ep)  0 0Lp# 000Ѝ0 `<00Dp  Ѝf@D`5F[@-@ *F@O@-;gP 0 0  H9 T8 O-IMP  @Tl p ` Y 9/0 pPS @T[ 0 R 2/0gF P003/Y@ 9/T gT T @T@A 0SM 03/P Y 9/f0S, @0 R 2/0f( P Y 9/Z3 0 03/Iߍ 0 0 r 0 0 i 0 0C/` 0 0C/W 0 |0C/Nl l0l B0C/E p7 l6 E H7 H6 ; $7 $6  7 6 h 6 5 D 6 5 p@-P@PP  P $0SP  R Pkp`#P P ^PP ( P5 m <5 P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0P 0 $ \00 Mߍ R00 0 0K/⇷L 3 2  0/0/@-@@P 00#0 0 P 0S S R/P/ R0/@-@ AZ Zp@-!@ (M  P l  !:```oP(Ѝp<  :P (Ѝp2 2 2 $@-@╦fY@-$@@Y܂p@-M`PR@0 @0Ps*0 00 Ѝp;0"Sp@-M@`1P0 Pqp 0 00 Ѝp0"S 00 S 0 P :\03#/S 0 P \0///A-P``7T"@P LH(pP (; @P u3SW@'(0( (0 XW>/ / 00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ zЍ00@- @PM  @ lЍ00@- @PM  @ ^Ѝ0@-@P ,0 00R~ /P/0 00R / 00 !S R!* R0:/-  ^0 : 0P0*  R*/@@/ / D~P $0 00R //\}P $0 00R //$}P $0 00R //|P $0 00R //|P/d0 00R / 0   \*|Dt000 000S/@-.-P pЍ(0( (;0 wt@H 0@-pP@ M T T T % 0 Ѝ04 @- Ѝ0 0 :0 t$ xp@-@ @ $, 0 80 ҟ^t d Dp@-@PP (P$Pp0 70 ཟ p@-@PP (Pp0 70 ટܖ p@-@PP $Pp0 70 T @-@P  Y.<+ < 00 ;0 y8 |@-@P ( 0 70 h( `@-@P $ 0 70 V$Pȕ @R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@Ჟ P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pn80 0 @  0""048# /UUUU3333  ഔpp@-PQ@{ : S R Sd0 X Sb0?0 r-w - 0!= S ] 9SL @Sx00 r-w-0  R> R9 Rx 0 r-w-H!@ T0 T* T2 T x  00pRs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- H0H H09 ༝: S{A0a0-0| p O-8AP@:  2pPA XPA  ቊpP% 004` 0@T' S=P0=S AP` AT BX ! T6D0D D>0 e ꈟ006 G-XX"X2XBM 0 P@DH L0TPi X`P ㌠吠唠嘠圠刀Gpm pp @pb $P (p[ X0p 0S0R0400408<@-4W-Y-0@-뱊8180 00D000)@Ὴ -T  #0S qp@   `( Ѝ)oЍ @0@ 0 מ ў ͞4lO-PMp 0GW"S00`0v@=P-TPg +T@`0@ ?  0v0 o P p  !ʎ @00D \a0DSW0DA0DS"70DURX : QP   S  R  "000T@ W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`W00 R0  Ѝ p p᠀堐0 ?0 d XR A B0A PR W @ 0`W p pmꙙ 00 0M0Ѝ2//O-PMp 0GW"S00`0v@mP-TPg +T@`0@ ?  0妗0 㟗 P p  !ʎ @00D \a0DSW0DA0DS"70DURX : QP   S  R  "000T@ W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`ꇝ00 R0  Ѝ p p᠀堐0 ?0 Ed XR A B0A PR W @ 0`W p pmꙙ 00 0M0Ѝ2+/O-M8@ IPdC@P80X D,0( p `h6P000pp J@P!  PdA00S! =0=S0`S"`V`X`V `ሀhP*0#S RPU (w000C00pn@p P@5EP@( .Pp P42P 4  $| $| 0S000C00  0PP40i0pd$h`0 [ᭁ  ᥁0X0H@45PP崏0H Pڶ5 ,0pC -0P&U 0Pq0S S Px  Pp  Ph   P4 R1("2 0 t4 30Gލ Ѝ0@_0  (@t  040040 S  P 0pW 0 (!1 H 0!1 0H 0S!1 H 0!1 0H ی$0Sl!l1l H 0ό 0   4`*P P PO9ގ0S `Z$00pW,| Lt@N N ̚\M ,M LM ,ԙ0~C- Ÿ TM@PLP`pptE UN VW W` ! 4!,8 #8 x00000 $( 0 0 PLQ P,  "{0 p@ !0 0 L0 306TЍ 0 P 0U 0 P 0V 0 P 0W 0 P 0@Վ Xk@+HJ <tJ HJ J `-MYЍO-||Ÿ \M@PTP`pက儠刐N VW W` Xi 8#<$"448 #8 d000 $(,00 0 <Pc0Q ,  zzQP 0S@ 0 @hH!01 0 T0 30C\Ѝ!1 i\ 0aV 0 j\ 0VW 0 k\ 0KX 0 l\ 0@ w0 @@ d@*|0G tG XG <ēTG  -M?ЍO-M唔 sX  [  0S 0 0Go-0TP ~Pd 1 S S   #@ # S\  000 S SP S0 R R R R @ B RQS 0S1 @+S7 -S[QUp @Us0S 0S 0 D0_o0p`R0+S4 -SF PPUpw[ WPWD Pp S 0QUp @U40Sa QT 0 0_o00p+SR0S @S#0 PP _opR0S @S&0 PP` _opR _op`RU7 ! 1 0 2 30:ߍLPPpPp py S!@A. * _ 0 d 0x x0x td 0[\ \0\ 1d 0ى)l$D B PA (A |O- ß MM`PȍP@yr T{ W 2U0&N 0AM.0; SPY 0SV P +xl+PxR 0  0  0$k PP @PP3H0: ST 10P! 6 GD  !1 0 8 30_ލЍ@ P 0 @HPP * &DT100SP<104!414 t 0:T!1 t 0/Wz 0 t 0$pC w8P \0S  S 0000H0000  @P(l$(X0̈\ (ԍ܍A-@P`p0M- V6 W? 0 ᷉0 0 0rP @T@T 0 pPP 孋0Ѝ @᧋P0Ѝ| |0|  0ਈV\ \0\ X 0W@ @0@ < 0Ď< 8<  ]< `^- $M!Π00  0 (0 0 0 30$Ѝ!(h - $M!Π00  >0 (0 0 0 30$Ѝ'tO-p PP`~  B 0@00 00B PaBQWBABQ7B R0 S< 0A0CSF 0 #S2--00 D0S0R0S? R0 *@D T T@0 T:0 0 }݇0p D0 00 0 ʇ@0TD0[0S [?0:d0d d`0 േ0D0D D C0ઇ vȉH: p9 $9 Ј9  G-t1@0P?  @RP>T !6*pmvmzNS <@ @&`(aKi @$@dIcKL%fc .al0$e;a 0#0c=f;h.d f,``l̠j`荠fpeˌa{'D #n e 8` m3df` piHpp,c{d p' p8@}n{ @n+)Pl .nc+g fi`k@$X Pm$&-3 `+k[%P@ +.B #Bj'Bc+00@m46K=lKY30i[i;d 0h!+@k@0@lˀ. `PD *`ˌ ꭠg )n @ mČƌ͌3kˌf+" d,mČƌh+͌03hˌe;# 0͠T0fˌ+>C3C7Cg;p隠3gPa"j{ a(f `H hkekb,b(e P]@a[l&al( h4bf%bf! lLe+( e+"+I 啓I 嫗Ib< l`` +LLd pL dˌp' p g|nˇ\pb)f+ *h! pf{h,Ld8p`K`nkpꩠgi `lɠleˌa{" pea{'p0P @g}h{ $bK,@Ph[bK$@f `dID`aKl['P`akl[%P`e]b[gk$`bgk&`8 klkd% l+d!ad ge&  g+e)雠` di+( X%p Tg+pf+! gzk{df+" gh@+NDCD4GDkK,+J͠ᕣJ`ˌ᫧J` . n`b*Le+aK)@e aK$ @P(MXfKi "fi h`0a a;Xld@P`kb$b!ai4(0ad )l0ibb+D0l[i;(06P0n`! +뽠daK) @$@L dJ`Ki+d+(, < R0 00//,@-M Pp @u`P`W0D>S 0!3100 0uЍ>SD 0!3100u00u00؍/-p@-MquP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( tXD:PXWA-@PP`pU =UB 8X ERR14/.-,+*)('&%$#" Vp&2!0` 0`00+XPp -X% =X00+0E0VpPpp-0V0\0+00+0`0p@00,0, ,]0 r00 (8 ,8p@-PP@`  0RuSpWSRX0CSG5 +p à 0R ^ PSPQP^  0    T0 0+S -Sp0$ $0$ b0 \rI@ |6T6O-0xSpLM 08@ (`(0,00040jh 0 0bt @ [t@T8 P0p000003  0a0GS] SJ$00+W@ 0-S[=W000 0` @X B R j b\S  "=W  R"   P:0$Ps @ _s R$ "@P0 偡   n Y# @ T:$Psp@ =s0S$0 @"@DP@ @T X 00X  0  0pW ,Wsp`TS `! Z0$Ps ` $s R$ `"`FP`0 `偡   ` =W +0G?oY20S# Z$Pms` $es0S$0 `""`FP` `傡V X 00 00X00` `Z$PIs` As0St$0 `""`FP` `傡 0T0 00  HR;I?I00 HR 0P01 P1 00S.p P 081 00S:0 Ѝp0 @00S p@ Ѝt t0t  0InXL L0L  0;n0yt &`& (&@-`APP@ MG P1p0S'@1@T0 `0`S$ @0S(V+ 000S"P.p0S/  Bp ! Ѝ0@T0S p00hy\0 0 L L0L H0 mxtlK|JT4pJ $$G-`PPHM6 p 0 4p@ p@ HЍ P 0 p p@ HЍo0S @XH0H H>0 mQ0P R@# #O-P4M@P\pz W>X0S1 `00 S 5/000 00!S5+0 0 00!WfW0b Y` X00Ux5St50 0 0 0 0@0` P(0`0t5`0$0X1a 0S80`lW ,A0` hW00V0S@P ,(05#[0P` X $ 2P0 <%*&  # #. BPU 4ğ2#0!/#1##ʂ0#  0`V4Ѝ3+00 00!k3/0 00!dl30$0H\.d0La#0L0|2pST0, P `@!zhP 0`V ^ @P,x ^[d"$:600%$0H"%>!!!0C0"0T(P%"A0$AO#QX00 0 0$00?S%4P!( `1T10&1! T$?01>! R01"_0`A(0|10X00`d(0X!X1X 9@ 0l0@t`dP(0 V"`  R(N@P5Q4 0A`X0 0A$0PE `0P 0  `)`) 0 8@ 0kz`( GzG\LQ(\)\! ISQGL T(̸d @O-PP@`MN TV VA 0 <<T:R P* Ÿ PL P R# 0Qy SQЍR P P PP[@Q @| P @0 @0 T1T!TT0 tk@1@!@0 kkT$1$!$$0 ak^ # ^ p0^p 0^ @0T^Pp# W @ 0|T@^*?[   !]-p@-@PP U p@LX X0X 0 kU8 808 40 jp@L0 J  EG-P@U T^ Pp ppq W00"5gP: Pc 0Sb 0 R 0C ` PP0 XA V  00S0 0 Q 0  ! 0pW3*_oRe`VkP( U  !uk 0 0 jTt t0t p0 j\ \0\ G 0ujl00PH $ H A-TT1 0MM@P040`P! R<  00S0 0@ $03/ 0 0 4 30/ۍЍ>Qp夀0p$p 0'jU0 x0jp p0p G0 jT T0T 40$ j hhh CEx , TP |,O-Ɵ MMMčƟP `pTD$03 V< 0SE UN X  㰰lU0@U@@ R R 60B?o2 00⃰0S U0 S0E0 0S0000ShX. 0+0X 0@ 03/0Sp 0@H5$ 0000,00G$0(@03/P   0S00!*  0.S @ T0S0W:0S 0S  ,P8 * R P $0DQ/ 310 D1 0 (0$P00 0S  0P(80: S$X 0S 0   000S0 P@T  00S0Dk04/P: 070@(# $2 MލЍSLf00m0   0A x 0.Su0S` 0.So\ Ru  @p 03/0  000.SH W P 0 DP7 @q  2/0!1 , 0h!1 , 0hV!1 0, h0S!1 , 0hUt!t1t p, 0hX Pj0SP PP80!010 ,4 0qh9WI 0@ 03/j0SP 0IIQ;j0/ 0 @0 03/0p6I4I0k @gg*d@c   pd @8  /O-ß KMMPčP`pؔܤ9 UB WK YT \[ /\@ @ 0\/\0   V"2 0 4 30KލЍR_/\8VP/00p/\Vp"p2p @ 0gUP"P2P L@ 0gW4"424 0@ 0gY"2 @ 0g@Pp PGP 0   R  T 0T/S 0: S+ S 0 0 0 0 pX! +00S0 0@ (03/0S0: SV/0 0ā āg RZ0P嬰0P 0H Sg0G  0Mg qi/0 0ᲰG_@_p L D  m  n   op X  SO-XşX5M$M 0PQ000` . @~\< 0  pH 0/SS;R/ 0B0 4ZS 0H*0; P4S 0 0CPR IR*0S0;R X @H p0\  0  *\2 @\ ?\" [\!PI 0^N \@000XS 0H 0< S @ 0< 0@Ⲑ 0R  R QR Რ@  P+Z@PU "2 0 0 30ۍ$Ѝ0@S D0\P ]\!PLm @Ÿ]P 0 -P]^ 0]P @ 0< 010t  0BW 0R S0BW 0R S@c 0Q 0{  00P1A0 VY0 [0!P0@ E0 0 p3Q0P0H*0 ;P 0ꐀ@p@p0P xe0lX eS@S@Q[?**\Y[-]H! O-@PM`pM R T    D f^ @P}\ @\ [\ {\PU PE0\]\ \8(\PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S00 8(G 0}^S0CV  F B   ef  @ ]RR ]RR pPpp0PdP  \0 eWjL0 D0ec8 808 $d 0eUꨱ X 4A-`QPM+ 0  0 S -0{S @ p0Q @{Q0 !P Ѝ0}S0S ЍA8 808 0p df 0 D p A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ \R@ @R@ )\ L 0 RLލЍ$ $0$ | 0ld\@Ю 8p@-`P Pp@0T1@D 0CP@DP ztv000p 0  0 Cd, X 0 S. *S8 ?0C\#S 0 P/0S /Q 0S 0 0/p@-@PPV 0S] "S "$ R6  CQ   0S- @ 00 CR S 00p\S 000#  00p0"S0@000 00 c\0ppp,  p@-((1$a0QM`M0500 S ẩ 0 0 5 30/QލЍp, P00 @ 0 Qp x PE_0 \9PD204 P 0M!HML t 5C-0$eP`M U500S E@ p#S"GHe0 շP$ 0S %P @ 0S-e0SЍt `p  0@S0 0 40  0Sx t刄刔p 0fS0fS 000#3R0 <$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 vP 000#3R0 x# 000 aP 000#3R0 (# 000 LP( 000#3R05 " 000 0#S 20@ R@@EVP00Ѝ0 S Sd P 000#3R0 (" 0@00q P  P4 000#3R0+ ! 0 00T 000#3R0 ! 000EtP `_ 0@S0 @  P =QU 0P0 0 P=Q 0 @00 UU 0P0 0,Ldhl8ll0T ȥ ` h,p@-PP x^P c@PLPPP n00p( (0( I0 a\\У d@-,@@PN00O-ȟ MȟP P`@ pUpVpWT 4 Yp00: [Y &bU 8(,8 0 0 30Ѝ `s?0l0` Ⱘ.p X ,U U_ 000 2c110 0 0p0S( A0  $0p Ppc<000S[ c000@c@Z 0@ c00p nPZpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #Sy R BQ #S I BQ #S H BQ #S G BQ #S1 L BQ #SL M BQ #SB N BQ #S8 O BQ #S1 D BQ #S E BQ #S F BQ #S 0S:U 00S! R B  P `0000  00 F  RS0,Z *p0S Vb00 00MbW 0 c[ Db000@=b@p, 0` @v  D# 00 ( q#   20000"   2000000s2"_0 _nfp00,(@ ((@(@00,0fD / Pk0Sk{[p+`_a00[ aa  [ R0`00{0`0 0SpCt X  pGw0080 a0SpY005[ r0S0 R  p`00C0C   pp p [S IkFED`D,D @dAp0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF`CpP P ЍptA-P`? A@0S( A@Q0+pPpPP @P  ip0 @BAQA3M@ Tp0 Lp0 ,0, ,<0 ^8x @p@-p`pP`P/@T T0T0 R@@#pP000  A-P@P`@p 0S |@@}R R"@`_@P00`0@  \@- 00 \ C-`4MP J@P 0S|0V ! UpЍ \0P;  =R6 0Q*G B&R&>$#"M = -jfbRp㴀Y WꘀqvK　SБpE0X{FH9 0  Xt T0O-,,% BMM $ %u  %p 000 0000+ 0P 40 4MP P@\  P 0S l400#S \ P 0S 444d0``\ P 0S 4d0``\ P 0S 30   \ 0P 0S `s30\ 0P 0S Ss`30X3PE0 + L@3@0 0P`\ @P 0S QPP[[ ;ZP200xS0xS0Se "P2 0 4 30BލЍlR@P\ pPq 0S @200#SF \ aP 0S 2R0P\ SPX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ +0P 0S rH10\ 0P 0S r10 ! 10P 0 $0000 0000YP5 ,  L  `$<H3X t @عH h(L 0p@-d@@0S P Hp@P@P 4P mpp@-@P$ 0PP 4P BPP=YP TPph`h`PLAp4 404 0 [p4l xp@-@P$ 0PP 4P PPYP Pph`h`PLp4 404 0 [(,L 0p@-\PP 4P Сp<`<`sP@پptx@-@@PO00LO-v,M@Pp0J 0SR 0SL T60` 0P U 0C   6000?SN Sl *S 00 *Q @R50*QLU 00  *QA[SU \S0  0 @ @Q8 ,Ѝ?[ [2 *[ @[[. \[0S @@0S /Sx .Sxv 0X q 0X/Sn.Z] Q /Q NP  /P P,ЍQ /QT 400 000  ^[![00 $0 00 @   /S \S> S -RE S0 U@ ∀Ḱ0]S^$0 S w ti - 0Xm  0X/Sge @_U/200 0 /ZU0@  0U ∀Ḱ^]^ \^  @S ^U@  ᲀ^% @@  $0\ @ !  [Q  @L1L!L0{ Z0S,1,!,|0 Z P0 @0`pC p 0U0   Z  0 sP/ZY  /MQ /QY 000 0 -D\ 0 @0NP@-@ P [ 0 Q 4Q?o2ctp@-@lPVP XVP T00pT 00p[ 0 p8(O-0p M @p` P Ꮍጽ10230Y ߍ(PT 0 pI  P: [ ; 0` 0P ᄼP) @@ 0  p@ 0 P0P S P IZ ">0 "C 0 p@5[ -RP%$O-0p M @Xp` P 10230Y ߍ裺PT 0 9pI  㗺P: [ ; 0` 0P P) @@ 0  #p@ 0 P0P S P Y ">0 "C 0 p@Z -R=<#"O-0p M @p` P ᄼႼ10230Y ߍPT 0 pI  P: [ ; 0` 0P zP) @@ 0  p@ 0 P0P S P ?Y ">0 "C 0 {p@+Z -R(! p@-T@0`P@ e0P0S SP p} p@-T@0`P@ 0P0S SP pT} p@-T@0`P@ =0P0S SP p| 0 00 M-H- M 0 S 0  00\100M 0 R0    R p8 00 0 0 30KH Ѝ/',-H- M 0 S 0  00\100M 0 R0    R  48 00 0 0 30KH Ѝ/< -- M0 0+--M  --M  A-pPPp` Q @Q PD@L0 0000A!m$0$ $0 Vy 0P R   0//lO-0'07 0 0S0 H0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT U08@@0/S(@@ @@(`lA-M@PHPq0PpC D!0C `0 00   ! 0b0C S0;.-,+0)('0%,`vV0 Ⱉ0pS@ 0S 0ScV0"S $7# Ѝ T1r0:SV00Ѝ(D @-@P1 0S* "H@T. 0T)  /Q0C T !@# *0P@/S x0 B@T@!h0 0U  T <@0@0@/ShX̅00@-@PDM  @000p 800S DЍ0p@-`P:p' P@ p V U ph'UX <p` VB@`00 Q?o?o 0C-@c^?c ^' ^ `pCc&Pc2680E270G2&1H01./ "(0C0 /0: Q?o?o 0@ c5RA-?c"6R2 7R Pcp0E7`G 0E1C f<68<70< 01>?0#ό Ό C+ C+0c̠0: /07 Ϡ? 0S! Q/o/o @bPG-?b P) P @pBb&`b4')3V4( X4G1Y 010.? "1?1>( B24 5 /00@ Ϡ P! 0Soo C-@@a5T?a"6T3 7T `a2V7pX F3Q g>>> 36 / "A11 A>+@A4+a21/4 6:  / 0Q!*?B0CS?S3S4 cC0 0c11/C.B0B#B# b0///0Q0@-#/A BR?R0463R64b0A3QBA b3B ,00/A BR?RCA A2" #@A4#a01,000P-; S J?R$R b02!0 SJ?R  C" C0c0,PP `@-T00p@-P@` <Ppp@-P@ <Ppp@-P@`D <Ppp@-@PP pLP GPppC-PMP`V ♴@T |00RЍp :  1p@`$ Pd 00 R x0,@-S00 0S@`p0#/"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PBPX `E@ :PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍPP @@ @0(@$0kD |O-`ϟC 0C,0   /"b!!A0,0 W0 0000 0YWP 0  Q0( SP 0 00HWz 0@P(0PW%S(Pk6 ,0 6,/,0 v>C 0CWP0(Z 000"0W0QD6 0 0P( 0, ,04!/A!b!b0C P0( 4 0 B0 S8P(P1W*p 50 ,P(W0 00W =0 P( WTWp ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0$0?2c1, 11,0 020 0000 0 ,, ,0 0CP0(J 00000 3 ,, o,0 0CWP0(000c c0 ,^P([(P000yW0T 00. 0 FP(1 u  RO 0s! `p0@@v0 @`   ` @aKal B  0 B0 V PKUS ZSP  @ 0,"P ( 0$0 R0Y R0P ,P\  /#b!!0"A `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0,40 00N(00 S!0 @pA_Q"pG@D  W@ 0 40N Q @(0AP 0(P00)\P(\ ף] ] \ Ql'$Iȫdn\R Q(PP @ ACLC  \^JS S 00#3P0z z H/o"(PzXn|TQ(P7 pp@*CP(!B0pu10 B0,Pp> ( ' Pp!/"b!C;R, a2ba126MP P(P @ @0C2c2c2P$00( (0 00 @ 0 @Q ,0@0S} 00@y0S 0@r r,p0 0P P(00, 0C$0(^3000c^\0M0cP$`jP$`   0P  P(00 , 0Cq$00(06  p  0P( ,  #P ( (0 b$ 00 0M0ЍA-!1 0xM@P0t00PT 0S?@0 S=a`\`at!p0  ں?P1L! `p,`0 H *|?1 0UP@@ L 0 0 t0 30&xЍ0嬀 S``  pMT 0 jM0l 0<0 0\ t0 30 xЍA\LM L L K X@z@-0M@ l0P p00Ѝ@-0M@{0P c00Ѝ-4Mo0P V04Ѝ4p@-PP1 00Mp0,00`@P4 U<    P00Q Q Q L 0 0 0 ,0 30#0Ѝp  x h`0` `:0 JUD0D D;0 J_,t,t,t,0I 8|I p@-@PP U 0DPp P @pD0D D70 {JU(0( (80 qJꨝHI  I G-pP`' X/ Y n>V @P0PES  R  Dn30PEV R  SS0@0D@ D0D DH0 5JX(0( (I0 +J̜8H Ԝ؜H R@- 0BAs @Q 0CR J@O-阡PP p MU WC 6@PI 7PI  6p`M >4101S Y7 Ѝ060P@6P- 0 0P o60 0 J=00 Jl0l lD0 I@6K00808 8C0 Ih74DF F ̚RQ@-M 8@PЍTT K@άЍK 00O- 眡]MMpō PpG p1PR pJ @PC@`0 80xA|Aާ8O80`TA>Ct9 sQ$`040@@P>P x0 0 5 30]ލЍ\0\ \D0 IEK00@@K00T00(C 0   M Ѝ~|--M  Ѝ Ѝ/ -- M0 0` ЍЍ/O-鐒@P p`M X X00?@P>00P @ P 00 P! !  81XP:  >VP W^ [[XPVppPp4W` D 0`f`0 `hpPR P00D!D1 00@ Ѝ媬 1XP C0PP00 @ Ѝ̰̀0 0 0fHW` 0 \H`|0| |?0 RHrpP[ pP `\0A 8X@ ԕ@-@ M<@(0S2 =0 `0( `1/qpPp0)  0 0 PUR <0PU"@ ЍPPTp 0S  0CP @J00Pp@@-P M?(0S: b=0 "p0( p1/qp@`0/  0 0 @ToR <0@To?1`V ЍP@T` 0S  0C@oIT00?I00?p@-PPE 4A0S5 @Tp1 Rp00P0 P 0S P0姫 0c0(墫 0P0 坫0 S,P 4P 8P p@艫T0T T0M [G0Sp000 0K0 OGeEt< D < p@-@$PP֥Wp@ϥ @- @@ȥW@¥ԀLp@-,PPụ Y@ᴥp蠀@-a@P`M[ P10`00S p  0 XRp p 0@@SN @ W8 CR6<,0L0 S0\^,*N^(^& N0 0QW   "\ ^ #R.S @A a  00C ƒ@0@ЍD0D DF0 F "^ #RX: 4  R  *4 8/ᠻ 0X\S 040:8 R РS /zyxB@-@`PxHLpL0ppD尀 9T   y' p@-P`@|H0 A-Tx`Pp@P1 T&  0 SSS7 S300 S(=wbj{#g\*N7'0 F7'0 Fh70000F00<00 V00#R00 00;R c\&V Pd\ 1P01 0S1000S0d\ Q p60100 R =R R 0 0 60000   `70B=<;:987543210/.-,+"!  [|%50#\X00S00%0H?o2300&0H?o24 00=Hoᨂ%  00 |2010 0?X000 00BS0100C0w-X00s ^X00n00  00B0! 0W0C0 0 X00000X00 B 0M00J\ 0 0K 0 0@ 0 0A 0 0<003 0 04 0 0/ 0 0* 0 0% 0 0 0 0 0 000B3̯rqq($qp=A-R@P 0`So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@100@10 03/P(!p0 $@ y0V0 p00 R (~P00 0P3/P" Up   R  SVp 0SzP00 0U ԭ|oHoLo؆nnG-@P P6`P (rp^u  0F0\c<!"#b!0CaqV; Y ?PpY` $00100S p (1`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(֣P`0003/P 0 p 0000SXݤP00}00t/>3̪mhl4ll(l=G-@P P5`P $rp ^t  0F0\c<!#b!b0CaqV; Y >PpY` $00100S p 0`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(8P`0003/P 0 p 000$0S?P0 $0~00Tj@jii(SR: G-P0`00Sp 3/0Y @IOP G T 00 00 Y @IOP 4 T P00 D0D 0 p`P/hh4$ԥ4hSR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP T P00 D0D 0 p` P$/gLȤgO-PPM M Q@ \ /\C 2Py4P8p/\ @ @. D\m `P /RR.\' B Rm/0  F0A P 0E PspE 0: S 9S0/\0Sy@/\` FQ .PQX 0t/S0W0OʨP !P uO G4 \B  YA+/\p@` @Gލ Ѝ.00X0/ލ Ѝ @1B X 0/ ?   ̡P@XB00 @B>00 @B?00 @B00 @ B00B00p@-@P Q nPp`\P0@P _P`V A0"S pA00p@p@-La P`M=  300QP0tP ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P 800  A 0 @ p@-@P`P3 V( 0Pp:P @P0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 ?(0( (0 ?x` hxj< Dx00/`p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 >U8 808 0 >pX iTw, _0@0B`H PEI@DĠP P @:00`0000 0c7(`,Vp4 (`pV6p2"2  0N="2 0 D= 0S"2  08= ` ZR$ W?0@QR?@00 `@<0S= 00@>@`V n> 00w03/(` pՠV 0Р> 0 0 T 0lXv]\s$ 0` q  $qp pp  (^op@-PP`@M V T 0 @ Ѝpx x0x 0( k<VX X0X 0( `<T8 808 0( U< `ml mhm@ P\0S00S\S00 RAPဒ 0S7\S5 00S1 :S000 0 S4Sp A 00S :S|S@0@ A@0S'!1 0 8 30Z ލ Ѝ  z@P 00 C `10 Y P @P/ D @@(QP P ; @ 10   0 04 Q;V( 0 04 F;0(P j0 0pP[ @X4xpP,a8d0 i,i 4iiL_p@-PP@ T `` P 0 0 t00p@   T T0T P0@ :T8 808 0@ : ,Zg g|gA-`P@P T U = upP d㙜@P 0:SS  `d \S p+ Q0 @ 0:SS ^S0S:S 0Q0p @Ld@P 0`:SSd@0QLpA0]`0S:S 0C^7B Cp2RIFB?5/A)&"!0p 0 BW1 0 BR0 0 0 0~0|:0z0x@y`PS( 0n 0 0L !:M 0 0L :T@t t0t p0L :6p ps)po(< 00p XIldH VDd @ddA-PP@`J TS V\ = PPh d㰛@Pj 0S:SpppdS0:SS   \0@@AdPL pd@ A\@ATp Pp@ԝ6 0 F0X 9 0 0X 9T 0 0X 9V 0 0X 9pǜP@@᜝@; 00| b|bP TLb"$ Hb b# Fa$p@-`PP@4 U= T& # P? 00S 00XS@<,00A  RaPAUA0AW0AS70A^p| |0| x0d (9d d0d `0d 9UH H0H D0d 9p a`sd R``q8 \`4`rO- AM Mß3 0@P0(0 0`p 0SH -0/44 ,PPN PX0D 8T  0;00CS3%10/.-x+*)(&%$#"! 5 1 ,0:S 84Sr:0S:00\"H2 0 (0 30 K0e$P* 0B.KS:S00 B0$ 8T S%졟 440<4 0 S BKJ ; /0$ I 4$4I9 <4$0C 0$CPtB>K0C 04 8 0S:S XE H R0 0  Q!000M P@04@@0n9 0:S a: 00UOPCK0 E0 (810 S:S008$ 0S:S00< Xz__ _&]|?K 0] %0 00 h-H-M0 S0 00 0 0 0@  00^100M 0 @R0    R L00 y@ 00 0 0 30KH Ѝ/04@-L0 @ @0[Ȁ[O-@`,M$xxP d20 R\ 00@`pR 0 PLP Z p ]P p J M- J PP0 S#: 8% U10 r 1$4S1$ !@00P P0S "<100S (!0 0 $0 306 ,Ѝ U r pP Р #P 5SX0(, VT00#    PP %P0S|BTTACq* 0 $@6 t0 0 1 30sߍX0X XG0 B6V<0< <H0 86|@9l VVD U0   M ЍO-ϟ MpPÍP0^ Yf 00!R !Z P   1P0%%Z * 0S0 R 8/0? 0 3 30[ ߍ@P0 v1P 0C PS !000C 0 `0zS|NQ~|{pyxwvus1jhc_^\ `ZEU000 `0CP0PE 0SF0 0C0000 000S0  IY r<{P0 0P 0P0CS0000 @ 0D SU*Ir? (0R0 (0 , 0C$00 40A@Qnt#zx 0 S0 00 1YK @@0 i0P 0C0@0@ @T  0SP 00 0@0 @0 0CP2 0S0 000$0 $0S0D =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SP P000, 0@C0 H9T@!r?(0@0@ + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0r000@T@0TS XRm    0 (. 0     6 4  00 0@0( 0CP000&     ( S@ @& YʱY  P6P&P0 3Y464&40 3Pp _P @0cP #/P  0 S0 0C0 S 3/P @00CS0K 0 S0  @$ 00S .P40SZu 40AQ0Q 0Yk $ @00ESZ .P 0@0CS0W 0Y0 O @0ES$ PSZ R0 0@0CS0  0 S000S @+ D  @AQ X2 @ @.P 0@0CS0Z000 0XW $+D @@P 0 R0 @NTA 0Ti@@P[ 0 R0 $ @XQ[@@P  R @0 00K? 0r?(00Y D  9. 00S0P0SY 00 00C@0@00<000WS0,` `01D00(0H@V< \ P 0  B0=>J(  r30  p P p  p =>3PSx $0S0000PS`FP Z,`X@ $0S0 00 0000V0̗ \ 0 KK KP BBhd c@ 0 -P 0 0C P0 S\P 0^Z``,402Z`Iy @0&0,(0( =>0#C0,`-Ql ]QP @0c Q: ,`0;00<0000000900000 000:0090 00|0:0000s09000l 0  H  0 PB P>  +P6  P1000;000;0A00=jIT  , BR@ 0Z0 @$P 0 R0l @X<0#  R @#  R2XX  P BR@ $P$M 0 SJ 0iT nT  , BR@ 0Z0K @ R񏐷D" AR>  @ BR  0X0@ NR-  @ BR  0X0] $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0 S$@5*Y,Y0$ 0(0@T 0<050 (@* p00500S @0SI 00 0!Z] +P 0@0CS0| 0 S0  @]0SHP 0Z 0aP 0Z 0 p00 00= 0#P 0X 0@^@ =. #RRc @R  B   @ 00. @0=>03SS' 0@T0C0000@000 0SP @X A 00 000~P@ 0 S= 0@@Q#pP2 0 S/ 0@ dPG 0 SD 0 0 ( *_0T0P0S 00CS@0 0 S000@00CS0400 0S0  @0 ᶔ PW 0 40H0 B=>  @J0r0 dp= P p ᫔P 0Y0C P 00S"0,p `0#  , BR@ t 0 R0l00 (@o00P Z 0@003,  ]R$ Z Pp80$0 0P80,  4`, rO<`T P$0 0P(0080<$VPR 0 SO 0MP 0X 0$@3}P= 0X: 0@rPD 0 S@$P P; 9dP 0 S1$1I/YP 0Y 0$ @0KP. 0S+ 0 @0$P P 7P 0Y 0@/X,` @ t,TP 0 ST @tZ( S C@ S  &P 0 S 0 @0002P $P @-I  , BR@  0 R0"  ,$P&, WP 0 S 0$@ P 0 S |Za 0S@!0@3ZS 0䋱P P 00 0Z  ` `d0$0H00  PK A=>0 $ CL/ 0r͒p5 P&ZP@DD 0S#T `Z 0 @+ @D00[P0T0SJ0000rp0SFP Y ` 0@00X_<0< <08 -00CZP@D`4 4A-@P`p%0 0@%@-@`P MDp%@0p0 000@% ЍvA-0R@QP`Y v 200S5 %0P1S010o L000P`! pW@0PI ᴐPP[ 0 .00  C `C000n%0  Q  Q*RQ1 <00@8 B`0O%0 `0 0-"P00P0 P + B ?#A 0#@ # B0 $% %`u44 X2p@-@P % ᾂ0@ %p@-0P$L`T M 0S pW  07/@P  Ѝ808 808 ,0p.@ Ѝ1 @10 00M 0Ѝ|rA-0P$L`TpM 0S $X 0 8/@P Ѝ< <0< 0p ,0$.@ Ѝ 0X000 0M0ЍqA-0P$L`TpM 0S (X 0 8/@P Ѝ< <0< 0y, a,0(.@ Ѝ /t/00 0M0ЍpA-0P$L`TpM 0S 4X 0 8/@P Ѝ< <0< 0D (,04L.@ Ѝ 4/.00 0M0ЍoO-MD@`Zp@P] UK 0TS$Z0 0S- [* 0 ;/0S5 $\U 0S H[ 0 ;/@PЍ 0 0 +0H 0 0Jh +0-@Ѝ0$\d d0d 0[ +0D D0D }\ 0+x .(-H ., -|- H-P-@-$$@M vЍm@-0P$L`T M 0S 8pW  07/@P Ѝ< <0< 0 e+08p-@ Ѝ -+0 00M 0Ѝl@-@`pPP-tt0l尀 T  @0 \֐$ |l 7j0㟶O-şM `@0  0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b P  00D0S0S0 S  \000!#300@ 00@00 @0`PUb*Ѝ@\ M00 ŽP-  R^^? @ 0 `0  ῎P 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `\00 00 00C0S ``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`ikqA- Q@Pp`! _P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0% P0 AB $B A-P@`Pp .T Tp!0D1(0D,TS0 pAd_T %(0$"0@ !1 I6A O-ǟ WMT|ǟ@P ,pခ儡<  ?oY20S_Zg Yo y PC0P 0 b`;0P(0 [080{ 9@00 P0 $0*U6 `$p@00PU`" T U 1 #0ɍ0P?0So PzP P6&0 (PU` 0倁`FFa VP1 P! L `pP Р  )00S  V L0 G0CPa  * T50 0  R  ' 050 0  R 00 00 00 "00@\0000 Ĕ U( `(PU$ 0p 9/P*00ˌ(Ɍ nj8ŌX$44 0 T1 30 Wߍ<0S@<@N(00(婍 0PS 0S0 $^)U `(0Dp0C 0P@ 0T 0- p004 L l6<pOP@@@P@T_@ @@ T*0P3<:@59p0 ? 0, 2P0 E0R$ "@[PpY`* @ U)00S0Dp<00 SR00<0@?(= ;t ƌPp]0 S2"0 '4p@1!0 'Z1!0 'YPꨑ ) 0 L⨌p a 0S 0S& 'P Dp)00㴊P+ 8{1!0 'R~p200/ 0>0 0 t') 000 z0 g'0p80P4eeT$( #l D TaP`    p  PP @-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ\\@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝ8\[p@-@QM`P0 0 `Ѝp0@-@RMP0  0( PvЍ0@-@M 0 00 eЍ-M $VЍ-M $(HЍ@-@ M00000h0 @ .D 80P @0 0 30 ЍW@Z1Y@-@ M(0  0 0   @D <0P @0 0 30 Ѝ(41tY4Y0@-@QMP0 k0 Ѝ0d00@-@RMP0 U0$ PЍ0 00p@-@Q0P`0M <0  `Ѝp/-M00  Ѝ\/-M( Ѝ(/-M $$wЍ. 0-$M  0儱$Ѝ @0S@! 00m'(p e'0S$ 0 0? .%$0S%*Q'(p I'0S @ @0@ <0 % $( `@ @-PP@`Mh Tq ,0PXPI00Pn0: S Sr  SЍP P :ٱP '0pݱ`PV&0 `\0`.S0@D`H08< 0L R:0L R68< \P@D V^0 0U %:0Ѝ]0S \040. S 0 :0 $Th h0h d0 $Ѝ&p $pY% Ѝ ꨷ | 0A-pP`P& V/ ,0 `/@P0\X0/  % 0  0P$050%@P \0 00X0T T0T P0$ 7$V8 808 40$ ,$@L X\ 0@-`Q@M 4pp.  8<0RP@D0RP 0&0P0V Ѝᚯpp pP&0@墯&@ЍᗰPPЍO-`Pp`o L0L L0  | @H1 p@-P  @T @T0 0pp@-@PP U   p@D0D D:0 _U(0( (;0 Uؓ $ O-`PPp M# W+ 0Y0  eV 11* @ 7/P 0 T VK:0 0S0 ЍD0D DD0 W,0, ,,0 HԒ LnP $oO-PDMP@4S Z\ TU 40000|Px ZW 40S` 00U0`0E4 0 000`:/PPP Xg*0d 0 0ᄐp`  pQ`(p0p$ ` Vp:/PU `X0$ (pW*`p `P@F:/P00[ 4 0@F 0@[@ p0 `V: @ PU0 0[: K :/P  04  K P%Qp`00S 40 08p0[p  P 0 `1#P #Q$s PFR'000  0 0!܀,UPP@P@ 0&&```00A @rl00A0A100H H0H 0 OꌷȶHx $ȶx $0@-(@@ @r0@rxp@-@P PP P @p@p0 A0 L`w |A-PPp` @P# P# tP  P@3*"00@004 404 V0  00@v Q:// BQ://G-88!0000S03 0p0Q= `AQ@PP 0 `Q ̀@P   0PR@ wTl@0@S w000  B BG!]`td4,p@-@P P8MPpU0 =Sp=Spp贒p@-@P PPP@Ppp@sw 0 0 E긲l8t tp@-P u@P 0 P0@p,p@-@PP LPp P3#p$ $0$ 0 s O-10  MZp @To p `P ɲP0=S] @PT[^ A@ZP1Z04 S@@@S*Z3 w 81 0   `x0S:a  D!0 0 @ Ѝ0Z   RS@ `J0S a1S  Ѝ PP T p@- @t,PpP 000ppt A-l`PP` p\Q@P 0=S SP(00@04 Ď,@-iq@Pv0@舮,@-[q@Ph0@P,@-Mq@PZ0@!00-!0!Q00 000000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1  p@ Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPG-P@U`pV1S P@@E  8/P/@P@@ @@ģYC 1Qp0000/ @0q  0000W @0S0@0 pPT1S1 S Do 00000q@ @@@@0@@p p00qQ0 -"P 0 PC R00 SAP 0@/ p@-`P@T0h \ H RH  "   T0"g \ ` ``R```0000000000 0#0 0#0000``0000T ^pp@]R4 /o"!T0#00#00!01 000T p`^`  T 0V0pp@.Q  `T \ !O-p`qP& 0Q@@PppW@Q0Jh `X  0PX@aaon(On(0pG.wZ_TaB g 000 D.@-!,@@0@P0S@G-`@P@_}P(p 0@aa*n0Ofn00ZO.TTaXPB(0( $0 0  0p@-05S PnP0SZ sX@ 0CR\np@T P UP@qn|l̨(/p@-@P $PtsP ps$nsP jsp@gs0 0 9ld tMp@-PP@ T $0p@! 0/L L0L 0 T, ,0, 0 (d c ؿp@-@PM$ P$`0.uP  P pp(qT00S 3/Ѝp003/( (0( Z0( lc c A-$P0@MSp p0(`0 0@0p$p3^Pp0(0V,00S 3/@Ѝ ኛ00,0(p03/?pP A-PP@M) T2 0S Ѝ $`0P r00 @5pP fЍ00'pL L0L H0< ]T0 000 ,0< R(a ` 4ؼO-d`yM(p`'q,PP }  q@Po 2 l20 RF l0!$@ !  000 4L  00 0. $(p,`x PP 80 03/``pP"   !0 0 1 302yߍ         PqqP qqP||Pqq``Pqm@p4T^ ^ غh^ P00/H@- 0UM 0H`0L10ݭp! 0H1姚@?pP?0P`p  S 0$< ,0 0 L1 30Uߍ"c@Ġp@-`PP`@M& T. dPЍp hP KcP  FcP |0 0  PL0L LG0 & T000 0H0  HT\ ||\ xO-@P(p,QcP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV oP``-p@P V@0SZ V@p00|[ PG-`R p@P8/PP @VG-!1 0M@Q000`PQ UI U .00P!1 0 0 30ZЍ0) p00P 00 S00 0DPP  09PP 00PSUp!0T  -P~p0 pPp Pp 0 @PV0 00P/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R ,` , `! B  // R 0  B-  ` .$`$"  /0S :p@-@P0C0 00 0p/0p@-S@ :P0C0  00 0pp0S Pb"! b, @-@M0C0   00 0Ѝ/0S/ p@- PM0C@`0  0b"!4Pb4#0 PЍp0 $000  / 00$0p@-PP@ T" dP 0S S pp@dbP p@bD0D D0 S T(0( (0 I xU |PU Tp@-PP@ T cdPp >p@dH H0H X0 ( , ,0, W0  T аT 4p@-PP@' T Pp 1dP 0S S7bP p@1bp\ \0\ x0( @ @0@ w0( 0p@/S S Dp@-@PP U p@ 7dL L0L g0< U, ,0, h0< @S Į8S P 0@-PP@ M T# aP Ѝ0cP 0Sl00 dP P0P 0L T0 000 0L | TR حL(R t p@-PP@! T* 0 Q paP cP aP  aP p@aL L0L 0\ E T, ,0, 0\ : LQ ЬD Q |G-PP@; TD  R R `V V  0L0 00 0 `V000 0`V 0|  0FS84/+' 0 0 0 I0l Tp堀 pl 0  R R 0h `  00 00 0000 0LO Lث4O %  @-/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`0 V% T ^ 0S^  S 0RR00Ap@@Tpp@0@ @;0 [ (0( (:0 R P,N $tN C- MpPÍ`@PO TW A< %[PX AY`T 0S h!`1 0 3 30Oߍ(#@@ R R  R 5P9  R   ᷋ p0S  % 0p 00 0 Tt0t tt0  P  ጋ 0ꋨ@`L 8L dO-ddğIM,M IM$J͍$@@Pp P0`S S  $3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " "  J=00hc +4p# 4I8#8  0 J- 0S X0S> S" UV J=00 v J=00Xe O<  >ZP Z0Sx 20SG0S  0S0s S0S UVJ= 0  2b"!4b4#"R #< v<0I8 0J=00 0 P J- 0S.J=  0S) S LJ͍0 @:01 00000G0 ,0UP @(& 00SaLP P P J=00X0  YPjJ͍[Pa cHJ ( @H O-ğ M@pQ4@0P0C`S,H6)('&%$#"! D QWX00 R04 0S SYk#3 0 0 30Ѝh#\3 0 0 300 HD@pЍO{QWX00RTcWX/ "44 8 " #8݉pPNTL0S R "44!$$("( |"8#8 DĉPTVT008" 0 Ᲊ X: P00Sj!0 T@@O 00!0 piT 1i #pYp \1\\ P0 pY 0@D    iT00? YLp0쐟젟PP0 ppW 0@D`    IT00? D >P|Typ`X  13l,РD<ȟDO-p 0 IM8 P@`p/ !P PW  }PWD G0@S000h &h0aR00  0 P 0 0 1 30!Iߍ [: 40VX 0S P 0 F0ꯥA-@P`p 0 { 0P Wp@-MP`P@@P@T 0S  R0S PB@PЍpP:PЍpp@-@P PuX%Xp0 @0 wP? 0. AAS0C .S .R Q P-S.S S /Q P_S /0@-S GRC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ R 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0S00@-d!$M""0 0 AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S0S'  R  R R R/S /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PP0 PH@~0S0S 0S  Ѝ0$0$ $n0 B : @-PP@p`M T Q Q Ѝ0SS ЍS 0  0PP8#<48#8W R R | p000S SH0 P 0  |9 txp@-PP`@ V T! 0pӣPpx x0x t0 V\ \0\ X0 T@ @0@ <0 (8 Ĕ7 `7 o4O-Ÿ2M0pC P,0 0Q^P0 $03/P 0P&< 00SS   &< 00< S R  0S Dp0pՔ&V!F 0SC:(008@@0H 40(0 C 0^`P0  $03/P P^^p^W `pt<0Se [O &< 00 Sf&< 00S D́PP0K?o2W  RXKoᩒSp40S 00DY@0 pC(,0D\8 [^4 @0 C80P1 0P8040040"S? @&6 04 0 30ݍ<Ѝ?^00H0Sn&< 00 Sp 0K'[SPT 0@DUd:04S8@N Yw uP0px`0X0pP$0(4pdY; `p$``p0, 055U0(  `  fP 0;0@#$$(4"(@0S S000 0SdY[J ,0LE0S. ]00z[w [[[, ![ [ DPP!KoᩒW00 S0K?o2'40$00 Rkd]00ND 00R  Z,0cRC`\.@]%D0_/fX0@@T@]@@/p#p3p 0hP 00SGP#P3P 0HP  0S>0#030 ,P 0X5#3 P 0+D z2~0 0\PP0 $03/P Y 00 S PD ,0hRC.\@&< 0PP M("00%P e ,(5$%0 5s 40S \` \\1~0 0LD\PP0   PP LSaP 0!m L0R4 d 4S Y 4S 00L\P00S 0R $RY $R 0}O2p) ) hX) H() ( g`@( O-Pğ SMD`0`pP `P $0  08Y0p00SX Z 00-00`\ @T 0 .T0@T RuS d! S*0 u DD@Q00 00000000 P*0=S /\0S Ss St 0S 0 P0s0S \00bb%  P 000 P @@PY 0  Pbb@8"02 0 D1 30}Sߍ @S @Rd! S1*.T 0 Pʵ< D 0PCdM   DD@Q000y0000  Qr000S~000.@DOoB0  _Pʘ[0T0 0 )0sx [00t 0 *k/0# Pep0Sa v[00]0 3Pcl[000 DD@Q%Ý'b^[00I! c~O-@X`PM @#  R[ (pP 08X0\0`0d0h0l0p08000 00000XS< S5 S !+[00([P( P& PЍ 0& 0$8<`\` 0 0x Px000 0000 d1SbЍ 0<`$ 0<`$#ppP X8 xa  ]x!x T00(000 n 00R @# 0  P  0 `$ P!$08<080 0P $la[0 Rl딀Xid1 @StX@Y 0@0S 4 {P001\//᤟zp@-@P P@P *a(aTp 0  0- ydyrO-`P,",2M 0D000 0 p@P0S A@\ ST P-  eMP @!x1 0 0 30UЍ0 SRB P> 0 h@P30* 00S  Pi X0 SR ]P 0 B@P 0 00S @P _@@ @P XxO-ϟ MSp 0D 08 x@0嘀% ! 0 0` W$ 0S0S  ` 0 . "2 <ߍ0S0SP;0S`V>36 `d.d>d `.0 ` !Q P 0. V 0S 0A?o2\0 P00S0S  p [ 0m吝`n`P`  0A a30<aP[ 0S  ?Q( 0$ 0기$` 20 RS S0 00T`P  `<00@(0PP`$pY i792 I120Y0 0 S   S  R  R Q ^  ^ \/oQ" SR RSV  0PsQp 0+0 0Si QRe 0S %0P,0 P , 0 B  ` 0P0Y ,00 X,8` 00  P 0P0 R㜐  00SS㜐RpmRo \;R P @ 0XP 00[0 0[*t0e/0 `5`%0 @Y Xa0@S 56p$`(PX0000XP X@T0 4p0$`(PpP` 000 EPt@T 0S S00S0000 0  `sP `@' T0 M-RSQ #3 {/0J[ 4@,8` P1x00x0 \ꢗ`PPP@ `0V 00`[T0`[O-PLM` Zi  @㰱q p  PP0 0 K0PF ``0S S S T@;P `0S `(0 ( (`2P00 U `V Y 00  Y``VU$@LЍTT T0T P0/\Z8 808 40/Q$O O Hdbh h cbi G-XM`@9zP pP @00  ?0 CzP 40S0- XЍ PP >[% 0 &zP -[8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 0D DD@  00,0, ,0 xꉫ#EgܺvT26X SA-PPp`6 W* 0!ᣁ000?0"@@h>V0: ?0hV@Hp` 50S@@:p`F AjH H0H 0 5, ,0, 0 +X  8K0   M Ѝ -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/Tp@- M@= Pt00h` 0`0 `P@@X@$q0@&T  Ѝp$ @-TT1 0M` !000|p @P    }p {@ 0 0 0 30*Ѝ{PpW @@T PU 0SP@MT00@D00qxi~ 0p@-P@0 0p0S(0PS(P,PS 0\0PP 0P 00,,psP 00pGp0G 0@-@ 0 0 0 0 0 B 0 00@- 0 MP @0S 00P 0  D?o20c Ѝ05 00 0p@-@P 0U0 0pp@-@PWS0PPSS(0PPS(P,PpG-P0Pm `Pf 0@00 S S0 S S tPU 0048#<p48#8W 08 (p@P 0q0p0S S S@ 0A S  Ay@P0 ! 0Sp q0000RP  p QPp0@~@,E,+O-@ 0Pp M,0(S{: (T_  0 T0V 00SR 0 RL@D@T0`G 00SC000@D@D0`0S, T0X  0!0J@0`I 00S$0AS000  w0S000 m  f0S& b0p@YR0ppUR(0pRR(p,pQ@ ЍkQP  (,@H(|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ0;p 0$  $ 0 . Ѝ0O-PLMI `|E$P@ @0 ``PP$OpPL 0 ``zPA$PPW* 0`@Q QD QR Q/ 0S:00Sz gOPb  `00p0 @p R  R/ RY R 0 @T:p Q 0J[0H 0 LЍ   @QA@ 0S`:   (⼐+p 0  ,m  p0p 4`0bW G`@U @T: 0GQ00BQ `^ \LQ  QA@ \Y ^ Q\ @  p, 0S QAR^  R  PP@T( Q  A X " X. X= p X@  P@T+:>X X X 0` `p  `  Q@` ``  \0\ \]0 `p`P w8 ; ;@-@P @P( (0( 0$ b@P x;\;/VyO-'Q Mqp P0Ph<N @00`0l f  ` $$ZZ0 X(0,3(``-P p`Z # 3X(00, "(`` -0P p`RQK`a!Q0#03U0S` Q:PQ Y7X ЍX030#1! 0 P@ Ѝ 000X; S`3 `#61S41`F2s2`Fs1`FPS0`Fh 0`F`4:0;`0Y S`3 `#61S41`F2s2`Fs1`FPS0`Fi 0`F`0809```` pC-`M1wp' @xp* P0u00 @l0@-wt \0 0P Ѝphxw00w\ / p@-\ ,@\ \ Q :\ :Apc00p^00C-P$0@SMJ 0( U4pȃ :`H;$963>0H G8ƌ<Π GpB71B- 0R  R  0000890L>1 0 00LЍ 00 !00 0 0@-S@ 3/@NO-M@Y Qs` 0  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \ᧇ" 00\3 L0 1 00p0`0`Ff& G B$"HHࢆ(0F0C(6# B B("HA!0C0C1# B B%"AA!0 Ѝ ZTr `   P 0 p 0 J0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧇# 0Z Z Z 0 0 0 0Q 0  pL 0`Z$Z7 Z3 Z5 0  p; 0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[Pp`@p`D0|0x0t0l0h0dy7 @ @-@P @ N0 /0 H 0p@-1!00 P@0 00D@1011.T 0@\0 S@ N P p0  00C1000L   00LDLHf ʚ;( A-`M!PpM&laapGQQNHH0   @ N 07"Ѝ QP/@-T4T$00 0`P@P @0C0APP@@ 0P@PP PpP p0C0qPPp@ 0P@PP  0PC0.S P000@000@ 0@E0C2S20/.-,+*)|'&%$n"! je \NJ2S2\0/.-,+*)Q'&%$L"! J< 1,*000 @ @  @0Bdn`QeEBdnnQph0000P R 0NQ00 H 0NP0000N00 P 9ldO-``!80@@R@@ ǟ MM|čǟT ਴L<,406I0P80 0 06,P0H0p000S&6 0 @ P< 0hD0 0 ,P?o4 2R0S <0`1  D0PU 0P 0U V HkV/h0S ̥ 00U?pe5P00P 0UH W00刅?pT|50= 0X& WP0 nk@V00? )R 08p UpP  , P* 8  -4 p0a 4@ p0Y 4 p0xO p4 p0PF 0S{KP I0P80[ 0 o#3 0 |4 30ݍЍ_3P `0 _W0S 40ST<0`1   :GL`  jP#2 0 |4 308ݍЍO0Kp$P00!?0"( jU]" P "\` `T X@` j@F`DV?xT 04  S)D#$$ D(H"($H1 Y Pj pI  Ij T 0 T2L p 0I00  .I, T@F 0 `DVX@P꘡ 0   Yx 0  0 L1d`0`0 ppG  pGPjT  0 d`0L p 0J00  .J, TʳL  -jA__4 l*TfL2K(K(0 P(0( (d'@'p\4'&[&&&&&X@% %%$p$O-tM@@ `VPPh0 P p 0t 0  0i$`14 %S, %ἴ0 徤   (6< 0 V 1P806< 0B>PU  0R40008 i`1S   ;`1S0 0  0#PJ0  0P7P  P P$0  0P0  0P0  0P0  0P0 0P`1SxYz < P0ppW  0R 0.ipW 0pW  0Rx 0ipWf 0pWa  0R0 ,0ipWGpWD 0 PS00 h`1S   50 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0001p 0001p 0001p 0xt1p 0[`JL htЍ tЍ 0 10 0  0 0  00 x0 XH#D""B! x , @p0pP@-@`00AMM0 400p00 @PP0S D 80 0 4 30AލЍ.JPTP0,@-@ M pp P@`P*P 0S@ < Ѝ00S.S 0S Ѝp@-|0|AMPt 0 ` $ 0 @P <8 00 0 4 30Aލp蠃LO Op@-P@Q`  @Q edPV 00pV00p@-@ M`p`PU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝp@-@MP`70S 0 @S 0S@V00ЍpO00@0 PaV00Ѝp\0@- MP0@0@0@T  0U Ѝ0p0 0P>U:L@@ Ѝ0<00@,0 0P- Ѝ0:x!S|p@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@9T90@- MP0@0@=@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0P Ѝ0(9HPt$R 0@-@ M} T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@zT" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPptD0 (,0@- MP@O@ P Ѝ0 0( 0P Ѝ0 0@- MPh0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ085HXMp@-@ML 0 Q0P0<00P@ ` 0. 0T @D B000T H0 0 <0 30 @Ѝp@Ѝ/.0 T3}GFO-PM@PP pd``0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`a 0 T @ P  S#3@ P 0RQ  S # 3!# 0T4 0 T @  P  S#3@  P 0R \  S # 3 # 0T0 0N 0L0 000J 00  0;EO-Q0 dM R Č  $Ȍ (̌ 0 00pp< pp_p  4bPc$Ѝ$ C-@P@ `p MPOP @U _P@W  Ѝ @Pt0 0000 k0 P#@c0S0Toᨂ#*= C-@P@ `p MPx@P @U _P@W  Ѝ @Pt0 0000 %0 Pf#@0S0Toᨂ#)`; p@-@P00CS0 S  P `0 Pp5c`0 0CS0S P 0 /c@-M@0  0000 !R !0@Ѝ@-'0 S 0@Q0 R  004S N0@l@Q0R Q    R Q 9Lp@-DPD0P`@0pp 00p@,X0 8L p@-@ @ `@0Ppp0p@,D8LA-DD p@0P`p0 A7LC-P0 `0pMpp@ H 0D @ <8 @ЍP;7LC-tPp0 `0p MFp@ ( 0  5@ Ѝ.;6L0 00/l6L0 00/L6L 0 00M0Ѝ,6LA-TT p@P`Mp 0 Ѝ5L0 00M0Ѝ5LC-tPp0 `0p Mp@ ( 0  |@ Ѝ:`5LC-|Px0 `0pMp@ 4 00  @Ѝ:4L0@-P@000 00M 0 0 Ѝ0<4Lp@-D0D 0@0pP p@<X}:p3L((  M  0 Ѝ3L; R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` 0T  0C0 ЍH0H0 p<0<07/0 0 2  O-Mp`@PPMWC*00V>:Y ` <1 p0 p, `\P 0 P-0 P 0%Z ` p0 P0V0`FV0S0 0 LЍl0 oP h0`00000Ѝ`p \O-M 08>͍0,0= 0080=͍000\ @p@8<LH$0 PJ 0@S P =4 0H P0 Md /P000 0Hk=P0= <<0@PU *0,.  0< 0;/ 0`Hk=0PE(P0P D0d=<;:9876543210/.-,+*)('&%$#"! APx R 0S .S 0S 0S00S.S=0@70- R' 7d 0 @w0 PJ 0D$0 SbD0C`7.800440PJ0000$0@ 0CS(00 w0p` >Y@`p @D0  P(0S0 |P0 0`P 6000#80p6, 000.0   .00Q 0 ASP0$0Z 0D: 0@H+B 0?R0S %5 0  0 30  ݍЍ5Y =00S[=0@h50Z=0@T50T=00P040H0000 P@00 0;0P00$ =4000#80P =4 0H 0 P+6P(6@%6 0PD;`4@@2 00 Pf00004 0<8 BlPZ 0H@ 0R0JZ0Sw#3 0T m=00S5 @0D;3d 0 [P`0 P,4 0<8P` B4P"H40P`<8p@C 0P`"P0 rP 0 P`P$=00S35000Xd 0 0DT2 00 KP=00P@C <2> `Ps V qVp$ @P0 ,P0T00 E#P00d0V0@DVt0 PT1d 0  0 PAp`$P0 /@P 0D 0PYX' 0 $P{=00@C00x,L,HD`l0*P#h0 (h%0$(x *8  ======VUUU  dt$,h@(t@0@d 0 0@`0 {P0 P0d 0D -0 jP40d  0 [PpWD @QP0d 0 00  EP 0DK0S3Yy 0 6P D{PUD " $bp`0W1 0E@GS E^=00SY4@`\40 P@D[ m2d 0 ` @ 0  PP:=4 @DK )Sd P0  p 0 Pv'4@DK 0d  0 Pd 40D; 3d 0 0 PR4 0<8p BZPH$0D P@C  4 P`1 P 848$0 $@ 0ZDZ: T 0 P&$0 @C40+YW =00SD0@d 0 06`P0 qP 0 d &0 cP$0@T 0DK*HU$` pPTDK 0d 0 00  EP =+L0W 10"3% 00;L0==0;L020 200;L000300;L0<=0;L0L10 0;L 0 P 0D$0SDvp@`T/ P‐0d U`%  R @ Y$ O0d  0 Pw@T0 +A0W 10"3`' 00;A0==0;A020 0;A7; =+L0W 10"3' 00;L0==0;L020 200;L0L00 0 (;L>L C +A0WD(1 000X(;A>A Cd8;u  4 0<8 B(P 0DK$0SPxp\7 `(P倐P 0V*  R @0 Y$ 0d   0 QP@T0- t9!?C0 S 0 :PuP`v2 0@DK1p)0Y 0 !P\=00S= 0@$:0J 0  < 4 8 BP 0Dk$0PCUQ=x@p@U31 W2 S0d  0 Pz=00S= 0@ ;040P`<8p@C 0P`qP_T 0 PW 0 P``PN 0 PF 0DK$00CS @;0p4 0<8p BBP0 0 P( $lDK`1PD[ 0d  ? 0 |P1PD[ 0d  - 0 jP1` 1P 1<@d `0DK P  0 PPH=@ 0l '0 >Py=00S 0d 0=0 0 )P`V D 4 $ 1RP@p` PPPP=H 0 0% Y@ *, P>P0PP\> `05/=0I 0VHD* $0S#@P0 Pv@P(0d 0>0 0 P c=00S1@1 x4d 0 ` 0 PU 0 \PP 0؃,P A-Pp@LU`, T @0 x0W``W0*.pPE^p P0070 2000 S037#Q00 ^00( (0( g 0nO /o/x///@-` @0 0DM0<000p2 0*0 RPr) 0 0C 0< 00 0 <0 30DЍg x O-H2HrP0੒ 0 M 'r $rgqC8(0B刀B$ C@$AQ i!dP`3 @@CB*TJXRW/Y  @0 SP7[0S  `  0T0000000S @B0?R0S2  Ѝ @0 MgP Y W 0 \P@D 0 RPX  @0 HFPWY @0@ @e0  Ѝ: %I$h DK A-`pPዻ0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@q( 0 p@-M P@ ȍP k`\ PGo4 (0 0 8 30ލpf`  0-@- M0@R0  IPP * Ѝ@Ѝ/ + Ѝ@Ѝ/fPRp@- `@P PP0 ?p@S00pPRp@- `@PPP0 ?p@S00pp@-@Q `xPPP0 ?p@yS00pp@-P@iSP p@ p@ p@-@P 0PS <0S pP 00p00pQP@- 0R R  00p@-PP Q@ @Q Q QT0 D32l00p4P IT0DS@p%P :p@-PP @P - T 40,D0S ;00p T@pp@-@P T 0 4. kl\ ʠ5 6z 0p0O-Mh0@ ,*4 ,?p0S @P000d0`-Q-+*)('&%$ 7>000Q00o 00A S: P @1T00PCT Љ0A d @00A S0P  ER  00A d0d00+S -S ( 0(00d000C \0Sd 0 d 00S 1CP' $ ZB 2^iS7 IS4 NSd@JrP2 d00(Si <010[nS  0S Ѝ00XS `d`0Q Q00 Rd000S 1ЍT @Z w 0'$0 Z0C0;01$Cy 0 "w 0yZ0ST 0SL %0jS 0JR0S 0R0000 @+1 0 y0 00hqPU 0 $S B ? @ $0(SY0SX[ <}@P h}P 0  0o}0S P {q X:`ppP)9pP0S t :0jSk&Bp 0,y[ 0 tPpqf yhy{w{u{ s{(`{PPV   ! 0| }PhI {@P; |0S $ B $R 0C 00CSp`6 bAQ`ppx BpGaw0 [ 0 0S0SIHK 0Se(|@P h{0P00 h!{00Yh0W h|PhQp(@0S   88Y'\ h {{{ { {Q 0JR0S8 0R000X h0 P'1 0 yH X+j0vp8p yx0㨀pSY  t6!:k cR R4R p 76K0ct0tj 0FbP 0 'Q0p0"00yQt \ QNdT0# 0 C Rࠃ R0d;0d000 C Rࠃ d$ 000d0Q0 `000SZ  d 00S `1 CRd` 00C QPsW0 S 1$ 0^0C$d 10 ix0Cd00C [ d00L0C [@PxT$$ ( R$  b$ d@pP{PPYp(@${PPNPt9  o 1[oPk [t` 3# 3#s\3X 00S0jX0S c0#3>oP P3t[1HL0$#40k60C40pc> 0ow'Sw`2 0SRF؃ vt 0 Nwpdf p`D"@2oP/ h(@yyy y y4/w  15w[_1@D0$t`#0}t 0`p aP0[00nt`p0 P @0(0$0 @00 0h0 dl l0@ S 0S  p0S46S  0nPO 0 v0 #1X\0%#4#$ DXB A< L5?6 ||N?55P9?0 ?MXkX(-0@  p㨀 v0XpSt剑5At v0 0SI&BS5t 0'́5fFp't`%E 0wv'[v(1pW{56Qp 1'G  .00C?o200!\ $ 10 S' 0^d@v[ p  2mP "2mP SV 0p'(h@t pfh |PR 5{nhrx0l p0jS'0 ` A V@du 0#$v5ft`Q  N$ZPZ Љ Z$\  Z ㉐Цd00Cd0nPd00d00p(000C?o200)0pS `(@0S0SL Vhxww w wXK 4 ul40S> 4% 4# jP0 46'4t0[p(@ k R \p0 p 0CuVp0@SxULt 46SG50jS  X Rk&PBp  0=up0p0(@t 46S60kS0S0S yPa p02p0Xp@q3 \ q.6B#: :p t0(g$!\p0p(@ 7h' xP xP@Xէ 0' 8h'((S   0&ht p0X( jRqlS@" k`Q0 00M 0Ѝꤾ  Q":?C0CS S $4c&&0C0c2///A-PU@`ḳ0pS  j_P 0S UDp@-P@}PyP0 S :pSSp 0R:pp808 8e0 @$0$ $f0 8|+ + xA-P`H@ET,AP: =P- pPW 0P P B $$P W 0 P d d0d C0 L L0L E0 4 404 D0 |* hX* ؖD4*  0 0@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-r-w0-x0 00000S wS -S rS  0S /xS  /  p@-^ PB2 pe 0 pP P//0S/ S S/0S/0S/@-@10@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 Ľ/d% | ??SS $0$ $p@-0 ఽ/% ,P P P`/AQ/Q/Q Q/?0 H0H Hp@-0 Q/?S0?/0?/|$ QP0 ?0/@-ȿ 0  A-gP 0`0H@p᷿ P/\尿0S調0@!륿@pp@-@P`M P0ES  aЍp 县 0P\冿0S 0 0 Z0 KP# p@-@PpP Q 0S P_!0PSY!p@V!A-PPp X P@PEX `]P@`( (0( 0 `h"  O-` MV " p@IV P4P @0SV F!0 `F`1 Ѝ Ѝ ` \    t 010/C. *     A-RP`p(M @x 0 @0@0 P0 P0T^ P@ 0 (Ѝ 0  T00 5CS /0cS#:3 3Q31:0CS! 2#0p@-PP@ T Pp S 0\\0 0NpD0D DL0 DT(0( (M0 :e\ e4 O-PM`pu 0FV"S00 0\ Pṷ@P-UN +UP0+ ̸pS"@0 P00E Qa0ESW0EA0ES70EVTPSQ @0U9 V)  `0q 0T00S0 S` 0J0 ЍS T 0P 00 0R0  Ѝr `0 ?0 ஻00XS 0A0C0A PSVr `Pr `ꙙ,M  4M00 0M0ЍT꘭ QO-PMp 0GW"S`@P-TP0| +T S 0T W  p Sv?0 0D 0  < P p P8Q PS \/ !Ȏ\ @00D ^a0DSW0DA0DS)70D S&| Y[Q PS \!0"00)"00 0S \0F0 ЍS@ `" ?0 0Ѷj  0 00 R0  ЍS@`_ i0T0] XR" A B0A PR W  pP ppLP0P P?0 ৺' @p` <W6pp6I 00 0M0Ѝ갩  | 0 Q?0S @-CZ-- Mw ЍЍ/G-PP`Q VY t00 !PER !U6@  4PG0 }PU pWU@uPp X5 00O  @@pG  p[00? O 0@003T0T TB0 V808 8C0 V ЃI A-P@H`H0``@p =T  Q AD Tp@-@P00CS0 S  P `0 Pp3>`@-@P DZ 0`00@Ʊ0 60 ੹H  D- M ? Ѝ0@- 0 0 MPP000@ T$  P ᶺ g0 0 0 ⫺| t0 0 0 30 Ѝ0T0T TT0 lT<0< <<0 b Yȥ T 4[4 tM[  LNA-pP@`% V. 0S 0S 0P Q 00 00 R` FQ`00L L0L 60 !V, ,0, (0  tH TbO-ß OM4`儳@P `pPdh V V 00/00 Z.` ˬP 30 00 [ !!.PQP\.Q Q :0 奬P 0H [ 00:[.[<##=[0Q.S7 Y_0IS00X00 I Z  0O 5 P00 0J ` `噬0 0C S:: ᬹ0  `   :[ 000(0,$P0z 1 !01 `0 $e P00 0 0 41 30)Oߍ Z[00n00<4 P@Sx x0x t( 015 T.R  : P uW댣 h  Dh, } T K|BO-PPM@ 0X0 X0 @ߍ0( 0P 4000 00 ` @ p 凧P 0 "00P ? R R R#[ 0 R@ 0PUI:PE0S[PEi p @  p[PEW R 0 0 ˹00 R R0 S S p.PP  Jo P ôP !Tk*0@ZU  0쁟pP`P R R R RZ T4*P  R`~pp ^ R  PErXA Hq g PE  W  A U*(rP@D `( p@ 0 @ 0 00: (X P@D pa `@0P`p+( `R`P P`zN P9 80 0PYP  0 0P\ᇵU 00S S 0pJu8 808 40 : 0 h hG-30BMPP040@ 0 00S0. S @ᬒA~ ` p0v #0G5P @T *X` \"T2P 0 <"$2 0 4 30Bލ 0    ! x5@PS `PN 8 0 0@PK` 0 00 00000 0b0@TA 0 p pIP* ᵳ00S 0  0pW0   0 0ȴ 0 0 0 ge 0 ᯴ 0 ᨴ 00S Sy w឴ R넋 hg 0g, e`eG-M0`pt@P0P0 V 0   0 pPsЍ 0 PP 0   0 $3cA-M`pP>@P , 0 (   P0@BЍ0, 0ЍA-@P M`P@pQ UV'0S9 0S0S9 P`4418(!<P P0 0pP 00 ЍU U, ֳ/ 0 0 Ѝ0S ˳ 0 00S000s S 04 P` @8 808 4 00y pcM /aO-DDğ DM<h@P 0 (50P P`sp0 `PP P ,0  0P0ß RR RR 0 Q Q 0 R R 8 $0Ơ$0@P`  s p0S S S@ 1Y g*@᭠@P 000S 0 R0 ?@B 0I  R06@DQ1   @D T!:  @Dp0 Sq CF P`0  @D q [p>`ڤPT* P` 0  0d!P1 0 <0 30HDЍ(PI `  AP@ݲ P1 0 0 00 J P`00 0 0 000嗲00 `'P`P4 544@ p@-M`P@ ),0,0   0cЍp@-M@ $$ 9 Ѝ蠑@-M`P @lpP0P0 ɠ@0@ 0   @0 PkЍ8P0@-P MP@T 0t  P00 000` P 9 @ Ѝ0v@TN 00̐C-a@P`PMD UL 1 0` "  p0\# 00 0 L R_0100 L.\3W 00 @Ѝ R0 XS 00 9\0 @ 0 m0 U0 n0 \ @ pG W QU ( ,$0P c#!$c4" 0噰0~ 3 Z3 ZO-ß3 0,MPQ0$00@`# R P P3 s/ 0 \#T3 0 $0 30,Ѝ4#(3 0 $0 30,ЍOCs p 0I4 #Vu T T 0@ 0@:T000 0A TC 0ŸP P` ` @0  ߢP 2 Z- @`V pW` f @$pT(",400Sm T0D S0 s\b @:TP ~ pᥢP :V:Z) 0S  $0R8#<40Pq1pJ04 ⡮Tb TPU 0 0@ x0S 00@ ↮@$p@.T`@$pTPʫ3NT| t| H| 2 Y  W0 /V/@-1 0,M@P0$00`P V(  0 0 0 p 1P"* . 0 0 $0 30,Ѝp0p ph0 +VT0T Ti0 !G 0 Mx UPx 0.l PU.D (UO-ğ lMQd@p0$ R P P4 !/ 0 p$h4 0 d0 30lЍH$<4 0 d0 30 lЍOyTdP`0H ЭW T T0 ŭ 040 $(,00h1T@ RT@P  0 q0S P q u ZP 0SP q: u00 Z0S PZ2U001P40@ 0b0T0` V?*:0UT0[ H"K 0 0PY0@T 0U00S 0Su0P040@` 0bu PU 0 S *  0CR00:80 S8:R 0 /HQHaH1P`I0 T. T0S% !1 0 DZ Z Z@P0( R0  KP P: 0 000@SP{ :0U0@Lw ,w w , SPR< Q) )P)O-ܥM@P pP" 500SL ä([] U U U ֮ 0 彤Ѝ0` R < @,0[' + P(P 0;/qp  00P @ P 00 0 00 冤Ѝ趜p  9P0  * R + L UZ p  0j9P 00 0 SM  00 0;/qp 00`PßQ <`V;᧡0 zP0 ;/qp`0 q 00 0`VßR <0`VßpX0PY Rf0哢0aX0`YKS  00Q\ <`800C`V0Z & "  RP`L0i?  `;/qp> 00 `P  @ P 00 0 `Z 00 gP'0S$: I y AJ0C09P`T 0S  0C`ß@1@!@G0 A`V0 Z 0CJ `J`P @0P 0000 00ᅣ0 0 g0wh0h h0 Y0~ 0 etr 48 ,KJ tJhJH E0 !>F0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L Y0\ U, ,0, (0\ P #=$ ,>=e0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L a0l ΧU, ,0, (0l çH "< 0=<0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0| U0 000 i0| @ !; 8<;0@-PP@ M T 00vP00 Ѝ0L L0L H0 ^T0 000 q0 S 4!;\ l:0@-PP@ M T 00P00 Ѝ0L L0L H0 0T0 000 ,0 % | H: :0@-@PP M$ U- 0S S S Ѝ0003/P 00S00 Ѝ00 0S0 02/ Ѝ0L L0L H0 U0 000 ,0 ަ `,9 90@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 দU, ,0, (0 T 8| h67 A-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP P0P L0 M8 808 #0 C @D 6* ,6A-PPp@`M3 W< T% rP RP P P ЍPX ; 00R X# ЍAt 0 & 0 0  0W 0  0 P@ J0SP @@& L65 \5^ 505_H 8p@-@PP U  ;p@|L L0L H0 ୥U0 000 ,0 ࢥ p<4 44A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0d 0  0ZXl l0l h 0OWP P0P  0D 43x 2L 32 320A-@PMP` 0$ U- 0pS SW 0  dP R`V* V V Ѝ1 00 0 /0 U 0 0 [0SP Ѝ W` K0SPV Pp 00 1 2T1$ p@-@PP U p@T }P P0P L0 ੤U4 404 0 (# `,0? 000@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0C/VU0 000 0C/Kh .W< /.0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0G/U0 000 0G/ -{ .l-p@-@PP U p@QX X0X 0K/ޣU8 808 40K/ӣp@9ꈿ 4-\ -,p@-@PP U p@zX X0X T0N/ൣU< <0< 80N/⪣p@b \, L-8,p@-@PP U p@X X0X 0R/U8 808 40R/‣p@< + ,+p@-@PP U p@'X X0X T0V/bU< <0< 80V/Wp@꘽ D+l ,*@-M@CP0.S00Ѝf@-M@p  B0?R0S Ѝ(0( (0 "0CЍ@+ X+ R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 /I L0 00/I D0 4# /0 48 )P @Qa P @Q`P P @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]Pj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b" R` V` `A ` @R^ .R @Ԣ@  0D0C  X1Ǣ(00$Ѝ00P  ` < V   \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00`D  0G-XAQ@L*p0S% RC @R`P000 0X: 000ܠ   \ 0 Sp00 @NT00Y0Sx x0x t0G/AS 0SPQP!00P0X (0@0,@ DT RO-P3P#RP3 M0U 0p`\ @W @RH R R4 (00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[Q[ 0 0K/⅟  Y*@T*0P࣠ 0A\ R!ɑ" 40S 04 0꠯ `8- M| ЍO-S@4M p0S0h 0S 0S0^P @^Z \S 0( X S B `$ ,PU P0S @Sf   [@>U `PU00 S 0W*0 B>^A ZP `00  K Z0T?\P0` RP SAS^01"0!0\VP`(00X0S $0 Q*0F S(0S 0 `(  0AU0S"  !  [)@ПZ0 p w(  ABQ APAU QpF  p   0B>SE0A S0AP`0S 00埠(00@4Ѝ R p0S   P\`B0[,? 0,$ @C /Q R!1 0R/Gpj00 0 0R5 P`^00j,@J0? Q0S 0 |0R/" sX \Q\ @ @0@ <-0Dꨪ @J jĩ Xp@- M P0 `00p @ !xp < 40 0 1 30ލp@=X7 6 A-P 0 0M `0 10@0 (q^p 0 ph0 (0 0 1 30ލo=6 D6 Q:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R~00Cw(00/C/A-@P`TP% UVT ᲆP @TP 0?Sp J00E(00QSp@-`P@ 円PP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1AP(0000?00Q @-A?SSRB 0@S Aޞ00ٞ(00/-- M/ ЍЍ/@-M@ {)p TЍR/0S0 \ S 0S0000/O-P M@P 0DT"S ` P-Ya +Y Q0Yc T@ @Q q<pjd`Ppgf<p_d`P" [-SQ& K0I P0aIQW0IAIQ70IS| V[SQ;+ :50S \0J0 Ѝ`Q0YXP$ A@0L ^P @0 0R0   ЍQz ,0, ,?0 Λ]T@@q | 00 0M0ЍGp. DA-00 rMPPp`, V4 @X0^00pAtA)0Oe `p00TA΀`L PP%0 @t0 0 1 30rߍX0X XF0 xV<0< <G0 n,;@. - Ƞ x  P 0   M Ѝ,  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/l, O-@SM ] YXc 0pS000!R !01 PP E`#3`7P*Q30A 0#1#2#4#8 IP 9   # U 0C  pSKVP0 0@pQ 0S  ЍT 0 @00Ѝ808 8@0 ʚ 0 0 A-@`Pp’0 z0@’$0$ 0 M Ѝ* T`{p@-0 000St@@@pdPddP@PR@P 0000 0) t {{ p@-P@ᖜ p@A-@`Pkppp0php ,T  2<0 w  A( <4&@-@]P0S  3/000S@|0 A-pP@`  @ 8000X@P p@-@PDPpp@@-@!1BMM 0`PF040@@@ @@9xqPpU h10S \!p0@  P8A0@ P< 1 0้!0 0 4 300BލЍP  @P  4/P Q Q 0 0p0 00P 0 0 @VO9H' ' PDx(& \ O-qQpMP s&Ap@f a@0` RD 00]M1PI 0SP p Z [ @@P t0[opP j0PU :Y aP``S@PP TP 0@U:W K0@@00ƳSQx00p@@(ЍPЍ<0 0$ 8% vupuDux T 0@-@PP$M U" 0 P' 00 0 P $Ѝ0`0` ``0 ͘UH0H HH0 Øpt|T4 X~ 0G-@PS  RL `10\0SA HaHHqP`p #)/0PS-00兑 000S 0 000 00 0 00 0 00 h G;P00H H0H D0 Sl%L@0$X ltA-pP8 0S@P$0S!0`PP @0S PU @@P G0UB00 5\@ 0@ P 0 000 ,0 q,q $O-XğdMR  0 S X (4`000SYD@0S00 0#003 0  0 00P YP3s003@0p0VQ QN  QI EP0S_ 3/0 0PY@@ SP00SJ" 00C0T@dЍ!B,@@@20\ 0,0Ss  R20$   @$(00 L00LxP 0S 0 <00@00<00hP 0 S@$0S(  ( @0P1 1S@i!1 0&( &0S X @L!L1L H0( X0!010 ,0( P, 00C0@g00$   @$(0qP @$0S(  ( @0{$  $(0t( tdp H(po $o4 nn $ hd 8a8 Tbl C-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0/T*0 V @0S00U0Pep 0PT*0@0S00 V@@W <0Pe 0P5L Q p O-ϟ |Mtϟp `0S㠐夀  V 00 0S %SP 0zS񏐆~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[YWVTSRQPONMLKJIHGFE/@;:97)54+1H*)('% |a@%B50\-P= 0 t0 30|Ѝ b01O3d2@(,  P$;,#"0,cR:,c2S<8-PP8 0 0C /@!b!b0C CBq\\<N#/3b112N 08<   !0cQ<5: cQ<0!<3b112N 0 [0 S 0! V*0`0S00 Y `|0 p` Q @+(0 \P0   V*0`0S00 S0S ! V*0`0S00 YURP  0S0  P0P V * Y ` R  ͖P0`p `0 S00C`  B19Q/0A!b0\P  Q Vx*0`0S00q Su 0  B1P9Q/0A!b0\P  1 VX*0`0S00Q YU0  p'`BQ / b !Q  (0 \P0   V,*0`0S00% S) Q 8(0 \P0   V*0`0S00 YUPIUPE0 p``p0 L4`0 S 1h V*0`0S00 Y0S{ 1 V*0`0S00 S V*0& `0S00 S0 p` 0S 0 @ qp  qp  @Q 0% S! -R S% 5Q0F. "x@V,h @P^Q  -R 0hDl -R P0R 0R R0Ģ DO-PPß M@P  0S0 0` 0  0 S  0 020230ߍ0 0  0 \ 0SV  R 0|0Pz ] pP"rNA U p"^QFVh-X0X0XQ RO Gp `VE 0FlQP  Fl R0 h oh0 B00000  0 .0S d 0 0w0 0 00S 0h ?oh2A 0 B U 0 VCT00 V=00+ T O-@SM@ 7 ˄ h R2?JbP0RRP=[0”` P4\#O 0CXdPReReCHDSL0P0000$Їp4nϠNl@ l lGLˌ##H#802c2c3L 0? ᵇß0D0pϠ'l ‚ b l C /B/`0`01>aG` 12,S"&.2db`3cd@G@. c 0ㅇ0#+:60 0($0(>! 0#‚!!!0C0"+a[oÏ(" ?00 #2>[?@G'PE@GP@2#"*" D2D0! 0+Q`!_P!!!0C0PVXi`v c 0 &: 600*$0 *>!!!0C0V& )!"2 >n:E.€Q_uk9"mn` Sc$IųQ\(\ףp= ף[ `[ Q(\)\ŒZ sc 0 ᫆8 +:60 0($0T (>!!!0Cl 0[+Q_("Y0%R^PP0 0 cQ @R0!V BqgqgXpC)1? c 00o0,!):60 0($0!(>X! 0‚!!!0C0x!YÏ1(" ?00 #2>r/D B 1?A1c 1c0R0B0$2@ 502c8"2c2A" "b1C S/  P008T2T!:#0 όR! UZ: 0"#2>"Q0030#0000T  @D0 S0  @ @$ 0ЍDv)1?c 0 0܅0x#):60 0($0#(>!!!0C Y38#,"0.s<0P0@<00000@<0P0@T 0 0@-pP M0P0@P T0S V [PlLPQ%  .   !0 P  0% R0 R !P  k}00Ѝ0PS, 01P0% V 0? VP'8R5. P P !.Q P V0% R0UСbFlh 0P F^P2l VS`@@0FSH[pP [ 0S10ƒ!0 hh "0Ӻ0Z  ! WX! \! !Z" <Z; R R >R@p9S*S0S -S0 C R0`@0F)0H`hlp崠VUB tQJ `1`!`0 t0 V00 m``@ vL P =D0C0CS\@0d/@D  ;@D0P0T0S00#  1 PWPࣷ@U|,dP@L0L L0p0 000\ D= px [< @w @-\F0 { 0|uЍ}0000@Ѝ谯 0@# @-@P s0#3@s0 ;0 {,P# p@-P`@o R T0U:T0T:p@|Wp@-@QPJ 00!R ! 00! 0S P A0Q0R0S`' 0S 00C000P0S 0 U00SpGqP#0qP `qP  \0\ \W 0G{  A808 8<0 ;{a} 00ꤐ! `NL! PA- R` P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ 110L00^ 0A pW \00W00S PA0ASP0@# 80p@#1! L0  A 0AԭC-p@0T@1WP` M | c|0S D!{00@ Ѝ00| J|0S   {|0 @|@O-P4M@p `g{0  00ShSf  %R0 0BZSZXWUTSQPM&J?>=<;:97310/.+,+)('%#" uqpo  #8qnR V@6VJ 0V & 0 aQ S  T 4ЍPPPP010 00C0B Q$RPMP00 x3 0S 0V`1!(  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S  pD 0V`1!ex$ 0S 0V`1!X V  x 0S] 0V`1!G +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py p p xp& qp jp cp"s R 0Vp0y  V@ `1 | x 0S 0V`1! | xm 0S 0pT  0V`1!u ; x 0S4 0V`1!f ; xX 0S  p/ T- * p# p$ p7 p#l x 0S 0V`1!(P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S ppx! 0S dp@ x 0S Vpz  0V`1!  x  0S Ape  0V`1! PZ +X PU &S PP !N $pG PD B P? = P: 8 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P  p  P  p pO p P  P  P  P  P  P  P  P  P  P 0s 0 S p  0V`1@! P u$Ry@00 P j P e P ` P [ P V P Q~ P{ Ly Pv Gt Pq Bo Pl =j Pg 8e Pb 3` P] .[x 0S ,pP  0V`1!q PE C P@ > P; 9 P6 4 P1 /O-@ϟ nM M0Pƍ0L@ H@ @0S 0L00!R !0k00 ` 0S   R  @( 0 ԠD E/|@ 儠\ x00000d0X00PU @%U PU`DV0pJ0`0S00`` pU 0j010P$0 0EZS-~+*('&$# "   q2>+;wQr+,jCv;<PjP    R\00sX @0S p^?P1rrPOP.>TqCuˠJo8qPF0<,@ LDLd. 0(4@P@jP@@0@ 0@00v@00E`PA@00E S$U $@DTX V4 $P;( x0,  y S !0S0q-0j00S` 0@TS@@n 0R00S @^?j40`,0(040@dPğT`P`8`4`V` h0P00  h0P00K 00S 00x0@0S0000XX w)9 0 6 30 nލ ЍUa  `xQj^_@TP841$ S0 R0 0S<000,00 BRyQ 0Qj0Q 0\ 0Q 0, R @DT L& 0 RP`0   $ BYS<000P U0E0Sx 5ht0400S@@x0S (!0(040S  pt0l00 \7t `R1t0P p 0R0 BR0SD  00S 0P00 l0S-0j0t0s80E P P`KrL0 p} 00 (@P000L ( x0, * S# ! c``(  x0,   * S !P 000SQ<0Jd`0Pk0X0\4 Rt R0 D8 @KT``Vڈ 0 R`0 8@V@DTx8 PX R    ` R0 ^/ x0: K[[ ڈ 0 RP0  p[ pGWWhU `PP@pGW   0RP0 S0$ B[c[=%   pK[   0R0 SZK[0 l& 0 \  05S00 /Tڸp @DT   0R0 S@DT0 ('0 P @ 0S0 [d0P000 Pd0P00 Gd0P00  R +@^oxA`@@P`yAD00Q@P0 S d0P00X0 DpLWdP0F0? Rиp  K[ 0Q0SK[0  T0^ 07jTc0P00 S0 c0P000 KS0 c0P000 N40jd0U 0TT0@P08040SY cP@@00 $ BY0GYڤZ `P@IY   0RP0 SIY0+ 0 P0 S<00\c0P00 \ Qc0P00D0 0CP0 .0>c0P00o x  0 R ,0     ` 0   0 R Ut@Tj D  0 @P0P0Sn bP@@:0d 0F? 00 S(   H0H00 `S  ࠡj,0(000S R``@D@@`-0  Pp0 xS b0P00% V -=   0Un000NS` `Ujd ^P0@@ `0T@P@8@8.8>8  08noT.T>T X 0.nbWt^ `PP@pGW 0\P0SpGW 00Pp0  KXb0P00 /@ + S2 ( P+ 0P0 M @ S (   J  @ S (   H0 00H0h h0h 0p ip00CD0UXTP, U P!H0HSH0(H000( D 8@BO] 0P  ,.> P`jL 0 IpP/  0@00!1 D 0Ki!1 8 0Ai8SV (P!NSd F? 00 SM ('Sz (.Sj t@0`H0 H0 H0 H0 H PH H0P H0?&k 0 0 0@|x x0`pUk 0 0 #3 0$hp @B0?V0D@0@|x x0Ap x0SeH0 $ H0b>@L SH0(H00( 0H0PH0 ] 0P H t@H P0H 0T0P0x0S P(@ 0 8 0@00*P00E SC@A@00A S$Qx0S$ 10P  SH0(H00( 0j 0 0 S(H01 0(( H00@|x x0p_ x0SH0  H0 @D@-@`P MDpE`@0p0 00U0@A` ЍD` A-@P`p+`0 ?0@+`O- M4@P`p08Pjrc T ЍO@3 0:ɳ` 0@|  0PL0ST 0S000p0t l P )Jpo  46OD5@DT 6 4>0.0>,.,>n`p.> 0b`p 0%P  0XPJ@H0DZ0K=1 PgTD@80( 000D00@COo0B SP@ES0C00@0CS% =010x<, 0  0|ЍOtt@@C>0 SA. @0c 0c6"u0@DT06A0@00DS0d0800800Z80( 0C800jD0=0P 0P|Ѝ00C?o200P0J@00 40X <0$ H0t0S( Rʘ;$04 S00Ӣ?(01 ?` @Р $0X  \;`p 0AP 0 0 0`paP  0`pPE0 0P P @Y0<040( 0X00S$00P 0 $0S00R  \ Q  RH  Skt0S(0Sʌ0<040SX0$00<00<0 ,00 |ЍO< R T RpPC^0P6Pe0080P?@PD 8 RQR00 BPE0A8 0DQ <0Sl @P- -`P) `P" Z  <0R0P   0`S80`0800P00<0( R$8 01"B`C 80@"xT 7 `p@ 0c 0 @0S d 7P$t7 $0`S uAo $0`0(0h0<0S7`01C 0 7 0؄ p 0  @0p`pp 0QPhlHؠ`P X%  t6 h6p`P 0o0P 0P`p'P  0a 0P H PT8SY\0H0v$[ 5>` uA 5E 0P  1P! \0H0V 5(0@c01 5 0$B  0$` '0@`S 0 = 008 P 8  00UL0SS@0S$0S<0SZP p$ PP  f00S0SU0S S P P W 0W9SpG 0P0 @}X$48 DP P! `P Z@P X0S|$080SSZPa 0$ 0C0$00040  pP0 0S 0PQP 40S0 RIWQQH R  R R S p 4PS oP9X 1U TU  p@ P p  0U (0000C0-$0S ` CP P 00 0(00(0100vT o`P <0R0P 001 `[ ?aCoc?`(?yPD?@'$>?5?@$@@0 ` 0<CP`00@ 0 0`p0P@ ( < 0 0wP  0jPC! t0( 0R?0S\0H008P@<0_X  L1P`p!$$0S 1 YP   P0 0  0 , Q0|Ѝ<0`d \ 0t0S h0 P(0 +Wp$0Z5 P\ U  @PT  PPM)@PGl0W0SpG P @GPP8   ! cPP, P 0@DTk t9Y h0(0 0 040 P0(00d80@ +P(0 0C (0P <0SPX0S$0000+0Q$0S X0S`0(00C h044  0 `4 0` uA-W0S0Sz 9Xw p90 @0` P@h010(0H0S 0S SL  0 `pWPA P 9 P @X APP @W>0S 0007 Qڶ0Sd46S01::S0P000ZbQlHP#h0 PH(0 @$ P !(0 Ph0/&$zT P p0SB0T(0 0(010P0 @&$`00C0X07X0$0h0 P(0 @ p@B00C0 X0|9X[ W1|Qʛ p8  &\ H 0[ 0P \0x0\00cx0x #H7R @ 0a0P04060P`$#@% 5\ 0T#0 0 (0P [t 000(0 0Q0 NS 0⊐SQЅP\00\88908$ H 80 0C10 ^ T 0#0 0 (0PA W$#`Pa @00C1 P0 Cx`p,8PSQP0/5P`wS!00`p,0#0P00(0Ph AR%Z` p P,b $0Sy 0 |wQ0n !P0 00C  0Z `p,V!0Y0$0X PR09PX tP000  0C吰0"PG 0SI @ 0( 00 0S90`p, $000P00P00Y!08 0$00# [00S 0 UY 00P0 3S 000 P  @1@d@P000!00t`p,uX0P Sጐ !000Se0SD00D0_0吰 0C0d@-00HO-@ 0Q@P MPP `PV  0Lp@P  "(%(!( Z"8J@ Z3pIq WG N@ "8!8P0LL#8S 0Y 0  0 Ѝ @P   ! W ``O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WI:Q0 [ \ 5 0QR T0#03\0SuWa*0 GV*0F@S3 F\   W0WN 06S  ЍW*@DPD@ Q0: Q0Q l  l>P:00XS Q0pBO)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0 O-M<0 XHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 0- 0Vp@ !@VT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0S PX 0Sa 4I0 0UX 0p 0 Q U P  U UE^ PLU 0CC10B P0DSy`0 S0 S C U 0S S S WP@"00ЍRq  BPP+\~ -\  L^ ?L NZ @\ #L@NT @Pl '@Ѝ \ 0P@0Q 0S00 LS S80S Q 000 0 b@0V"00@C `P `D21 2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf 0 S_ F XV@"00Ѝ@P0M@E  PL `K"V`pKW  J` 21p 7 ` PE~@QP!80Sj80S 000i U U E%P 80S800c8080S `VT0)  RP!@L#80ST80S P 0 0  B P\ \vj 0`e  BR "@` P3 `2 c 1P5  * A-P@p` P  0 P  0 PA-P@p` P  0 P  0 P0 00/ 8A-@< RP`pn3 ^ P 0 W@0 p0U0`PEPU 0 B P @` pV  0 B Pp0U`98C- M` p\ @PW 0  B 0C2S P 06 Ѝ6cz@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ S0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/p_D_p_A-^0000PbA1 !0T2, l!p(  T2,0N10C#10R! T TNNN1^0R @-P@M: Q @ 0 R Q t @ЍQ0@-@ @^3#1^HP1.P2 L+@L+l0n0|@- 00 M0000@  0 0 0 30"Ѝ| R000000 000000  ]X `1A-0@`T@p Tp P1 Tpp8#8S$Q-* q2 q: R 0X00SP T@X@@@  000COPX@ TppPZvW@00?2  0a\@\A-P0 Q@`%; S V45S pJV R00S D S0 Sp 7V pSp?0+ A-paPAU CQ R& BU50e0345@@ 0 QARAL^ R Q(0P&Q Q/.PU  sp A T/TA A Bu03>10^020B 0A-ˠ a LRCS0\8 \TO:|10@o\0 ^# QR=0b035PPA@DT3!#1^ !1. !2 A"LA^U /B R s၃p AT\ A Nr4̠ @@QPUP@E 0  T@T@?XtyG-@  \PP`p!! \Q 0S6C 0*4>70 (0S6C * Q 3 "\  \Q4>7 0$>' 0G- PXl X` PC Xa`  P)2Q>8 qD ?qV   0@)pY00 S X Y  0  $Šˌ '5  ?@pY 0 X``@pWVVA Ϡ? pAAG pa2GA n2.! N3! 3>aV@UO-T M0! # Htd{Ġk[ @R) X# ZHM R?[` k? 2 B0 `b>6> 2 0k 0K55[@Œ P 0S 0 ЍOE = Ѝ Z* XJB0  ?{D? ; K2 k404(; 0h# 0H<#@<Ƞ@ X X+0P QP 0`Ġb ЍOP  Œ  0ŒJ Q0 002 0O-r M0!J# DŠUe [Š"kX LTW T@ ^ 0$:[ 0x:820Ao ЍTL Y= ?Xb h? 2 B1 b>0>2 0h 0H<<Ƞ[ 0S   RP3P#(1R$1 ",!P2PP E!E2D5 ЍOY 0A ЍT PŠQ. ЍO% T! @I?x'?8 H2 h;1;$8 0d# 0D:#: @  @ ^ " 0 0@ D 0QqP/P / /BR30!#11S041 #<120A#ac/o P/R30!#11SP41#<120A#aK$00 0A#aAoToP Ϡ`P03 !0##1RH$1",!020 C  0c0C>b0//nP P03 !0##1RD$1",!020 C cA.c00 //np@-K@T0TUoJP& V @DOoUB@T p~T03@d0 D  000V`p@  000ppLhL@-@;0SM S^ #  0$", !0 C0c. =Ѝ^ h <$;S 4#6>Ѝ(R03:045S Km?S/ | ?S/  s;p@-!0@S. ) T SP\M M P03K:00a `00Cà0cT'R: QP3:PR 0* p\0D?oR20S p@P!PPE%Peà$!P0  Ap@CBCR @pp 0kk;!0A-ˠ_S  _% \ \ RP0V _R^\RF AGA!@L,lS^ Q03:00!00C0c @C0$aqW` }@~@pH? 7\S00 AQ3:bili;0S ;0S P /45S 0 ;S l0l !;S /45SP/P @-/Q ;0S ;0S ?S/P 3# /R /45S @- 45S /;0S ;0S ?S/P 3# /R /45S @-45S /p@- !!:S$&O3S%C>c0&0T @c PC22 Q pQpa1^ Qp|  000pPS X  000p0C?oP20STD|D0@-0!*P M!: %+ %U  C!A Ѝ0@ O Ѝ09P :#:S % Ѝ04>70 S-Ϡ M\Ϡ Z Ѝ Ѝ-Ϡ M\Ϡ ЍJ ЍC-M! P D$&F#z o \ @po& W \" Ѝ@U  Go R \B  ЍC0 W 0 0 p@ E%J +ህA!p p0#0 0P# 0S 0AAAЍCPOP 0ЍO-D!j,MF#_Vp `@$_% Y Y  0pOp 83  ,Ѝ@Yt ,ЍO1  0 YV 0 0 P`@E%(K$ @0刅ᤊ E `F 0R0O:p0?/000嫰 0 DF` 0 *) r\ Qc0S0QY0 P^ 3#P0 Y`F PP0 #0#* 0F 0Q0`,ЍO(1,Ѝ R0 #000!*R0p#!`!*iÎ!)`#Z Q p#pQpQ[ ` R0 \3#`   ! # QP!   00 / ɠ@- ʠ,ʠ\ l!Q  QP/> 4>70@-! # Ϡ\Q^ ^0030# P  00  a @-! # Ϡ\QP P03# ^   00  3 +A-$a$1`pP0MS3 U10AT !0S 000嶧 @T 0 0S00 0Ѝ@0!0D1S<000厧S 000冧@ t:` 0p@-@P0p R pPQ`00App@D `g80 0QApp@[ tD9` 90  0#10/ P30 R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P:pP   ! I`}P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  I  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1[ zPP4 @p PU `@00SaPP# 000S 010,PU 0C  pPph0iV0S <0 ,0R0i  \5tq 5`4Y3G-P0R@T`塢ڃ0TP$ Zp  !p0H0   a!  \2)0L0C\0003R @@GpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @ 00S 3 #V0`F`F` 02NS @0@PpP 0 0Q@3A! p@-@ AP`DC0 P `R C*\0 `l3DR<* 26p S0pR4 c5 # 502,13p0 p?C-@ MP`p7P Đ%T@ 0Y0   CII5` Ѝ P `!300S   Y0 C@@1`0S0/0 R /@-dap`@PM> L1P5PP3 pP-0S  Q6 +p 0: S/6P  8#800@ 0$  0,  0( 0 0ЍH00Ѝd0d dE0 E<0H00HO00 0@tSp@-@P =00CS00 P=pP0 =0 E xR@-@P 00CS00 @ 0  I0 EdRwA-@PpS 0rSL wS aS_` G 0 \`0S! e C+S ^R)# `0S``0[S0\S0TS0USP`0 >0 *EP$p@-@P7 0S= (= P00P! !& 0S 3/PP೼000P @ P *00 `$00aa =d0`` 0pk:P404 480 D G 0P0uO(@-@P 00!R !.P 0C 0 ;0 DptHO@-@P 0 0 S 404 40; D0 0 S@!: tNp@-Q@PPD 100S3 0 VT >000SB 0"$0 3/0P:06p00P @ P 00< R 800p40PrJm 0 J0 MD9P 00:  0@000 p_F 0 @00 4xMr-Ѝ/p@-@P@TS S S @F 0 pH0p@k,0p@,f0p@n6@000 0 0000/<P 0p/@-F/41S{ O- @fQM  Q 5/p <`?`  +dl+kh+&dlk&@kh+&dlk&D kh+&dlk&H$kh+&dlk&L(kh+&dlk&P,kh+&dlk&jh*T&li)j&+dXi*h(\g'+d)lh*gt&`dp0ex%j*(n.jd+)h`l'n&lx,p eT('lP`X d%xl( `+ẗ|x|FGEPKJ`DIpŐlĀH`ĐŀPt l [`0 `pA/`48pf APpM_ĀmZQ 0pkPUQ 0pkPJQ 0pkP@ Q 0pkP6Q 0pykP,Q 0pokP"Q 0pekPPQ 0pZkP YQߍ/DODp,qXaQ@-P @41S  P bP0iDA-4!@ pPP/1S 0L1P @P!I<PPPUQPMoPP 8Qp /W ,Dp_oR'Dp$Dpp@-@P 0@@A-@`֤P] VapPɤPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V C0@BC@SSO-P M. Sw$AT`p$a(q ap A`TS XX`D( [ʋ Q `0(qS 0 P@  Ѝ0Co$!?P" (Pr ^{ \ `VH$8 S zpVpGp@(V: ( $ AT$$( [ `( A^ \ :0  m @P C@@,A R$!H(1s V( T  0 @ 0 @0 @ (R 0Q0(0$ 1@($AM 0 qPe Qp`$a\??ht?DO-,M0 0 S ! rp2/0, (Q0 Pu @`P@P\%$P 0  CZB 0@PUpWW 0 `PM 0@SP㲀1UJ[K ,Ѝ 0 oPPu/  $`*pPB 0 $ `P# 0@SP㲀@1  P\ \4 \  ᰠZ"[ 0L `PP  gP 0 jPp@@,Ѝ$`  0oP   gP(q@GT 1S(Q0 @-@ ! \ @,A 0 ,1A0S@-@0@ A00,1R@-@1  @0A ,!A0 0O-`Й0S ]MH pPwq@P Uq  @| AP 0 2 p <* 4ɟ4 00 84  D5@@ 1@HPXP lV P0 S40R !Q!3^ thȟ ^ ^@4; P3Kp D H 0$p hP8ɠ3 LJ<,0($ ,pQPVNP P  0p pt 0} Vp 0Sm A/ 1w *4+ )4p+́* (4) (<' 0<' .4 .<0 4< <0 4< 0#<  <$ 0 4< $( 4< (, 4< 00,#<0 <400 44< <840 4< 8<0#<< < <08 8 8Ġ  4   4| pp $ <  x0$0 (p , ( 4$,0p ,(048 < 4x0080 < |@ <4, 8p | < , <00@)Ġ| )  p' pJ0  | S!tpH (( x 岠*LL,| , S[,CC r A[X3pWTA^P  8/@ PH( PD 1DpN8ɠ0  !NV QU0 aPP$4Q$jPy 2ŸrR@B  ` `]ߍOP.ᠡ?P| 0?p 0 p-p?P?Qi?pW/ <*  8004 D$>@  >e? _pX Z?00W?@PQ?PN?P0a{F?@A?@ꈽ Xa0lH0dO-(P`P10p5fS@(Pp6 R ؑP. ( ,0[ D`D` S`1 005,`5Ohꂡ ᤞP ر % J= ؑ@-@ 13/, (Q0@-@Q Z000 2> 0 O-ĆMS`p & 0 Z0 P U E Q[ [ R Y HHYYY  >00 Ѝ P 6&0 蕟 0 P@P 0 10$!12#P- 0@S0 2005V00t500l50 0d50 0\500T500L5000 S S T>00P Lp F 20 2 80p# 0 0cUP U\3UX# 2Z 00 20120QSE  000 1S 08 pE8`@V*("(R!3w0 .P0 "  .P 1S0S1S q/0 29 20 29 20S 28 2@R/S # *  ?P{P s R < "4 " 8(P0<S 0%4,<%<00.4$`<.,,4<&,| 4& 80<$0480 < (0480<,0 4480 <*$,00 4*,80 < 40Z$0SW(P 0X0 0UXS 00; Iv0. T:+[) P0K/S  0B0P00: S f1000S0I S\1?00$1$!$?0 )/ QP PV# 4- 㺺p!A10S X  \0 RK [ "P*100W p xP 1@om} L} xlhcTR Q0P:Q0Q:0@-f`* @-@@` $ @L* p@-@P#t+`P$ p@諻 00@-$M @@PU 0P000 00 0 Op 0S$Ѝ0$Ѝ00TP 0p 0S00000 0`00la( O-@0lMdP X0/ d8/dp 

P FU @PQ PEUp @P: 0 b" @2"b0 z"R @, 1 P 0TS@A T0D@  8280002R0 @ 0, 8#8UXQ U0E  1 e@Pe PU1P0CXS㣐%X: 0b 1"1!b0 ("H0CX 0@%XHXX  0PEX%X=0!1  0 PC 1 '@P' 10CSP: 0 b!1PP!0 P 1 PP @@ @ R 55`4p4|00,//4/hD/.0|.p@-@`PP 0 00(0`00Q(0pO-@`,$M,  弱 pPN 1p0C0XS%X4*U: P+U! @H$H @ 0E8P X 0&0!01@0 @ [ @KH$H% 0b ^! v0@0p 0$Ѝ 2 @ TQm10CSP:4$b0 9!8#8TQ0 0@p MP P ἑ4 0P0 0㼡 [0 30 0300300X%XPEY0 00뼡 [~ 0J 1pP QᴐZPEUP:b 0  " @QP@ PH 10CS@E*0D@ 1PP6 m0㼑 [0 `뼑0 [a P0I 1pPw @YT @D1 H$H @U0PE1I @c ;Z 6@@1!b0   &I0PppGw0 1 01P01  P0'0Z!08#80 !pаР @D1H$H@U0PE1 @10  TpP 10CS@:L 0 b# 4-L,x++**(п('0'/000/ @-@P , /!@ ( 0"O-@2,M0\00$0(P 00$` 0p@ @` pP 0 0 $1` !0`!%g#"," !00 &Z0e!e!   0 t10\0 0` pP 0 1 cIC$A$ 00#l! !00 %b !b  A@YIH$*E$00@0000000 00 0 0 00 000 000 00,Ѝ褽C-@PP M' $q`?pW($7 ) 0(0 `` 6`p` b8"#4b4# 0O V@h  Ѝ 08R(@R )p@ b8 )p8 b 0A-1?`@Pp @f(X( P 0刁0 0$0@pG0($0p ?W6@`G?`@`` 0$ <@P U 0$ ?pW ( 0$ q0 0$ ?W@`G?`@`(`@  0$ <@P U 0$ `R @-/ L@-@P 0 @ (o 0"(R @-/ /@-@P 4@  PR 0$$贷O-B@6\M0^~?@0P0D00H 0 0p00$00000000(0 0,0000(040,0800<040P0H`8L 0 @(00 @,0 0P$0 `0Pp`p000 D00Rh$7$)'90#%ɠ%'nj) "ˠČ 0#ˠČ<0 "(0   (&Ϡ' .,80  * $ )'& )80冼0姳 . 0<0 0 0 $0 ,  04 +  !@0 S(00,0403`0~?00L`Hp@P@`       @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP&8P[T "PP< !Q` PPqQP0yQ@^vp'Q禉0Q4PQႆ^P%"#-&S%a` " P08{t`p' 0 0 <0#0.0` `!4`0( PP0, !NP/*! B@$*n /!!bp`&,#@$`& '@.p p " @.$@0`@`0P$ PY0p(,[ P@`@@0@ 0 00 0 0 0000 000 0000 00 00 0$0(0$ 0(0,000,0008 400 40<0 08 <0\Ѝhp@-@@DQPUP`  0pRPQp bo Q0P0H @ p@<R Q b2p z@0A-1`@Pp fPX; @0D 0 #@0D  H00H0L00L0pGPpP3WR`G```@0D ;  SP@0D *H0L 0 H0L UpW Pz@0D q0 #@0D H0L 0 H0L W`G``P` ]@0D ;  SP@0D *H0L 0 H0L U`R @-|/G-@PM 6 PH8I `p `@) U Ѝ@-@P 4@  P 0$$萭R @-D/mG-@PM  PH( `p `@ U Ѝ0 ` a!, a c,/0Ġ@-@M0 D 00Ѝ0@-<PM0AP@;P񏐽mdm<840PLHD@<84|xtplh|xtp<84JIzP;DPnE@5Py|{xsrqponmlkjih{xizQPedMl]\[ZYXWVUTSRQPONMLKJIHGFEm[6Pv  6Py 0P9@0Ġ 0P%0H p Hߍ?CP 0P 0!@ 0\ߍ0= @2S, DP(00  E 0Ϡ@P000H Amp h0@ P000H A\p D ?| 0 0!@0H Cp HP ߍ 0d 0 F0y@0Ġ 0P`@0ĠSH@0Ġ 0d 0a 0^ 0[ 0 0 0 0O 0L 0I 0F 0C E0 D0 C0H7P* EH1P$ ? 0+ G04@0Ġ 0 0y 0v 0s 0p 0m +0j *0g )0d (0a &0 %0[`Rp a@ U 0O 0P@0Ġ8@0Ġb @0Ġ@0Ġ B0- 00P@ P0H Ah0pH0 <0 ,0p@0ĠX@0Ġ$ 8ix(p\\@4O-P$Mp`  xxUY xB@0S 4{@P_ WP^ L 0S8 ({P Vp5 20 R {0PX U`d  R ! @ W@ ! V ! 00@w x$Ѝ VpU0W L1P0 W@V ! 0S1 z0P` @V0  0S z0P`00TT }00XX  }W0`t  @Q @0` TT |$  h D  h8 p@-Pw00@T 03/@T|,PP ||0@T 03/@T\4wp|H00@T 03/@T$wpT d $ @-@M@P ЍЀ`p  0a ,p P(0( (A0 cЍЀ脁  O-p@R M ഁУP `A80 S! 0SJ: b 0 Z 0!80S7  0Q?0 M 0 0 Ѝ 2  Z  0  00 0 P 00  }P00 2  @{P   9{P  000@-0 P R@MPQ ! 0 013/Ѝ0s?0r? <P100@-@P0U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpC- MP `@( ``0V"pؑI@ T`1 `! @D  T@ p  PP Ѝ ЍzpP p`O-Mq0 P0 pG 0  PU @P U`1`!   @[ 0PU0  ЍЍ@- M` @5 1 % P 0 q@pG  P@D @PPT Ѝ Ѝ P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:y080pO-Ÿ2 0|M@R0t00P`[ 00S80S `d"\2 0 t0 30|Ѝ4P  =wP8 01\ C`0$p  8 0 0 `X: P8#Y> 1` ȁ1!004 04PU 08  R88P@PX`0 A@ Ny0 801248 Q!:D0 S 8=08P7y8P8vP 8 ` 0`P 8"0008PyP8l00`gꨴ \ 8L O-ɟ M@pD,\($ 0 PU 0H"4S3S1`90U 4000Hh00Q P.00e d0R 0h@00S d0P01 0CX 0 ?01H000 yp0 pS000S0!Q0:X Y 0c/d0*0c/%0  00S 0 Yp 0 SRPU d00$ R 00u"00'p7 0 2 30ߍH2SL708 R4003 4P0P\ R400P 4`400刀u@ 0  p 0`U:` 86(0_Vࠓࠃ6048 X00Sr  0\ Y``VP `PP$XY0”2  \8Q(( Q &P`00S 0 SRPU 00$0S00t8Qr 4Zx ` Z``q XPF 0SU 0 RP ZaY0MX  R+c/Q0 0( Y2 0 SRd@T 00$0S ,0S  !$0(0S (0@TP $ Z P 0 SR@T o00$0S?00 ZY0 0c/d00 p 8Q 0 SRPU F00$0SX00c/dpx@ X P2 `0 R(SYPR`WY`P2 08@04'wtRP?"wP!0 S (0( PC_oXRPU``  0S0S w\40 40 8 \R8 \P0` @ v` 0 SR@T` h00[@ @ hM`xt(0P`2 ` 8@P@,@ bY$0S00B 0X0 0 SRPU 00$0S/@ e@ ^, 4 ` A-`PpX@M@`@p000,0 0(000i0@pЍ O-<<ßp MW@&SppQ`Pwpm p' r20Q`0  PB@2B f 0S SZ0`|lŸ <@ЍOT 04SD:`XB(p~>p P  T0  RX 0(0QP0 P  PY   T`X/oT" R@pP T 04S`X# @@@0V@ 0 W 1@U V W(: 0 0 0 30"Ѝ-@@@~`@ T X _Y` `@ T`I`~U  001` x L   @- A0@ @ €1p@-P@Q v0P ! "0 2pp@Pp@-@P` VP(p0-P@  P 0S RP0/P*0    PP0/0/R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/@-4!41 0MQ020' 0S0. /!PR*/ "RR /@ 1@D0Q R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ կ  QRO-`P$MQP U  "100000@b0pRppP0@࠰P㒛+ ` (P   5/P   5/P 2W00Z & 0 0J AQQ0@A`HQ!Q0Su*R*0RI: d 0 C0000  5/P G00`Z, 5/PW W 0 S  0 0S Z W  0`F W0 [W000000S00R*R:  :W0 SW 0\KWJ 0\0 0`HCAQ!QQ 0CP 5/P ) 5/P \!0  05/ P 删  5/P 0K  05/P    5/P ڈ0F  5/P m 5/P  5/P l 0WC>0[000S0W5/P `0`Zo$Ѝ I   0@w N !0Q0 0`HCAQ!Q 0C!0Q0 00S  0 I 5/P n 5/P f  5/P s 5/P Fk 5/P T  5/P /K0@ᐚ*Z`c⃀Y*`  V@ `5/PyW W  0 T0  5/P  5/P $ 0 R0@0@ @l0 (0( (k0 ꠹yXypR Q0P:Q0Q:vn@-鋭C- 4PS@ M  $3/`t  0  QP` l4P4S  $3/000 Ѝ00A- 4dpV:@T@T 0P0S  00 S  0_p@P0`0dp@ B ! A-`M po@P0: St;pPP ˅P@ P 0 ) tdЍ\00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0 ?  0SL@-  00AS 0qO-4MS{@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0    Ѝ P@ $ 0   QP 1k$R P0)d 00@000dS0  pq0Vp 0  $6/Ѝ 0000}O000Q 0A00/0@-S@  R   0 cp0S^pp@-@PT @T 0 `pp@TƗP`p  0S S/P/$(0#   @// / ////  0S RP/0    P/@-P0S`@M:Q !S@Ѝ0 0p P Gl@Ѝ T 0 @00O-PP X 0S & % 0S" p@p" a,0T T 1 ! 3/PS00CS@D0 T,0@pVP ?0T` BB \|  i V`!  0 0C00`@000CS0 0T` @pQQ  | D R ! ,03/`PIʼ0@00 "R( Y `1`! 00PVQgRJ ,03/`PY M 00CS@D0 T@0Tp   P @0S*V*  000P@DS*`A 0`V:n0P 00``F0 ``i  0Y0C00 00oP   00C000Z`  000YP sd0d dG0 XH0H HH0 00_ 00[܋lxlp@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 V0 O 갊k0p@-@P0 O0 PPp` 0P0, @Fi P@ip R0  R/ S/p@-Q@PP7 100S 0  R 0   p0 0c0&   0R070 P @P n0 0 $0 ,0, ,<0 p 4i@-8aPP`p@M( W0 T8 p   ӖP0:*C/o" R/  S L 0( 0R Ѝ ; 0 Ѝ0 0 Wd0d d0 TH0H H0 ~ ;0 h |hThC-d#d3 `S0lM@PP0d00B 0 C 00  # 3 0 d0 30lЍ }0p0S6 `k0P " V000`S0p eP0 @"@2@ |0  $"$2$ 0 0S!$`@ ᾋPc 1 0FB0/Q/M-,+*)C'&%$#"! C- ##`00  00 0SP pj 0K `` ` 00 `LePS f̅ftp@-@0MPg00TahV( h0T1S Odg0T1S h0`h 00UTX!\!R Ѝp@f\!g00Ѝp@f00UX\! X\!0 000S/p tp@-0 00PUp@0f00TQgU0` TQUP fpX1P0X1g0T0`X1@ th0h 000S/@-@0f0X10CSX1 @fT1Of0@f t0 000S/g( t0 000S/p@-P@0sfU0 \AQ\ X10CSX1 p@cf`qg0T1Of0p@Xf t-X X0 04M 0,008 00 0 ,0 304ЍgT , p@-@QP  p@$幔 0 90 t,@D`lO-M8@qp0P::T0Ѝp, ,0, i 00[\[ @-@P 0S \ \0\ |0 @p Ƒ, ,0, {0 [Z|#O-PMp 0GW"S`@P-TP0| +T S 0T W  p Sv?0 0 0   P p P8Q PS \/ !Ȏ\ @00D ^a0DSW0DA0DS)70D S&| Y[Q PS \!"00"00 0S \0F0 ЍS@ `" ?0 0Nj  0 ~00 R0  ЍS@`_ i0T0] XR" A B0A PR W  pP ppLP0P P?0 $' @p` <W6pp6sHWԯ00 0M0Ѝ 0 0000/x 0<0/0 0000/4 0<0/0 0000 / 0<0 /0 0000/ 0<0/0 0000/h 0<0/0 0000/$ 0<0/0 0000/ 0<0/0 0000 / 0<0 /0 0000 /X 0<0 /0 0000@/ 0<0@/0 0000/ 0<0/0 0000 / 0<0 /0 0000/H 0<0/0 0000/ D0<0/ @/ /H-M3 0ЍH-M 0ЍA-`p@P0 8#@T0P@@-M/"O R ?#0!PO$ P!ЍG-QP@ ` S V " RpSR Pa 0Cj /o?o BR00 b8VS& ?o/o0CSpp0 c08ϠT \  Q0SpᢏVP00B V0 0T0d0?oc008?o/o Brp!0 S c10pV Veo0`08 @c0q< Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /{ 0@-@ P  000<L| / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 0000@-Q @% ST 0 C0 P @D^TPPU0N QP Q  00S@R S Q0 S 00 /U/ S R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ ^S QNP  S^ PU@Q @0S Q RU // Q#/  //s R RS0  0/U/00 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@RP` R V  U  R 0 p0 0 `\MRQp@-`P@ 0S0 0 0R0  0p 0   0L4R S 0Q00S0 0/0 0/0 // Q#/-Q S  BPQ P0C SP PU0-Q S Q P 0S 00P 0@-M | @*00jj00d f4 ,0 0 0 30Ѝ P - BMMRč `` T @P 1 P㈋3   Լ<0@- @-ßs M Mp$ȍP|`@M TF "  r" @$@`p 0 "l2 0 $8 30ލ ЍB^T"P0 @p 10 B^P.!0 e100A@  0 g P0 \ AL+\ -L+*)B'&%$#"   \P  i\\\\\92P q 0q  LgHJTp  o 0 %0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL00X0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@(@(0 00/8 (-$0$0 0M 0Ѝ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/괶 t@-@p@-0@ ,pnpP[0Ppx//////Dh //1O-0pPW`,M } n1 0 0(05/,Ѝ.x@PK 0S PPP S0S3*0! 00S S( #S1 0 0S  0S S * Rp C 0QW000 00 S0000t0t t0 00X0X X0 &w@XT4ȱ?`?p/O-QPHH͟ MQ0 Z Y< = 0 0 0< 00$0 0%SS  KS~ 0`  0HZSZXWUTSRQPMJ7~}|?>=<;:987643210/.-,+K)('&%(#" ZU  {LrX  0p@ 0,p,0\  P [: Q Q0 [4R BW Y ӄ ˄@T*a 0 PCUPE[ 0 [04PU*U 00H! 00H S[   / 000S- q0 .0 R0 b`< *XS 00H S400H S-l)l&@ 0S  Pu  0 P0  BU@a p @At `x0 $ ` 00sd 0SRk00\p@0 p0p R R  BL \ " [P* QNAQAH0 [4Q*BK  0 0 000lX ``k0p  0@ p,0, `@``  0 000 r 0SRk00p0@0 p` < 000s 0SRk00w P0 ΁0  c0RPpEWS @G B dW 5 0)0Y`  000 0 +003`00S 00*h5 00< 00 0 0` rkS P0  !  c  j< 0 r0l Q0P0 %P% :D$ $!Lp Q `XD$PD)@ dW 0c* P0C0Cs N 0000L0  C 0A b [  04AQA Y˄Q*Q Y! Y 0Y˅00 N  0000g0 [0K0"2 0 0 30Ѝ0 0 / ,  0  )   @0N` p0 @@ 2 000' [ 0 @!   p 0 @ Ƞ,Ƞ l h@f 0 0 e 003@1 0A$10!1  0Z 0  0@ 0 @!0 000X000~T0 0 Sꈳ (??ܩp7 43Ȥ2dA-@P@ `t0pP@PU J0PES 8/`uX@pW$0$ $:0 x1 0SS S 0R / 0R0@o/ @-AoO-,,@ CM Mp4čP`t0@ m 0 @0 44 30,Cލ Ѝ 00 00p0 `0pP ^t 0h p|L+  Y  0Y/͘뼤 l  4SG-0pS+ S'QU$ X!`@0`S  0P 0#S@0S 0S0S0S%  P V Q@0 R!R  "R0 R R \O- BMM!dQčHd2 hԀ&h Pp 0`V' 0  GUP@P UUU0 ZP<1PH <0 0 4 30BލЍ.( T O-LL AM @ MTč4 0Y/:0`x0(SP05 R%S3 #ttx0'x 0@T UU0  P pW t   0TPP D0 0 4 30Aލ Ѝ x (Rԗ  O-M Mϟt p / 0  @T 1S 6 S`1  0 ?t@X@0 0 p t @0H0 ^0S3 S90PpP@u` R HP' p 0 ] 0P R!R㇓ 2P PpU`@P0ST `u岀0S`V@ 9 S 0S< d - L - @ T p P  Tc0 <0040v?D0\@4 0` S1S < 300S S00X01< 021帑Y[0H0tSp080400SAT <0CP D0PpPPw 0;O8@  bP Q@O0P JP | 4 <0 @4 D 0 T<0D \@0S f H0SQ *<002p0^ S00H00SS *pt`P|@600P @9/P"8`0 0_PF 0  Ps * |+: 0 6 30hݍ ЍpW 4@P{D0Ppw} !㟃D0Pp0 e  0 : X0T D0pd4000S70X08<0PS\0S  夾P@U  0`F0P?$P 0,0 蘰 P(00E0, P [0.(  QO `1  0 T90 X0L@0g Y  @00@01$0 0 0 SO@0b0!0\p?A9c!ుP ;0S 7@50P [0T(0@' y  ,@0P@01 Q!  (8 0 {P0`1  0 70TX0 @00 00x  1 01! 0@0`1  0 (70X0 @0r0 M 00 X6 PW0&0< p XmyLP 00 @q @1W㲐@D0 `TPv? 0WP G  0‹2 0U 000W    ‹0v@1粐0 0 p5H@X0 m0@0! P0D p]@[0P Z0$0@$ x { (0d00@0Z0$0@L$L x0 AQR ^ `1S9 0   0@ H0N @@`Tiʋ |@ A`!!! Q=   30 @| X0Q 0H RC A ' aV *Pv|@0p t@p6/P񏐦0+S .0CS@0PPPU a0 2@X0 0`!02 @HX]xi S0\01S< 3`0`00S S8P1< `0 VP00 ` P101@PD  QhP p ` 0P\`0P 0D TP B("(R D0DI PN0d0KPI0@D@ vd06SF[D oꄟ ` hT  8CXP8<Ќ @l|p( ,`<dx  0NQ6pSZ06H`("( DP TP B("(R D0D \P0d0@0P \Y0 0@$!$ wVW0 0R 0`1 d 0 L1t0XP0 &0R  X R0Y0!0@! Sw 0 P 0 1 X@ 0&0 R  3 d H0S]=00^Y0T"0t"t %w4& G("( 0R00 P T B("(R D  R,#~Pʌ^ 0 ]0@ 0nP`P ~1011S1>00 m0 30 X0/,<0d0*d000 3@X@0" &0 R  $0 4 X0  00g0d0@0P wX0X$0@$ v0d0  `0 ^0+S .0CSB@0P NX0$0@% qvW| 0|p0 (0d0qP0 @ @r05 @XOvX0%0% BvP0 @  X0&0& ,v/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@~P$Ѝ0 ~P 0"c110$Ѝ000$Ѝ00@-$MP@~P$Ѝ0 ~P 0"c110$Ѝ000$Ѝ0M0- 2a@@0Ѝ/M0-  0/@A#b@0 Ѝ/MbO-@ßBM M 1Pd$č$p000 S00- 0p  P@QP0| T0T PN0P0A !< S  0 itT40 ;" P0 0000 ; PPi P0. N x`10$430OBލ ЍS  |N 0S0Q4 Q. Q( gN      , "44 .$$p8(#8"(s>N:N7Nꏐ묅 $@ @ K ȃЃC-LLP AMM č@`p04" R3 s 0@` `s P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R` @@H 8sD D sM/h T1ā GL O-嬡 AMM  čRI}pPLpPG `1tPPB t @+05P7 0S4 `  0S+ 00@ p(P00@S 0S0S 00@ @K @ P @ ݪD ,0 0 4 30AލЍ趏 Ѐ p3d O-ß CMM`,č@pPX\@?M0S  .S@0SV:T d10S#0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $L000$0D DR @@ 0S+ .S& 0Pʞ0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@1( P/d!  0Sx0h 0@$0000\0@P@Tk0!0$  00$0s}0S 0S oLV0 gO0  ^L궎 ~ O-p0ß\M P@`'T V  0 #à  #4 : 44U@ 0X 0 P\ЍX20 D 8  0 qVX0 0 0 FdKP0x 'xLL0SUPP^   B RX00 0 BCKP KKKK PAUTѺ'0 `F 0S0   K K K0 K0S 0 w <PAUT0QU} d0d d0 6\ЍP<0\ЍPHUT{ H<{ydyG-@0`P p1@D T@@)K0W K0` ' ~K  @`DyK "440(",40U00S PD D0D @0 (`txx(xHxG-@P` p崒Ḃ7 F0S@`@0WV!< 5K@1K` ,@F0W0T0S?T0 *G K0U0`FV0S d d0d ` 0LR@ @0@ <0 z`Twv=,wvvA(0`( "4`43Z1S//O-0P䡐 M0S5 @@d@t@`p S S0  P&   P0 PI  P00^ 0  SR 0  SRS ЍGPd1 00d1 H*p7P0 p  ŌP  ྌP060 P0 o ঌP  P090\ o000<oi0:0  P  |P090090| mP010r  cP020h  Y0P0Z^ d@e ?R? # *M 0 2M$ >0P0ZC @J ?R? # M 0 (32 #P+ @ P010  P010vvv@Avuuu(@4u?PutTttt>>\tL"s!ssds@-@HMiyxDy% |Ô0`p 8   0  xa 0TyxHЍЀp@-AMT x 0P0# ``00 0 y 0 0Ѝp@@@- 0 Q0|MU0t00& x 0p`0# @02 L @ 80 0 t0 30|ЍPPfn 0n @A-@PNw 1!01n0SPpuOPp =wp0Sp@-Q@U x3s|p O01P O01000pwcxVxwP //IP //oA-`p@0.V0PVSQ@ PQP  ] Y0 0O-P*: 0MM050:@00~H0RT 0 L01)0`,4 05@ d!A  d!. 0`11110MPx  J0@ʏy p d10 d1~ P  `@ uK`0D@SH _H S`\  S S00 Q`@0S SP C0SQ0 0CQS000008}nP PP@0 0+ 0/P 1#S;S 0x(S 0l(Sw 0`(S: 0T(S 0H(S <8R0sS2 S S(  8R2 S S0S0 S S SS@@ ` `0J_AP`@Q"0A'A+S? d7R2 S S00 R00S @0 S S00 0S S 50  00H00@06w 0" 0KPj< Rf0P 0< 0R@p0 @PP0d!S 0 0 2d1 ) Avu0 |3墤1 |vpA τ0`0S V `0`SH@DH` .S`0SV Pp.`FV00W0S 0 0]P $ )0$00p4 0 5 30܍Ѝ4 RB T T Z|44P00$0l40p000Pp(`, T T@ TT  ;T RO@T $0 ` ;T 0000@@T P 0 0cP  @0劁 $h1 P @@T;T P3P0 0000@@T;T   =P @ Zl@(`,0p4Pt 2R2 S S0Si0 S S SS@@_  ``I _AP@`0D`SH  \R?* S S00 Q`0S00`069OP.P `I1=C` lrDQ XaD@`kQ<d0 SQP@* P  @0劁h1P0- qA`>`Pa 02 E(k k Gmm0 domasearnamesortoptionplinEerjH-iipe listhTch4eLe$e!1 p@-P@hlHM QP  T 000HЍpp Qx#r cEuV p 0xP00ZuPT $000HЍp`A-p RP@`0P  R P  @R0P\ R 0  0 O-0PQM 0 |4|0k0P0 pI0P0  0@P($    06`P ;hPY 0& SQ 0 - 0 !#Y㌰pG 0P ` `P hP0`S Y 0@000 R# pGP @0Z* @ $0   Q A PT pG #Y ^[" 0 jKk00pQߍ @ $0P PEQ*$P0 0 02"0 #U  PY a 0p S : PC U 0 :` PE0IⴰR (0 ` VPE$` R PE` T$ (  0 PE a T ` Z  0  P囡 0 0 Jv 0 Jo刡 0 i d`_@-<0< 0@P @, 0 0~jY < @-$0$ 0@P`00Y 00/ @-@P @,00Xj @-@P?00p@-@PP  P  0 p 0  |0 K h50\p@-@PPM( 0 ` 000jPP#0 P 4P  0 ЍpЍp@ @0@ <0$   0 Ѝp $  |4D[@-A`P@ MK !1 |Q0 Pp 0 RpGST `Lp? Ѝ4A@xfP! 0rfP 0S@ R dfP@  0 `K Ѝ  0 K Ѝ|0| |0 dd d 0 `uK`W Dtp8Z 7Z\Z6,ZYYhZ6Z0A-0PU" 0U"0PUP!q@@``FHP $HP 0!E`1$(`P 02~Pܷ'' O-Ff@0`S M, 0 4 & $0( VFP@RB 1ؖqY\0i(1<0 BRS %+38<  50(< 䅟 1 c0Aş0 p8'(p4 < P 0(0 P| t hup40Sf0S L 4 0SlX6S ,% 4 0Sup00S S504 RS 4 ,00,000S4ğ0 ( 0XA3*0210S P10q S^P40( D40 0Sp (4041%40(8(JiP0440^30( p ЍqR 0Q*# 04|3p040(P8p!@(%01Rw4#30<!^ ^ ćrp S:p 0("< !0(0% P^4)|20(  l20(<  X20(<  D20(< 020(< 20(0 208(  0聟0(0( 10( 긁(0(10(0 R 00! 0t1t00`10Kp (4p Ѝ8p N3p 0o^4nqp2  Z 00K {IT ض  ,hD,WĴP@``L8 رxdH$ DRRQ.O-,1M0 X A*1a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y$00 Ѝ贯|`l\@-$0 0fcK  JA-@@`V 0 CQPqFFP pG PEP 0`0,O@-@00 R \\  $0!0D0 0@ ($ Tꀭ,@-@PL  0S  T0S@FF@FجP/0-` 00 0Q,000 P0($0 \p@-@P0`H P 0(S  1T  0 $000`pԫp@-`0P-D@P P(DP 00p.M A- 0@S  P t00  ( $   PH1H0?:Q@ Q$10 p?  960@`@0O-hG ,,D0ħH 8 Dt\DpGFܣHءBXBAxB@-@P00Q  P    $00<0 0@ ($ <ܝp@-l@@`VpPPp"0U1pPE1PSp ( 0$ 0p蘝QA-pA@PT`QV0@@P  0 p"PP``p`@@A-p`@m@PP T  0 000P   jg??@-@@0/ 00(/؛000/ě004/ᰛ00/᜛00/d 00(/t000/`008/L008/8A-``PU 0AP ppR0AP[B404 0 ,(0  ?hAEB/-< <0  M00( $ C Ѝ`0 <,>@-@P  0`00@0 50 8=@-@Q 00 2  0 O-ts`Pp@M 0㒧pF T 0S000 0  0 0$ -0PP 0 2* "V &= " 2? 0  0 qp  Z Z 000@> 8i@PЍ <R 2"00@)X 2: 2 (jP0 0Z 2< 210 010010 010 0|100t100l100nP 0 R00   0T 0 2 13/pTb0-00ᄠPP 02 2tE00B@V>@;0S{Z} 2: 2d ԖPv 2 @0 28001,006 8<,C-@`pQP M 000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH P (0$( p& 2P ;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p  ЍR @-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 p 2P 00 Ѝ  ЍF00PO-1PSM0:00 X1*q`I`[ 4p@ p W 0 P tZ 2< 2ЍЍ'?P O-MXr=*`00A̱PpP W [K D?@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 ; Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR J0  PpX U"B Ѝ 2< 2 Ѝ>P"! ЍG-pZ RbM'*Q* U@0U @ RD0  P X U 2< 2Ѝ@EЍЍG-`഑p 0@M PP IP!X%( 0!|!0 0CS @a%XàN 8#8S0C! 0 R 0 1P@10CS㣐.* 8#8 0 BR ("(R B("(  0V08#80R!2 B0C!2pl0l l0 T T0T b 0808 80 01100p@- @UP ` qPP  &pPp@-P`@Q 00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M 00 Vu 2+ RI 13/p)  0! 2$  00 3 p`0 9/P 0 9/P  re0P 4Ѝp$  0qp 0 P 2: 24Ѝ?p`(0 0,9/P 0 @P@ 0]AQP(*0!  R `  8!#8S!Y ! Y Y0!00C0 b0  0!00Y``Ѝ0E 1P 0UY0 0 0C0 0hQ[@@pGpЍ( ܼ+G-p`0@ PR!@DH$H0 8#80T@&:@DH$H8#8p@00T`:P0D0@l0l l l0x P0P Pz0 n808 8 r0e (H((((\(G-P@@ `RSZp? 0ഐS0FI S0) 0 B ]0V FA0  0 \   Ƞ!,ȠCC0R000 00@ @@T*80`F0C@J`80000 Y 4), ,0,  0G.d '&G-M( y\X`PpL \;S<03%R @@zz0 L l3< 0?6p P4,0SJ 2 R ,  0#, ##$\A A0AW@T00X0:(0H8#80ᴀЍ\008hS <0 PM,0S0S ,!Q #$ 000#$ P0A 0S/ S!8#8 C("( 0 0 0 b X0倀ꁟ@0@z{@0@d d0d 0\ H 0S0 0iO00$P$#L$#51Sp@-@M P8aP8 \,0$P8Ѝp<;/G-4Ÿ`0 MqMŸY w @P^ 1 R2X< *5S0@ZZZ0 Ϡ B Ό b3Ό2 0N5pE YO\!L1 0  0 30H؍ЍU80`J8 ڧ8000S   "4<Ġ"< ̌Q0 Z "Q Cttpp귞@0ⱞ@0O00Bv  !O- P `C8@P H1嫲p0q1 I JE08 10000N`ⴜAO-40@S`p M0S0040000 PD 0$B1;0C10 X0 M ^ X @[ 0 PX!B! 0SR|   R 0S  "  0!2#$ S C$ U @ Uc SR]S5X%XqUl 0 SPd 000@@℠0ᄐ000ಀX40HPIᲀ0@ ЍX D $ U D T RP1 PD D00CD0 0 10CRN Š B QP" 8#8 0X%X!1  0P!@ 0C 0$ 10C0S  0"[JPL Ѝ1 `00 \@0B YPUڸ1 0S 0PŠ!D PD 8#8\1 PU PHDŠAD(1  d,O-@PU`p 0M1^000Xg*0Qᄝ P @PU \000U00SP ^h PЍ`0SP0@ 00S"@P 0S00 000Sb 0 P00080080ЍO踗 0008(8ќ40PЍ0@0 00^00` 0500C8#800嵽 0S<:00C8#800娽0 0PP 0 X0:0 H0ಀ0 0 ` `x x0x 0 70a X X0X 0 0V< <0< 0 0L Lĩ $ 0A-% !@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!A͝pP 0  < 0ꤨV0O- `ƟtMV@ `Pn0P(0t 0 f P0 l (h0&h 000 00p0 R\H@ P$P  0괐T ` @H$H F  00D00@`P  Rڴ R  F@D 0@IHP$H A LH $ (`(00P`@@H$HP< 0,0040X0$0800CS@H$H@0S,<0@0@8#88 @QpT0@:80@@@00, 0՛0P,0 \j 40 S)i 48,0400<0 \  )PfP0@0Q0 00 R P ` 000@H$HPE08#80 ᳐Y;00S pB C TpP\XO0S$0Q0 00 R 0P 0[ 0 $0I 00040少S,08400<0 P6PX40S 480,0`00 0 0 0P)d0S 0% `0[$0 h0`S,0 40i B("(0Y @: 0I00( pഐ0000 000tЍ( 0d d0d 0\L 0!H H0H X 0 (SO- @\T @0`S0P p@D%P 6 S5P( [  8#8R40  q 0(10S0 1$10$10 0S0㰚P 0 P0S 0᠚P  00S 1$10$1K00O-MYP@0 00X00 ``FV*hY&hz |$  t$ l$  @ 0ಠ0`2p PP Y#```0S S 1 !* `p0 pGx'x0H00pF0F000 B 00p0@000 ``FV&*hY&h/ V 1 !0p pGx'xI̺0`h&h08#8አG0Zp01`:0y 02"0 hY0&h0``FV*hX&hZ 儲2 0 00ಐ0X0p0`0G00000``FVG*hX&h7 V 1 !8#8Q0C8#8 Hp pGx'xf`0`h&h8#8ቐG0Yp01`: 0 3000SL0`0F`ЍЍ00PP @0 0 0 0k 0`0 b0 0 0e 00 0 hX&hcL D4   P t ,      l G-p`P@0R"  0S00 0*U@ qT; P0X BPR RQ00S0Ӳ00ô00A0 0!S CY01 *8#8  0000;UU800C80h0剐CY01*P0&< <0<  00^ 0 S ಐL O- @ T @P@D(0H$HS(-W 0PPI$ ᣘP! @T @(0@DH$HT `pV T`  0 P``p@-P@ 0^\ ^ P0Qd Pp\ p pG-@` 0PS 0S  0QC@PS"  00S ᲀ\: 0 BS P> 0 \'P   00(!S$! 10$1P0 P @p0弐ᲀ 0p 0 S ૸10 B\x ἐ'xP  $1 0$1(!00O- @T @0`0CS0P@D p M!P 3 F2P' 0 0  dP 8#8R0 ] Ѝ0 0S0㦗P 0 0PP000@- M@ P p10 Ѝ0O-@PM 0 0P`Hpq > P] P0S "2  0D0Z0 0 @ @ 0 pWU@0  Ƞ ,Ƞ pG W04*0@p 0@000S p0C8p#8W㲀Ḱ04*0p00ᴀPPP D0ZPPЍ0 P P 0  0 0  0~0 pT T0T 0L p0ꄔfh(}̒\G-Ÿw?`0 (MR$@p2S:0JS P P崀2S (p 8 P ZP崀9 Zp1!pp BRK:0CS㣠:* 8#8X*:1!0C8 !# 刀#( 20  2!1 0 $0 30<(Ѝ( 8#80C 00C0 0b 8#8X*0 pdP202 qp 000   ` 0cnm , <A-@pPQ`M I00 2   Q `:1Q嫶0" Bf1"000 VI VFEXBAF?0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " ЍX00Ѝ0PU Q:(0 $P0PU`P.P   Q0P 21 s&1@--M0  @ rXh hP 0PSP000S 3/ ZXY8S 8 80 $0Q/ $0S/ dl<<0 0R/$ 0S/Ф D lA-@T 0S{Jp`/XP0P@Q0@ @@aPP 0A/P v&O-@$M`Y1T :6pܴ4$$0Rab    XpV=uBP b0@SFSCH\p 4o03 3$$ 3$ $ 3  3$$ 3$ 3($ 3$,$7 `3$d `O$Ѝ $  ( ,  C # PU! +Pp "PO@P4/ ` R密PxB `  p  BR pPG Q]($R0 U tWS UX,$R$ ^SJp4 IOJp0 W$RD $pR $R !hO&@ $R $3Jp P$R& U Q R  T$LO&@ @ $.  ` &@ T `   ;p Up$R UMIp -Ip P  ^Ip U?@ Pz?I^r.,~&o&7|-@v&v&u&D}&h*Q[zp?:O-@`MpPW0뤳3#@ @2p#x3B RP!GP P( If@(hPF  H@ P8Lt`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X @s` `Z`r`T LXPP   u`Pd 0)ȱ0V!Xq``pWpP @ gs% B RTppp pppLL 0S ȪU X W0S X  R 7/ P  R -$ /  $ /  :P`0S PsX Jr%|-o&0<#T;zp,O-PyM`V/0p I 00 00 3p8 PEU( 0Ra S 00 0 rvPePRP&GPhKf0@SdlltlllllllllH0@ Slll0lDlLl\aP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0Sp 0pSppU0U PE4U& s P Q厽6P/[  0001+0SdV0Sppp C C0S S/R <[Vpy0SDUa(0S0S 0 0 :Vp !r 0: S UH/[0% r 0V0: S0( 0 000JPU   0P0 $0P 0)0P @/P050CS"tTTT$ `. j f `00ާPP0S Xq0Sr 00 $  B R0\ L` V `,Q& /0  P@0`0  P0` J/R  S/R/   C  R: x ` , 3 0S S/R$ 0 SR& U0sX/ HL!R\0X\!R\  X00: S Ũh C C `XU0: S P1: S ,T : S!  Sn  Sf G S_ S L0S !AIPL,0SK HKF0(尥 0Z  Z80 S80p1p!ppQ  UP!P1: S *00Z0S 80 0CS!800 FPR X0|S a 0S !9I0S !IzHr\&5o&Bw%%0zpT, S"CiP& 6 ?O-@P:TT-@&m1p8464f@(FIP60` V J0S0 dp `SP 9J4P0805H`40{JP0%.(0@JP7EpP0X T5T%H`RP8P H04 0, %43/00P08004 &pJ4a 0V0!pJP (jJP 0 00000 dL@0D 0 LP0; S @,0(D 2#!H8 01/,dP0`$S2`` `07Is0 CS 01#SIP0 0( ,S* B"!0 0 WJ8PH0U 03/p0SDfH0803/p(^P`؂G0 `0d P 0 S * X  0 $03/0  0-Q3  R H)$K0  0 -1/ )P0 0 0 0 `0d 0 `0d P0$ ,!I 0,ؠܐPYZ0     00h0 l 0 h0l   000 RJ0 0013/t S.I S>3IXP\`0O ( (0, PU`00 XP\`> ;Fro&0 '%`'7'zp'@'!!\'81 O-M Mp}R(b+$$H$ /p 0 Q 0  s0(0G@-P񟗙444444L444444d444444444444 $@44X44p0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S $AnPU RnR oR0P<0,3`P  :(P8(n`P,PPPP>t pIER8S;T5P3fP<a4 1S}H @0R. PV`@0S0H0S 0  HMP P 4R㓥' FM )P3mY`, 0| ,0Sl 8 RS P0SPeP4PD0S $00$C`İPE@DᲴ0p/SP/޶P墴0 S: p  ᣩ,mPPUr'o&A-`P@ML D 4 0 uMP  L kMP  L aMP  L WMP  vLPl h3P0`3P P$PD3( 0;P+( 5P3( /P7( )P;( #P?P ( PP( P P8$@Ѝ(P (PT"!(0S (P(0S (P(0S (P(0S (Pq0S ^KP!0S0S vp X~`PPa D1R`ᷳPU 0E /R m!P(qPU  00,0/00"A00CS$l8twP0$0u00S pUhx0s00yyvG(v& PG(X |% . x'pК'J A-@PK$`p )p 00S V^PhLP PP ``ꞟP $ڴ 0@?romo&@v&u&7O-`pGMPK$` `  (p 6Y.0S ЍfP WP! PP p `RP dP vP iP0p0 `rPxPpp0p0 p$p q 0S!R  VGeЅPU KP$0  S0S" 0帲0@0S* /R! /00P0 .R R .R0S[   00 0Q@  0P0SP$0`S0S@ =pP T\\PP0S <87g50C SV<<<D<<d0$S P P# 00$ @# 0 g0S $ ?RR00R0SV3 $ #  @0SX  ŞP i 0!0 0C0 MJP 0S' M!0S 5S 0S 0SJP 0 0~ zX 匞PtI0SmP h0S 0Sa 0?S] 0S`>ܿ0S ؿ0?S Կ0SS I# d!000: S0S<0S 0: SMIP1 0S!  S/o" R  +P SI 0SaJ∞P ꉿ0S 0?S 0S 0S H(ro&zpT, A-P@I"p` &p 0 R1 P0C@P=pPp `nIPq PW` /YP 0S 0S0PSIPV 0rWo&zpp@-PM 㯾 7 $ 0lHIPI@ JUITD0 00HP00/CE"器P3 FP 30S S! S  3I d3! l3 00T30S  R 4#6 R #!SR3G3 3 20S (f 2 20S 0S'002@T$dP0"@=B00CS00  0 D b0S60016 R0S 10S<00PT<0 01 10SQ 10SM(x1d1POT10S P10S l1 `1 0S  160S 8 @$1 1I01뮥(  80S0F0S 00q0S0S 00 @`|P@ETo*`O(rp p%I(I(R(I(I(I(è |%% U(%OI( в G-@MP LH1!2br@@0 S ṯX "m%pC 0 L1 0P|7x HPd`x HPLH8 HP4T; 0DS 00S8 @0xL; 0QD0@0 0Q)@0SZ L kpPUBda0@S񟗷@|FP \*d@@Lx P P qP 0@0 00 S@LgLw0@0 00 0 ZPLl|` D0S hx !HPTU;ro&o&444Bt @4ht@4t@4D}&4|-zp41gt4@-vGWF;O-M pmGtR @0o0C?o`DT20<$<4@@@ !p$4 4 00S ST [@ Y`> Z``: cRPGPP!  H@ P"!!!!!!!("!"`hP dP fPvP$@``j1 00T 00; R4 : HP @ A0S #S! d2 00 0 (`PXL 0pL#>. ኰ P (wp wp  (Gp  c0S<0 0@0050C SR#$$ $$$$$$$$$#[ g@P+0S? 0b$ p wp0 R qX  Pp P    3/P00 S ,$ pw tOpZh000S :r|W(5%o&5|-# #$<W(,Tzp;O-M MPPJ ^nP5 00 5P5005P<:0 00YP  TpP pVἶP Q ObA@6P񟗹P''`''H)'H)H)'H)H)T(D()((H))H)H)H)H)<'H)H)H)H)H)H)H)H)H)H)H)H)H),)4)H)H)L)H)H)T)`)l)H)H)H)t)H)|)H)))0WS }055050p "pQ Q 0X(tȟS SSy `a050505484 @P :P 7$ ط Zp0"S aꐷ Hp 0"S hL 7p0"S P 06ap 0z0500~00v01w 00 0s0g0e0c ^ ^  ^ QS00 00055e46V0 oB9WPE2%R U%RpUQp0%0;}TP%5S 0nEP80: S0550GS./X///`.T+U%R 2' WUz055 Ur4P$040:Sp`g`qPP C\$iB%`3rTD00000 0uC3PP#2 mCDCDD峣Pc`0 0S #P3`p@-S0#S  FCDϑ $B0E?o2?  3C `V4;PPf/傸 `urV L`PDh:C00CS0 rP Pp PNU0 P00CS0r0 U0S:00S:02U511S)1S   Pd`d!iB%luUx$;P 0Tg P! `0U0w0 P`0PEUiP@@`P  f/>0 T  xT PW(]?7@p ?e??@D@|-C[?v????%o&\Y(.V@7r zpW(u&c@Q? j@ MQQq@@v&md/?<W(PC- 0P !@㐐`p@XP9 PR`00CS`0 &;@T ЍX0 X @;}(u& O-`@pP0dMԄԔԤ$`(`,`0`4` ` 0Z p0$@DTlUU!Z  tPcPSPPPPd @"nP tP0 aP` rUdU 0Ap0#7_dU4 RU SU" QU040  !_pUY [/lUT  I  $!@ $ LCp0 dЍ $ $ >Cp_ 8 8 1Cp( 8 8V  HT@DPP`p p "`TEP 8 Cp@P`("(! 4 "0`V!  P Q !^%0P0^THo 0@Sx8p8xX8 u P P% PP%`V08U8 p0PZS    A9 0`||VQ|-o& V8W~DVD%V{D3V@V|D(OV\VkVzVV}DVVVVVzp Wv&yaratcidO-0pOaM☯$22242222322 pp `/$piP?$0PPC L^P0: 4"2Ro "0#0"0"0U1dR0 U% PPL0ᾢp LP  PPL0Ɫpd2SPAPX0: S0d2232d2oPPS0 =PP0S F Eb3PE/PF1@PCD:L:T:9P<<4:4:4:\::4:4::4:4:4:4:4:4:4:4:4::?4:4:4:4:4:4:4:4:4:4:4:4::<L=4:4:::4:>4:4::4:4:4:4:4:>@;?$;0;>4:4:,?A@9Pr00@000`h ,b0<,000S0?+ 09]0d2$042!02020202@[k @_7Taߍ0220202;/`P 0S p; 000P00S p- 00/`P Q p 0 0/ P   R p p0S p0 0d\0X*2X |?)4!14h(S`?̂037  7037\\p V7037ep7 P 0 S 0"R S2S  S 2S 2Sl 0s\ >p@ P/ +\P$4 f/)H70L7TP'\?S@<"820,"(2 6PPN0 0P UYP`T [d2S+ ?p\ z>00dX!\1  ;\1X! 0 \02T7,2P7pP 8>P#%P tU 0#HPh +#Xx 3023,2 3(24T\2S(",2QX"\2 !14!8!P@0+ ^0 \  ` v $!\p  ZY0d2S*'0\ E C[ᄱPPL00<08 4SP 40 S8 *"<02#L SX U[#<00R,b(H"L2R0;\2QP 0ꘁ(8%do&e(e|-c dd(9dDd(adkd7r ( ^zpdd(Uddd e=eZe8e((feerdAeedAe~(objf>Cff8%ggg(H( hShhffff g8,gSgu&(_gghi1 SR Q  RQ!R!RS !14!8!P" 3`p0 0?`,*P D2@T0[ 2<< 23S 2BS``B2S 8$)0 7P \!P c+0! 00",00! 0,"P? 0,! 0 0("|( P h>g@ T  @ET   @@谝  R%TY! pYP0  0sFP 2 pw3d$yP3[S 2O"20"0]wsPRmPkLh-0O-xUM M@ 00@00`p0@H@ 08%~p0C000005 `V1 0CpP jbEP/ ۥPZ4$H2ZSPsS?oY20S jS PZ  j:EPP4j/RXyScS PS4 TS9 k4 13(0d CRONONNNNNXON4ON@O$ONNON|PNP$O000   t 0 )     [r Rn : PW  [  \ PP S0S R) QnQoQ0 )p"pBp$0P@1  00,"($2$"0#ލ Ѝ P'  P" P  WT.@; Jp@. A!;P[:pA%"00 n X`V  ;p. @:⛢>04P)`CQښ. .a0C 2 0FW(|-1xo&edABx2j zpL xv&((w (T%vr(TfXOwHxix0(zd@(zxxxxO-`@pЁБQ p%W㰑 0S 0S p10`VA P dܯ0S L֯D`V.Z ЍyPmPPP fP #$n0@ S,TS\TSSSSSSSpTDT00000000000000p1W 02P .f$Pb$P 9X*{|-(3{o& L{O-4$M` :P! 9P$90pD刔刴00PPPl$np3W00S 0S 0S 4Pp(4 a X' 0S00CP >0S 85PY30S ЍzPOPBP4 FPo HP@*PX|V|V|V|VX|V|VY|V|V|V|V|V|V|V|VP,00S  0( @⯻P@800-SF 80@0$0 p0@P?Ѝ$0pw1 4 ?$040P ?000R0Sp c```8wpW0Sۭ0S } 00 0@@`p @$@ @P Xm 03/p Tቄ{ |-Rmo& y %@-,@,᳣@⸣屣@ģ(%4O-@P8M -`,@GF8 0Bv`^ +p &p 6T6 R|,0 P8 /P0T 4P0\80DpHP88F U1 6V(pCE C`0IPHPU 0  p 5pO005S 0(0,00(00 0FhPPPx%xSPzZ`ZNZU 3AZF CZP0 p 00aZ CZ LZf a J0Rkba|ba|b|b|ba|b|b|ba|b|b|b|b|b|ba|baaa|b|bLbWZ$00!0 0 P 埣$0DS -("K0L0J0~O0{05xN03Xt X`CpM0nH0l5$00!0 0 ᔃ p$0@S* xPSI0X00Pp 00J pS0kZ0{mJ Z =Pb_____a___bȂ/Ԃ-[mҢPH0SI0SO005S* L¢PO0S U5S5 ( ӫp0 (0S  0C!P ᓝ@P!@l.p``ެp! ᥝP|! ።Pd! 0S1H!彩3/ 0ƪ\@ PHE`Pᤞ*(<P1! HR #0 ⎭p PP 0  0۪0 wpS%(%%(p%)%o& N%H%|-B%S%dq*+sM  i iui m@-P [R审@ȡ h(p@-D@DᝡPᢡ@(嚡 噡᫡p@象p(%$p@-D@DᅡPኡ@(傡 偡ᓡp@虡(%t!,A-|@|p `(Pj,gm0`j8P@b@@4\,]odAs(%(!(G-`MF5Pe JP_ 5P0 Dp) Pz5\{5@P L5H2HP8"0 8288@p 6 H}p HQ 4 5P + @ p1a 0儵0 @ pz0 @t xp080<0@0D00 0000P0 0 080$@P 媶 84 HL@P@T@X@\@HP圪 H㘪947454 0400,0@@,0( 00P3pPPUPh0PP 0/`Ѝl +"0 4KLA%??>?(O-p0P`M(006唖Fp0  pt6Z0PE `V0S_PvPP`@@0V|P 0SЍuPfPFP RPg kg@P4lkkkkllkkkk\mkkln0P0 P0#S 2P00 $# $00S $ $ $00S ~5pP P0#S (SeP $ $0(0Sy  $ $0(0Sl00i0P P*q *q * s*` @fE[w a330C @RI0cS pS< bSBJJPEU ]P0 0U8U U,P 88 0,3/8 RP cW 4@3Zg ,3Px0 0C?oR20S^ qXUJ "P`00 0$,0$00S XU 0H 'K0S 0P0 00010S@1 0S 0GP0 0  Q00s  1000,0 0@383P7Z @0 $  32&SR @0 #  3 03  @0 R T 2Pq(00s  2pp 0 @0 3Z E|-o&(zpn4D}&!GO-P@`'M Mv$P&Ip6 @D 1T0 T( TZ|(wGPPhf`KOAP? a@PP񟗙suurusuuuuuuuu suu,su4s`shs|s5P50S $ӵPX OuȸpPp%000PpP[P <VP ,QP3呸P.  嵵P)p AP yP( N}p q;Pq/N00 00+0 00$00 0P @I`P'ݍ Ѝ (SP(Z@X  e2 P 2P( !+P( (}I@Pp `P0Pp 0(`Ȑ` q_;P 00 00$0 00l@P I@P  pI@PI@P hI@P pᱢP 嬢P ᧢P !jpH២P Z  մP( (p}p` ɴP( !q;@PT XC ڔPq=0p`)^0S B + /nPm``2 0V@ 5r0 00p` p( &2P00Spp00 000$0 00 e( 2p000Pa0SJ+S'- 29S!S 1qW o& (|-fXOw] zp1aixzd@edAp@-P@H1Dp@-P@@1p@-P@81ሹ@- p@-P@.1p@-P@&1p@苽p@-P@1p@a0O-mMR~p> 0 )p@7p>pl>a0S@>D$RP$r R  $t $l00<4A @0<4x00<$ 00p M <4 D!@ G'$`PEB@D4TGt||||x|||||||||||P}}|}|||h|||||||}$~|\~~~|||<t`||ā00<@!P h< $yPt || # 4< l $<$$r $d4LDP ;$0 00  0 ;M0(00 K0, ;0@= {L; T;$40 00 `0 t ;&0!00 (0 @ : 0(00 0* :$ 0!00 0  t:(0!00 0  <:,0(00 H0 p :0$:@90S |P4: 000  \!00 0 t90!00 0  fX90!00 H0  X940c 00 0 P J8 0!00 0  <888儈@0S C.0 18PK"8qP0@4j  P@d 8(K 8@臟PD40 lPD40D4L L G 0P 0A $000 1 1 7C0d7@^P00(7 000  ᯸7F:P[P/VP hLK0SX 0T40000PEU UZ R7 30pPQ 4S<4Z H4L$0 R/p << 4S@00TS $EH?HHLX00 $?4XLH +7P +>J k>PP;d%>PPT%TJR.p P1: S(%,6 $R m-@P%,BP$  AP0IXZs4S04>0$80p!x$ ,p = l$0nAP$0 r0 4؞P ӞP$,03}p,p40S0X44S@0S4p2S 2"0# )尞Pr 0T40S 奞P 3T#0S 0P 0T, !L4HϠ0# 4S 0 $?X 뼀04$$ST RQ  X  0[,p0 XR00R104Qg ;R040 Q$ Qr*8Fn(Vzo&%I[|-C[?v&, 8 CZn, D}&%<_B%F2Sj # Kh(n7T (Bx%(!E!6g D\1% ?  )HL4 Q} QQ040SVR0V 4S$khP 44崐S04144 0S @4S 0 0@4,4S $4R#1ѣ1,40 0 0kUu +t +0S Yp@% P' 0d!l">]H@tiP;X.R04ʃ1$4Q :$4'+tT4S$L -d0("l",+++L],\4$@1H4`D1x0<$0@ 0",plP>0Z ?P>0P  4tp  T4 { I(0. 8-O-0pIMM␹i4, U pP_h9`4pGs04WZ `[  WYa) 4S<44S $$4R0(*p  `v,p  4 SP,0S x0$9 $tZ0 0q 0$- P$H 1Sh  $$4Pa*` HZUCU@DPEUhܒĐ`vbPEUUꔑđ$X6 ('8#80( R&0C RI ("(G044s04=0 00 d0 Op6/0(00 ,V0,PA0@ 80 00  0/0*00 +0# 0*00 +00!00  0 0c 00 l0 050!00 < 0,00 1 1 40(40S,G00; T$e:0P0<$!G`U+p 4S )PP#`$5?`P#H  <(@=P04(0(00`V Z 00Op"#8$p = 0=P0 r0 4=P 8P#0F3}p$p4S80S4` 1S 1!0"@ 0S0jP 3"b|11   $Ĕ!<#WpT2   F$ r!gpԑ P pe 4 $$s(4S 0@ ?W   $tR $4&S 4%=X0; 4 44 W  0(p0RFpW!X0:S Q 4 $S  0 B (0S Z (!.X0⫱X+(|-o&n(7\%8Cn, <_BKBx( ![ D !1G-GMM@ph ݝ p40@D@DTQF@@5PH\l|\\\\\\ԙ\`\\\\\\\\\\\\\\\4T\t\Ě\\,L\\t\304030033˲(x3  p0,0p0L3000<3080,434#  3@| 2Dt 2Hl2"d20L0`|2"X\2d"P<d2D"HL2 p0V0  2W6 2 p0X01!$ 1`p0x0p0\1 )p`P%3  z,qp`P'0 S #  _ 0`YP D0S0Sh`lP0 SA/ẏP 0$ 0 0 @xx;@PD GGލЍ !o&|-  [= C # 5 A R a p KR|=Bx O-`PML d`cP(NPwD ~(PS'p''px `Pp (8` X.L@pAH 0: P U ZK > <;S|'P $H $H 0O =PfO PX(  =0 2S1<+02L0WC.p=0S- C@4PꔣHHHHHHhHHH̡\HHHHHHHHHHHHH0H@HȠHHHHtHPD 09 0zl h)h0P 00R0S 4Cf 0;8;08;_ 00;ppGX䋟h;h00S 0/GP  +;?GP= 0Cd hh000S0? P< ) 0< 0: 0 vC@0 0:0@; 0@0 00 008;0ꨊ hh0P00S0? :Pڌ 00v 00s 09p8 hh0`0PS 4t hh00S0@S ec 0; 000) 0 0 000) hh\0 ɟ Lh00S 0FP h:080X)X9 3&PL zZ 8yFP &&P mW<09 ,rd +P 0: 0 >0!.8u 828P80PS ̌p 80PSUpȌ 刀ppPt  4BUp 0@ @ 8 0PUP 0C S0400000,00(00$00 0000000000 000000x0 0P0p Ro PP@8Wo `m$8; 00 d0B&p8; 00 d04&p8; 00 d0&&p8; 00 \d0&pL pDV  |0 x;0 E y;z+h0;0; ; '0cy;0z;(0x;P+@PP d0%P;"0#10@00 0`c`QH `    ` 0%Pbc0S PP c0%PU 0  00 4%PHd Z0 X Ut``0 T%P`l4l$4%`}!2P(10Hd 0`[[[[,Q0Q4QPPPP庚d04d<;SSp%>؀C 0 <7PE`pJ 2M 0&M 0#M 0%hrNM% 07PE@XP`J @2M 0M 0M`"2R 0DP ' "2@PDP20S 0 c' y@P 0DP@P 0DP2 $p0崗#p00 dT֍@+9@0W0 00 D.P1 ]ppW $ P 81$P`dAQ D]$P E $1% 0%c0)&`)?eAo&|-8`RMb@AQnt),)) {Gz?Kg)r)D}&SH)<)Wx)FT%L)-C6?)#c8~A)$@)@@v&)))O@%*X)@v&)CH1Vj6Hm{ ( @  Y o       !"!5!h!G!)O!0)^!]!c!A KN @1L@P 0 C`PZA@ Pv 0K 0@PCPE 0CP E1 Kꔶ (08@H| 0#!n 0Pp#x         $ 0 PG D 0 P> Q긷Էܷ 3     &0 aP 0 #$$0(#"(!0 MP  0 CP4  0 :P Q Q l p pt n0 (P  r0 P  0 P  0  P  0 P  0 P4  0 P X 0 P | p; 02 q.0SG S Sx U؃0#$$L0(000"(P |S@0IZC U I 0K@0 @0C@zp c JZ  @0I)0C9! @ @0C0YIZU& <;Z   \PU 5(  ḫ ;UP 'P JZ U O-M`P@0L-S@%P. @,4 t p+40SP a`F0pP[PPijQNpGK PN _ <P@ \3pC d0@SԽ ܽ(L@20S[K@HGG 0冇 0p  Y >\J<Z'4`PyXP`0b 2 R  '0 S  U+ 0 !\0!00VXݔڔ הp4 ,p30SmXtm` p!0SFP0pp@@ 0; Vp]l`P*!o&Pq zp!P#!!!r R"""!"7"t"!2j M"O-PAM Mʢ@`~xP l}~Pd70`W00-S% @rP ᯆlP};@ p0K0\Z `F0S0`@DDA@Dv Ep .6p0StbLPt63 Q X o,P -00 `@Z-00  D0B5S񟗊8,,,,,,,,,,,,,,,,,,,,,,,,,,,p,|,,,,,,,,DP,\ A00S :P}:0 0w꤄4P :00i00f`400b `4 ^0S H: V 04 R00OP H ܃ 300S P60$010(0.0,0+t0C?o 2R0S0$0[PV\SPN@du00@DT3a00@`FrS; RS iS/ CtS xS/똒弢+q0p 0@00@00S ' 0@T0S #R0B(0/S 冲o(0S { 0@7ap0S (0S pe|1 0h0PS 4LV?(0S (L 0@&/>Uv%P+2 0 Ph@T[@*V. *9%o&Q%L$|-n$$`+$`%$pS$$% 8v&_l%9@=@v&{%%% %XK%%9O-PLM)@pPph/op\?,#@DRQ0I 43@@0SRt9vP cP SP- TP0(3 LP d0@Slx0D003030800H00 30$30,3C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0n qp 4y 0P 0PQT)4GJZp3V Lt`(os`F P% 0SU030#:U 5%P\ߚ P L*2< 4P&T6K/r03PvTS0 0R/# G@eRPEX9 Pd 0 0<6S"46S" 02Q" H201dp囚6S `喚hP W0`W  0㩆P d!EK/r0Z,6S m/BPP Pj@db<6S:46S: d1Q0@6D&Sx1 0 00Rh!  H&\RX! $&RL! 8&R@! 0&@R0! ,!Q   @^ 뉌 @4냌@|0PP*+o&P|-PΡWPQH1+h*,+,+!Q#CQD}& Q Qu&5QRQ R(!P!PfQsQQQQQRRP4R7R]P:R=R<@RURPA-Pp`IHM p10PEU* HP h0@ S S@PX`xHHIIl1d1T1 P1 `q 4)P p 1! qlPP 2 Lp$@@Ѐ@(@ @s >P P׋0S PxV 5P X20 0000 Ro&|-P%Bx2j P1+zp4yt RCt RR0G-`HMp0 ,S,C, ?p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 a0@S`p 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTP1V ДY 000 04HЍP  PPp  10S  C0 `PCPV qh V *`F[p1+|-o&X%@v&*[Qt1+zpC-Mp`ᦊڅPPF! VF ]pSPU 6 `V V 60S aP& tP8p6 R h&   =p<6U@,V`F V"@T 塅P 圅Pn PV 0S A@D  P`V     tP9@PA@3P񟗹,((D((((((((((((((((X(((((((((((l(((($(8LzP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 03 $0S=<0S800S3<3PP0$0:(U 0S# 0S 0S`V Q PF p00S 0S 0S`V UUl嶄P \屄P X嬄PPEUx4\ U3 UUU  U4 @U U0`0 0   UQa+PJY 0000 0  P    $0S   Dp lqpݖ*P@' T Ӗ 0"600"$0 $P @-P (P` b  cD6+o&|-abv&b] zp] ac#c=cPc`cwcG-@PMaqM p1 R1 p0CġP R ލЍRP fP74 gP` /XOJEP1 JP/0: S2  S)J  P0 JN@n` 02 4S00`iN땈0S %p J ~ PJ w @PJ0p@el6+o&zpedeeC-PGMM f0M= <8=8X@8DXqPx=0D80l8"=`{C0L `XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxx8qPP   tP:? 0.CML  qP< <q@P pP H0P XP 0Pl Sh0 jP4:Ty |P :h(q\P 9T(X(g8 c,{P 9h(e40GDS4Xht pP`Dh 8(VjS h8X(T(N T8,J8 8P 00S= 8 -8, ,, ,0 7,, 7H((L$8pL7, | 7L( |7P(w+s P :?@D 074wKpҁP78 7T( X(`7 6<(L7 6P 00S 70 7 6P 00S 6  T6t(6@ 86,p Bs68pKp0┖80 P 0S<6d pW 8pA<'R0 0l5L(5K` L5`(d( 85uH$5P հ@ y5?Q4<GލЍx5| p,0D\<?;?8? 0S0SA  W+@288S2;=@P R<S P 0S J JH2 uN @+Fr P: B?\ 081<Skf+q P*>;0:wP 0HP *@P4 |> p><T) @PH>@ >0@`,rvPP0@P`p@+q0(@0@000,`40U0 (P<P8K,8U0C?o20SP ,R  \0,0S MJ,8S= \,8S r]+I V!I Ndj.zr u&@v&׆o&0 |K] |-8&*qf+Th*v&?Rvf~x-è *24r rr)r5r@kFyۿP>r[Fr< x  j+ \ jG-P` 0E9hzP03sUp2S l  PC+UXzPH t圄9PB/PE0@ *  pd40pEWQU H4 000`BvP L,qPE0S#3 4# 3P׃ԃу΃VP *vP303 `pp hdmP\304]P Z4S @SYP  (*rM P 4SqRYPl l { PnR'z,p`bG1/΅<01 1> 110101$1X.,*4_#(2R$$hp`g Pd Q18C8S [N`q؁ؑ9X00l V B/o" R YP  \X=`S 0 0000 lIY18C8S+`#RS S=?o20 S S l.Y18C8S 0 S ` S S SW Zx,1֙Ùo&D}&!, f җ@v&d&p&',,> zp<}&rQ@-@`PF~P 1 q pt10SAPX1PH `D1C@*~P 0%~P 1 nPbP9P0P 00@0c0@ S $ 4        D   VP    h0  X0  H0 T TT~u I_`0S,%,o& &!8v&A-`JVG ,(2,00!"P5 Y#% ,|!z  P"   P|0S  z pI~|0S zT0 0/X0 @p 0SS RQ"$0p0U|0S uP@0y { CTP Pp`0P-) o&zp@v&ht@    |-z 4 Q? ^       0O-PMpP00@)wP #wP嬉ߍ*.(z%?@X1x?/0201 2211$B("T122ipᩀbp㢀[pn㚀&k Nd10 .0>p40G 00 GR`18`13h80( G1!1pQlq0( ቝ@Pxd1k 0> G0R  >+00.(+`18`1=0ZSVPMP 6PR ?PI 4P㸝N@P񟗬'x%'x%x%x%'''fP j@PP񟗛T''x%x%&x%x%p'x%x%x%x%x%x%'$=0X1hT =/hf`}蜟zd1f3d1kt0000n0d1i\ ݈@cㄜ`|]0 P(CP d1~P Ĉ0$P]( 彈0 GR(o0 (@P 0 P(> 壈8l&h(00`1(,}p (@1S(BP 3 (⟟(‌(}:0P dA@ @0 Tp  p ( d `1 Q 0P819: `1d! @ `1h* ` p@P ̋ljP*$8 %`11`V rlPPZ: )Z90)0 0+)( d1 (yPpzP 型L y(0 09,<p@p  X (0S` D _PQ Hz0S (`!d10d1808"/0  |`!2sH8"/0 |2`!s"/ ||p= `1X" (|P%<`!d1 0d1(00 8[p 138(>~❉Plw`t(00 7py0S x`aa0HXy0SLy0S y0 S `1d!8 0d!'zpy0S &tي}py0S &@̊(-P q( Špʊm|囊M~`1 I S 0⋎pL9 ^p5 P 4d1$A>d1 0T1(00 6T分pwd啊s$0 T1(00 5Twp 儊\p  e^p P d10d1Ktt":\6d1(@0d1`P  4+`1 P40 (0{pX `!d1$ $$ 43z(p (1}S`p3(00 4p8'!R`14`11(̋P+h(v!P0!  R!00!R00SRd1儉(~`1 0㄃儓 Q01Z: ((`1 (~1PU3`1d!( ; V A? =I(i~(1R@T 0S 0 @ӆ@ 0S    0S h|aP`P P ( RV  R   (001壆0 S   0׉PU3QL|Bd1@0@eևƉh&$d1 $K R El! ( C 8_& dm!o&rx |- ς T g il!: @ ' &pl!6 ĉ L2  7 * & "K \ r  ڊ ) 8 MQ 4 H 3 P'= D Z m >y ̋ t4-K  Q/0p@-x@0Ppp@ P T0`$p@ 0 0$010h](\p@-hPMP@T Ѝp@ `0 @ X 0 @ XwHH0ƒ S"*0@- R P@ 0\ R^D00"@ 400 0^ 00"@0/8v v v p@-`M PAP!@ `` */4T*/@-@t@*/*/*/*/ps_strings missing %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)ctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230516NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:inN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.12xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32gamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.0.8--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.0.8 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.8 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLchangingaddingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenIPv6-Only Preferred received (%u seconds)reject invalid addressnot ACK or OFFERdeclined duplicate addressofferedignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d & XD PM$(D cD rc,,\ p    ( \%0V16&g LR1g U{ LZ*L^"g3jO q9 yF@yLg `ySy`yaylyxy~y[ \ PHPHQP RIC I      p X5e HXz 4$pushdnepopdne 2p&/(@@+DJ@/@@54;ta P B`H@@@@N4unblock and -DNO_CONV?:::@@:t:9100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink  DhDh$&:NE_Zs# _^F<>?PATH= 2 t5K =f'q"dx"q"ss=c"q"m~"q"l""r  %p"0n"q"v "wb    EOF reading here (<<) document''''''''''%] ''''''''''( ( (((J}'''''KT   @ }-+?=\ @\ !***0*6*<*B*I*S*@-**abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'V(0,LV(1,8V(1,V(8,V(0,tV(0,V(0,V(0,xV(0,$-̜ݠ  SDŽc\eΡ { d W QN. ά ]h N;RrS-<V-? cD!2cS *-                  L/*L v.@G p(,wD" {.aj.t8$ mT.(.KDX.X<3$.D.D.. ff `j`.l~e .5.5#M0XL2/(.-r=8Pw. F r D..{.w@Y.|400 E11C L2 11( 15f Sd 0 2u33WR0:a <1>1<<1P<,i;1<2=2T=1=o ?\3<r ?1$> 2@?"l?t >2<2P<&L>1`>'?r2v2z2~22#232#232223232#R422;4 C4@{@J4Z4c42c2b2334233 3@333x3k233 $2C$#2C)2C$(2C\02<3B3:2C2I3P3I2r343X3`3@Q2@i3 Y2 .3&3}33@33 32222444%4-4 2@CC#C@A@)C@1C@8C@@C@IC@NC@SC@ZC@iB @_C@eC@nC@vC@C C}CCCCCCBCCCCCCCCCC@C@CCD DDD"DB(D.D6D;DBDIDSDYDC_DfDnDuD|D9B>BD@@@@@AA$AFASAqAAAAA_EcEhEqpEuE{EEEEDEE= Ed# E5EA,sDDDDDDDDDDOmDsDDD= DEEEEEEd# %E0E?EKE[EAA>DAB BBB B)B0B9B>BCBJBSB[BcBiBmBtBB~BBBBBBBBBBBBBBBBBC C_EcEhEqpEuE{EEEEDEE= Ed# E5EA,sDDDDDDDDDDOmDsDDD= DEEEEEEd# %E0E?EKE[E_EcEhEqpEuE{EEEEDEE= Ed# E5EA,sDDDDDDDDDDOmDsDDD= DEEEEEEd# %E0E?EKE[EATO0Q^;iWijiiiiij \j {j j j jj kj k?kRkkkkkkl$l @l!c#c$Pl&c1c2Xl3c4c5tl6c8l9l9l:l;l<l=l@mAmBTmCmDmEmFmGmHmJmLnMnNnO-nP=nQOnRdnS~nTnUnVnWn\nancnd+oeMofaogtohtoitop{oqcsctcuovcwoxooop!p.pCpRpdppppppq.qHqfqxqqqqqq r&r,rErErErerrrE~rrrrrrrccccss1sJs=uastssssssssst2tIuQtit~tttttuuBuVuvuuuu vccAvFv~ Yvusvcvvcvv w w,wOww[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]\ 6g $@b [ 6g A,sDDDDDDDDDDOmDsDDD= DEEEEEEd# %E0E?EKE[Ereturning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-0KRepлڻA  Aӿ^lȿ%h%%% %$%<%X%p%%%%%%% %,%L% A,sDDDDDDDDDDOmDsDDD= DEEEEEEd# %E0E?EKE[E^;iWijiiiiij \j {j j j jj kj k?kRkkkkkkl$l @l!c#c$Pl&c1c2Xl3c4c5tl6c8l9l9l:l;l<l=l@mAmBTmCmDmEmFmGmHmJmLnMnNnO-nP=nQOnRdnS~nTnUnVnWn\nancnd+oeMofaogtohtoitop{oqcsctcuovcwoxooop!p.pCpRpdppppppq.qHqfqxqqqqqq r&r,rErErErerrrE~rrrrrrrccccss1sJs=uastssssssssst2tIuQtit~tttttuuBuVuvuuuu vccAvFv~ Yvusvcvvcvv w w,wOwwSFH0eC^rSFU0eCdEHah!IdontNeedEFIns(s*K>;j }|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+[E=rGy=iG};Mt?mWC 3KOO(yD<#*=(3=3Dh&GO\ M}-bs@Mjy֬-чHD-чHd# ZIчH6g IчH@b IчH 2IчH,sL6 %?aS'@ )Ѹ,3*1@ )ѸM?E1x )ѸR\backupstore_gptstore_tblin_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus^ printallmaindo_setifpreferencedo_setifcapsziP%Jyi...%<%..% % %`%M %o%%]l%% % %%%"-8DP \ht@ 0@[ _  @^ init_current_mediasetmediamodesetmediaoptsetmediasetmediainstGr0 0 0 `@0 rmedia_statusmedia_constructorH %H %H H t%%H %%paddr_matchH L  4settunnelL%@%print_link_addressessetvlansetvlanif%% rsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrts`%,.%H%.%%>* %= x%%|%-% %x >* % %%=,<[[<MM$invalid major numberinvalid minor numbertoo many fields for formatffs@4A MV0bjނ ] q'] @.] :] B] | 5 _/ *@6GUl@\ 6g $@b ?[ 6g \ <FfXO] saO GD] Q_ j Al W@X_dmw{ bnorripbgensbextattbnojolietbnocasetransbrrcaseins<FfXO] saO GD] Q_ j A\ @\ l *W@0] @|<FfXO] saO GD] Q_ j AM V\ @\ l 0] @*ނ W@b0<FfXO] saO GD] Q_ j AW@<FfXO] saO GD] Q_ j A\ @\ l W@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror<FfXO] saO GD] Q_ j A*l W@.  @   4s@ " @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvl <FfXO] saO GD] Q_ j AW@|>e=:Nn'Ll?d%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@ B C F I L N OSa b0c;eOfahikmnorsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:B@@@h pp pp a` "'@ , $1м|^t0 Non-system disk Press any key to reboot AnnnAnnnBnnnDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYKKK L8LaLLLLLM?MqMMMM N9NUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_print?\O\[\e\q\w\w\q\\\\\\X\h\d]]]-]2]XH]b]p]]]]]]]]]]]]]]^^(^/^N^R^n^y^^^^^^^^_^+_^B_Z________h_____bitmask_scanw [[[[hw.disknamesfetch_urlWsendrequestrecvrequestr͈шՈو݈***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]a˭ț ϭț : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for datarQN.t\ VO _N #;D(,hN qN ,~N r,N r,N N ,SP N ,N N ~,N N ,O O ,$O I },-O r,6O r,@O r,IO QO ,^O .,eO lO ,vO r`,O 6g ,O VO ,O O ,O ,O ,O N ,O N ,O O ,P P ,$P I ,-P r,6P r,@P N ,LP N ,]P r,hP vP ,P I ,P r,P r,collectR AZ R mZ I !I ;Z A,sDDDDDDDDDDOmDsDDD= DEEEEEEd# %E0E?EKE[ENAME=[ @b $\ mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsA,sDDDDDDDDDDOmDsDDD= DEEEEEEd# %E0E?EKE[E edit_fs_type_extPc X P 4L L HL _ a n o 1L`L dL tL edit_and_check_label A,sDDDDDDDDDDOmDsDDD= DEEEEEEd# %E0E?EKE[Edisklabel_freedisklabel_set_part_infodisklabel_write_to_diskhiyD    P P  Զ H ص  @ 8  ̴ $ disklabel_change_geom\!(a!g!outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default - - - -pm_from_pepm_whole_diskgpt_freegpt_create_new`d!x 0|ܧܦ<`X 8КP lЫdL d6g ,sGGj j n@b ^Dd#  ,MR !| KeлA A,spn-B{ { { 6g $@b { { ?Om{ [ z# D| \ d# | 7EM| gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC^rSFU0eCdEHah!IdontNeedEFIns(s*K>;j }|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+[E=rGy=iG};Mt?mWC 3KOO(yD<#*=(3=3Dh&GO\ M}-bs@Mjy֬-чHD-чHd# ZIчH6g IчH@b IчH 2IчH,sL6 %?aS'@ )Ѹ,3*1@ )ѸM?E1x )ѸR\~r ~ '~ ?~ r!p(N~ DA^~ pth~ x~ ~ ~ ~ mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new\!@i!4i!T 0p4`$P ,$8tPHmbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************r͈шՈو݈control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2\nnndhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2023 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionq bc_de, f gَ h i jVO k l m! ns1o( p|qxr3 s: Stx u_vB w xI zPyY A_ Bl C Ds E} F G H& IJ K LuM N O P” QFSF Tʔ UԔ Vޔ W X ZQ 1 4 6*  |_~$ }/ - 6 F X f d m k r z     aO '] Α       Õ Е ڕ  x     . w 7  C O b o } default_configread_configrt_compare_protoԥԥ44rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt  rt_buildrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initҚ ٚ   script_buftoenv8 G ʚ make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os]  ! & * 1 if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leaseread_leaselog_dhcp̦ צ  dhcp_bind    Ԝ   ͟  dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaxxxxxxVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B 8AX x K ؝Ѫ ͏ 8FXڪ x BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ʪ L}&Ϊ $!,!ת $!4! A  K Ѫ ͏ F@ڪ R"P"N" A8 | K HѪ ͏ FXڪ   !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstring_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_number_alloc_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_reset_locked_prop_dict_keysym_put_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equalsprop_dictionary_set_prop_dict_keysym_alloc_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_equalsABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_internalize_decodeprop_data_data_prop_data_internalize_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_remove_prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynameTLS allocation failed, terminating ;Zx0Nm<[y1On%s %s%3d %.2d:%.2d:%.2d %-4s %s %s%3d %.2d:%.2d:%.2d %s SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesortsetup_seekdir_unlocked_getdomainname @_strncasecmpcreat_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEX ]^f`ff gp5$6B EENE`'$E<,E4E8E @E  D,D`8D@DDD LDTD \D  dD hD pD xD D D D D D D D D D D  D  D  D  D  D  D  D  E`Z <@ x|   ,xZ h j B (^ Xz 8 pP DG dU LB Q z t^ \T  B B (w l01$r,?0D0N"N"N"P$$$$$$$$$8}&TH"%-X-n&-t-(,50.P@l}&w&+.z&0{&dx-H%h-l-v&-o&!H*-*{8 .@z&<t-.%8p& . G"-T..+.)@..<-4- .<@"t`x-<}&%n&0-D- d-o&T-p-Xd-x-|-Lpz&o&\x-..)--D-q&h$hx-z&D}&@-8-P-4|&p&..`-8d.8}&lx-N"Ȉ-L-G"Xw&:%}&`"x&-(-u&,-%@X-!.|-t@}& 'H P(%.~ bjjc5K fhkl%m7oCoOp`ppuqrl u= tvwwxhx zzB)C!JOPST# VS VXZZ ) 5> F Sc(t.xv`t.xTtth ua(||x}`t|Ttth G 5) !]S/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbinJ(}-+?=###%%%}P(P(^$ah$p$EVv$eMQF~$Ii$LdPl$m$C:] n$f$$p$b$u$>$$qs$$hvZ?VV%xR(@=%h%d & (qKfS%*  > %* .%  %= %LAKXGXGHFH8XGXG'pEj PFGCXG,HXGXG,HXG| y  '@@<FfXO] saO GD] Q_ j A\ @l W@...... ...... lost+founddA.##.#   F3GMG'GoKF WR x K h GP F3NKKUX F8} F:$ ~Fo F!F"F# $F%F&F'F()G*F+ G,G-G/G1%G11G2=G3FG45Iw6%Rv&;\d [[[\ \\\\$\*\3\. (prog_root)`m fSg9rgݠH , rrr)r5rkۿ>rFr@ !S !u Rr!^ !5 m !4 !pD g!|4 Zr!^ !0a D!@J ^r! h ![ !] 3!Xa _!H !L N !O cr!] * !D nr!Le sr!d yr!e !^ r!t r!B 5 !T5 I !. |K!$G h!> $!H ~e !E !\ r!\ 9!|4 r!LK !o r!n r!X M!O r!j r!L !lQ r!? !X k!lQ r!O r!t ! 5 r!`m !o r!7 h!? r!7 r!n k!O r!Db r!a ֵ!. r!o r!|c r!O GG!O r!O !H !F ۿ!F Iw!4_ r!5 r!hW (!^ r![ !h < !4q r!> h!> r!u s!4N s! s!h s!P] !pY s!@n (s!e |!5 0s!F " !r 9s!l[ &!l p!4q S!s!le  !i g!4 Fs!h %!D D!2 .!|\ $!ts Os!\ # !U !hF p!4q & !\ @$!#dP" N Rr# rn} {  <<[˒Ғ!< ? <גT >V tU p)$W |AxG $RL Ct,N +t,N cA .B B |R ͓|R sP ?(j #3#,a",ۿ Gg : a ",Ka#,9!c#Q &è&cra #,k2 0d:",AdK",Rdh",[t bf?2a4#,p&B/bin/shĠrףݣݣݣ!m 0m 9@H@S@Z@f@m@x@@@@¤ͤӤۤ@@ @@@#@/@6@B@J@V]rgox 1Gʥѥޥm ݣ3, @2^ͤۤ˦6Rrz 1ѥ٧rog&bT && &z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ,&,&,&@&@&@&h&,&""@&h&h&h& e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<حޭ is a directory is not a regular file (use -f to see it)&& ( $ 0<H"T>_K_lU{; 7   #2ɱ8۱  ( !+49FPZ&[fe)q{5e:%6(4 ̲+ڲ,-.*$?< 4ES;/G/U'aFn U  [fǰXѰ^ ٰ  WmkRkRkYcWbkCkc kG ky wb YMYrWca 0&Tb,Rsb0&@b,( ٻB0&b,c0&Pb,Hssd0&8b,0&ADb,˼D/&(0 e/&@b, #7f/&b,WoF/&&/r >&r D>&r $>&r =&r d=&Z$=&Yb<&trF<&itk rFD<&eh rF<&iP k 4p Tp tp t l 0Q Q P hU \ tn p p dQ t@` dm c ` fm g` [m ]m \m ^m  P (  P q4P ݳHP 6g \P mpP /O AO NO YO XO cO lO %O O 0O DO XO 0` m m m VV Pp QdV R_ SWDV dU 0W W N$X OW PLW QdW RW STU Ul_ wN N x O <Hm =Xm >dm ?tm  N N N Q Q Q X^ \ Po to tN R8m R R \R 0R ^ p] R |X  r  I g ? [  "  G  5 L n x   =       1 \ p }  /         4 M h      c [  " ' + N U b r         % 4 G T Y b h y !        Ed    , 7 B O ^ m {  ? d  I ! ! " %" F" d" v" M" " " " " " " " # # !# 5# R# ]# h# s# # # # # # $ $ % $ % % & & c& & & & & ] ' +' J' c' ' ' ' ' ,sZ( ( ( ( ( H) ) * #* (* 8* U* ]* * * * * * * * * + + D5f &UCn, , , 1, =, [, |, a, , , , , ~ , , , - - - 0 0 0 0 ;0 0 1 1 1 G1 1 #2 02 92  2 2 ݳ 2 c~ 2 ;3 3 3 (3 D3 p3 3 3 3 3 3 4 64 OO4 4 4 #5 d5 5 5 5 6 X6 ]6 c6 6 6 7 m8 8 !9 0 F9 ^9 9 9 9 9 : d: : : ; q; ; ; ; < 6< m< < < = += K= h= ~= = = = = = = = = = > *> :> K> h> ? ? ? ? ? ? ? ? ? ? ? ? +@ 3@ ;@ E@ P@ b@ s@ @ @ @ @ ;@ @ @ @ @  A A "A 4A GA \A gA yA A A A A A A A A A A A B !B 'B :B NB bB A ;@ qB |B B B B B B B B B !B A C $C 2C ;C PC bC kC & C C C C C C C C C D D %D FF gF F F F F H H I I &I 5I KI }I I I I I J J !K :K K K У Z Z Z Z Z Z Z 3Z y` y` }` u` T/  t, Vg  - cg J] g jg pg u vg 7~g g 0g g g g g 10g &'g (g )g *_+g ,g .1/ftpj @I] yg  g g a @+  g +g :g Fg aħ 5=L " >ĩ 6? P @# l A# l Bm l C pX D Y# l E d# l F o# l G z# l H rX rT   1t 1dd t r r r s s 's 5s Ds Qs _s ls ys s \[d;\[<Y k y rrrrrrrrrC  ! % ) - Ԝ e1 7 :    = @ M P  Z j q\mm q u y  }     E [  dF ! " #ɫ $ի % & ' ( ) *# +- ,3 -: -G .N ./ /d0; 1X 2\ 3b 4g 5@6l 7r 8x 9 :} ; < = > ?¬ @Ь [\ \ ] ^ ^& _1 _: `G {R {e |s } }~   -dd-ddTdd:dd:dd LP XP@`P@lP`tP|PP\GhGpGxG#G#G#G#G#G$G$G$G$G$G%G%G%8K%G%G&G&G&H'H'H'$H(0H(I>I?I2I2I2I3J3J3J9$J70J8@J:TJ4`J4lJ4tJ5J5J J! J" J# J$ J% J& J' J( J) K* K. K+ (K, 4K-  L? L @L!@(L"@4L#@@L$@LL%@XL&@dL'@pL)@|L*@L+@L&`L'`L,@L-@L.@L/@L0@L(` M1@M2@(M3@8M)`HM4@TM5@dM6@tM7@M8@M9@M:@M*`M;@M<@M=@M>@N?@N `$N!`4N+`DN,`TN"`dN#`tN-`N$`N.`N/`N%`NCNCNDNDNENEOFOFOc$Oc0Od4Od@OeGeDO#LO#XO&hO&xO0OOOOOOOOOOOOOOOOOPPP(P8PDPHP\GhGPPPPPPPXFdF hF tF@xF@FFFFFF F F F@F@F@F@F@G@G`G`$G(G0G8G@GHG PG@TG U33333333$$n oo8oPo3333|||||Tx}UTC33%%|vxpqPwqvp33X..8Lp339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sžp&p&p&@q& % 33UU33UU33UUu&p<@q&@v&p<@s& v&p<@t&v&u&- (08С}}TO@PODHTx   @ 333333333333333333333333333333333333 33 33z& @"@" 0000000000000000 x".3333,3333{&{&{& (root)`33(%CN"N"N"N"N"N"N"$!%%%%%N"P"R"T"}&4 PX,(<@HH L T   LHService unavailableA*aeabi 5TE  8ThV7xگOA^Bǯ%)IC\jj.Vh*qUJ$I&(P,qIwfۤ2yf杙=ə 5pZz?Uکke86͙|IVq[Uooy(zFm:2ZSHlМ]-*炷Z^- y~o0_v3l~Ij?] LxϽYL~լf\sz[}Qrcg̳}OtTqKv幢M]Wuv9T?/?esMEXO<5M–@abEQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+a 0.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf /BL@HPAPA#P%e!V%e!$b%e!g%e!%t|%|!Ly%ȍ!0}&="}&="`X..="p="+$>"|@"MSGTXTS626 5024 5049 5066 5088 5091 5096 5104 5111 5119 5127 5130 5133 5136 5140 5152 5161 5174 5203 5218 5762 5796 6479 6767 7475 7531 7605 7701 7748 7771 7794 7800 7809 7831 7835 7839 7842 7845 7950 8153 8392 8833 9271 9306 9321 9333 9339 9351 9370 9390 9430 9447 9464 9479 9526 9564 9612 9694 9818 9954 9995 10033 10070 10105 10115 10164 10314 10320 10325 10329 10349 10459 10479 10485 10499 10511 10522 10559 10593 10617 10719 10756 10778 10877 10932 10990 11001 11017 11069 11237 11444 11615 11679 11731 12003 12553 13082 13514 13852 14185 14298 14313 14322 14482 14653 14803 14967 14990 15014 15029 15104 15244 15421 15576 15588 15668 15769 15815 15841 15911 15922 15931 15944 15970 15985 16001 16014 16069 16080 16095 16299 16532 16561 16576 16645 16719 16792 16822 16860 16914 17368 17394 17423 17527 17633 17818 17930 18045 18149 18836 19095 19235 19271 19441 19482 19618 19641 19678 19723 19974 20070 20124 20223 20234 20271 20308 20335 20344 20378 20385 20410 20437 20472 20486 20500 20529 20543 20560 20569 20591 20609 20626 20637 20656 20682 20700 20723 20740 20755 20770 20788 20815 20842 20864 20903 20921 20953 21181 21255 21298 21344 21491 21647 21691 21970 21997 22356 22540 22692 22873 23020 23178 23199 23247 23257 23265 23276 23287 23297 23304 23319 23331 23369 23399 23438 23491 23549 23570 23577 23596 23617 23624 23647 23669 23689 23711 23742 23779 23801 23815 23861 23890 23924 23964 23999 24027 24075 24084 24093 24098 24107 24116 24133 24137 24142 24146 24184 24193 24220 24240 24263 24282 24309 24331 24363 24379 24384 24394 24417 24439 24456 24473 24486 24495 24504 24510 24537 24544 24568 24589 24613 24626 24645 24670 24693 24709 24715 24727 24757 24765 24805 24816 24827 24838 24855 24872 24886 24903 25119 25423 25871 26087 26351 26623 26675 26711 26747 26798 26815 26853 26867 26874 26891 26894 26899 26908 26920 26931 26940 26961 27003 27019 27035 27066 27083 27098 27113 27128 27149 27169 27210 27239 27287 27520 27555 27762 27781 27818 27879 27917 27956 28112 28127 28173 28200 28223 28259 28269 28279 28290 28295 28358 28406 28450 28511 28544 28591 28609 28748 28770 28893 28907 28917 28940 29045 29101 29217 29248 29253 29279 29318 29328 29371 29381 29397 29412 29430 29453 29483 29504 29530 29727 29770 29774 29780 29786 29791 29802 29816 29845 29877 29889 29936 29986 30026 30053 30069 30078 30121 30127 30135 30139 30159 30176 30188 30219 30475 30524 31100 31127 31159 31187 31239 31245 31251 31256 31277 31293 31315 31344 31485 31619 31632 31768 31770 31772 31774 31791 31804 31822 31849 31853 31859 31864 31872 31878 31918 31920 31930 31945 31962 31996 32028 32066 32095 32124 32146 32189 32215 32259 32395 32397 32477 32523 32571 32676 32778 32817 32884 32891 32952 33016 33020 33027 33149 33218 33506 33644 33785 33866 33913 33919 33942 33988 33991 34017 34060 34125 34187 34257 34325 34418 34637 34662 34666 34702 34720 34748 34790 34834 34898 34948 35024 35046 35098 35142 35181 35215 35245 35276 35301 35310 35322 35330 35341 35353 35372 35396 35445 35462 35486 35529 35851 35854 35868 35881 35893 35900 35911 35918 35925 35934 35944 35961 35977 36027 36035 36043 36053 36064 36082 36099 36120 36142 36151 36161 36188 36194 36204 36223 36239 36257 36277 36286 36297 36304 36321 36340 36361 36371 36388 36394 36410 36425 36440 36461 36483 36502 36512 36517 36522 36540 36559 36578 36584 36603 36623 36643 36661 36666 36672 36689 36705 36726 36739 36747 36767 36791 36808 36816 36827 36848 36854 36866 36888 36902 36911 36932 36950 36959 36993 37016 37043 37075 37098 37118 37129 37161 37177 37188 37201 37224 37246 37754 37784 37815 37843 37857 38058 38280 38447 38534 38551 38569 38586 38615 38662 38673 38692 38714 38793 38985 39013 39131 39153 39294 39313 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-10.99.12. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-10.99.12 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-10.99.12 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-10.99.12 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-10.99.12 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd aktivierenntpd aktivierenntpdate beim Starten ausfhrenmdnsd aktivierenxdm aktivierencgd aktivierenlvm aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte PartitionierungPartitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen?Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS626 5024 5062 5079 5094 5097 5100 5105 5113 5121 5129 5132 5135 5144 5156 5168 5177 5186 5212 5223 5759 5786 6352 6652 7293 7340 7453 7546 7580 7599 7617 7625 7634 7659 7663 7667 7670 7673 7795 7980 8208 8728 9079 9108 9121 9134 9139 9159 9178 9199 9258 9275 9289 9311 9356 9382 9423 9501 9619 9733 9787 9816 9848 9887 9893 9926 10049 10056 10060 10068 10092 10174 10180 10187 10199 10213 10222 10255 10274 10286 10396 10458 10477 10596 10647 10699 10711 10730 10782 10986 11194 11385 11445 11494 11761 12220 12886 13309 13631 14056 14188 14220 14232 14410 14607 14768 14902 14922 14955 14969 15038 15151 15323 15458 15478 15590 15682 15705 15728 15787 15802 15823 15838 15859 15879 15904 15918 15942 15954 15972 16182 16432 16453 16469 16522 16590 16663 16700 16726 16802 17297 17323 17345 17452 17559 17760 17833 17917 18017 18512 18750 18901 18935 19070 19114 19253 19294 19339 19386 19630 19763 19825 19919 19924 19958 19992 20007 20035 20068 20075 20100 20118 20144 20151 20166 20181 20201 20241 20258 20278 20299 20321 20336 20356 20378 20393 20406 20420 20432 20444 20458 20481 20504 20522 20565 20616 20653 20838 20901 20937 20986 21077 21207 21260 21520 21567 21928 22078 22247 22387 22507 22639 22679 22726 22736 22744 22754 22762 22773 22784 22798 22823 22865 22898 22931 22966 23020 23045 23064 23086 23091 23097 23127 23144 23171 23189 23210 23232 23251 23261 23291 23317 23344 23393 23421 23448 23501 23511 23521 23527 23537 23546 23566 23570 23575 23579 23614 23623 23654 23671 23698 23719 23739 23758 23784 23797 23805 23821 23852 23883 23904 23930 23943 23951 23962 23968 23992 24002 24014 24032 24043 24063 24079 24105 24127 24143 24155 24175 24201 24207 24237 24251 24265 24288 24307 24326 24344 24362 24585 24891 25309 25510 25750 25934 26012 26067 26134 26174 26197 26231 26242 26250 26273 26276 26279 26285 26296 26308 26321 26351 26395 26408 26421 26458 26472 26483 26494 26505 26522 26533 26580 26603 26652 26893 26926 27181 27202 27235 27288 27314 27341 27497 27503 27546 27566 27585 27614 27621 27628 27635 27640 27689 27727 27761 27818 27846 27891 27908 28009 28014 28091 28105 28115 28139 28262 28343 28453 28481 28486 28502 28531 28539 28580 28587 28601 28614 28622 28641 28674 28694 28714 28930 28961 28966 28973 28980 28984 28998 29010 29025 29058 29071 29126 29184 29220 29238 29256 29274 29311 29317 29325 29329 29350 29367 29378 29400 29578 29622 30324 30348 30382 30401 30446 30453 30460 30464 30488 30499 30504 30567 30688 30811 30824 30958 30960 30962 30964 30974 30983 30996 31023 31027 31033 31038 31047 31052 31079 31081 31094 31106 31121 31149 31193 31240 31256 31278 31289 31322 31342 31391 31491 31493 31558 31607 31656 31760 31858 31899 31990 31997 32058 32122 32127 32133 32242 32301 32552 32693 32820 32888 32925 32932 32959 33005 33008 33029 33074 33125 33184 33253 33300 33405 33548 33573 33577 33611 33628 33652 33704 33755 33827 33893 33991 34008 34039 34075 34109 34133 34157 34190 34210 34220 34228 34236 34246 34257 34271 34297 34345 34368 34388 34429 34728 34731 34745 34757 34764 34783 34797 34804 34811 34820 34830 34847 34863 34911 34919 34927 34937 34948 34966 34983 35002 35022 35029 35046 35063 35070 35083 35118 35135 35154 35174 35184 35200 35213 35231 35251 35272 35282 35302 35322 35335 35354 35367 35391 35414 35427 35438 35443 35450 35468 35487 35506 35514 35533 35553 35578 35596 35603 35610 35623 35632 35653 35666 35674 35694 35722 35739 35745 35756 35787 35795 35808 35830 35852 35861 35882 35900 35907 35930 35949 35976 35994 36014 36027 36042 36063 36077 36084 36098 36113 36132 36677 36710 36738 36767 36775 36812 37124 37301 37378 37395 37413 37428 37450 37500 37510 37527 37549 37608 37766 37790 37920 37945 38071 38089 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-10.99.12. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-10.99.12 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-10.99.12 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-10.99.12 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-10.99.12. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-10.99.12Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-10.99.12Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Set up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS626 5024 5060 5077 5092 5096 5100 5105 5116 5122 5128 5131 5134 5137 5141 5153 5165 5175 5205 5217 5647 5674 6250 6610 7295 7356 7434 7529 7569 7591 7609 7615 7624 7650 7654 7658 7661 7664 7786 7971 8199 8728 9146 9175 9188 9201 9208 9228 9247 9270 9313 9333 9352 9375 9419 9448 9489 9555 9667 9781 9835 9864 9896 9935 9941 9974 10052 10058 10062 10067 10108 10245 10255 10263 10282 10296 10305 10337 10378 10391 10516 10574 10593 10712 10768 10820 10831 10847 10886 11136 11308 11480 11535 11570 11820 12224 12523 12791 13152 13332 13651 13671 13684 13873 14017 14213 14347 14367 14400 14419 14520 14675 14863 15050 15070 15149 15247 15285 15308 15398 15419 15442 15461 15485 15515 15559 15592 15615 15627 15645 15913 16232 16263 16298 16362 16437 16507 16538 16568 16660 17151 17181 17198 17338 17479 17676 17795 17942 18109 18667 18963 19144 19189 19352 19406 19541 19577 19637 19687 19978 20087 20144 20241 20246 20281 20316 20331 20355 20388 20393 20418 20434 20457 20464 20481 20496 20515 20547 20551 20571 20589 20601 20614 20632 20656 20674 20693 20720 20747 20759 20780 20810 20840 20865 20898 20933 20971 21224 21293 21348 21409 21527 21686 21740 22001 22052 22428 22583 22727 22867 22975 23160 23190 23233 23243 23251 23261 23273 23294 23303 23309 23341 23382 23418 23456 23493 23541 23565 23577 23591 23599 23607 23635 23652 23681 23702 23725 23734 23753 23765 23809 23847 23874 23918 23946 23973 24026 24037 24048 24055 24065 24074 24108 24112 24117 24121 24156 24166 24196 24219 24248 24270 24292 24314 24341 24353 24365 24384 24418 24451 24472 24496 24509 24521 24534 24540 24566 24576 24587 24611 24621 24641 24661 24678 24704 24728 24741 24761 24795 24802 24831 24854 24877 24893 24908 24923 24938 24952 25140 25445 25876 26067 26302 26490 26532 26582 26636 26684 26706 26747 26758 26766 26790 26794 26798 26807 26818 26829 26844 26875 26921 26934 26947 26977 26991 27003 27015 27027 27045 27068 27113 27136 27196 27448 27475 27737 27755 27782 27831 27861 27892 28024 28031 28080 28103 28127 28156 28164 28174 28182 28187 28240 28289 28329 28395 28428 28472 28495 28596 28601 28678 28692 28702 28726 28849 28930 29040 29068 29073 29089 29118 29126 29167 29175 29189 29202 29210 29229 29262 29282 29302 29518 29549 29569 29575 29582 29586 29601 29620 29646 29655 29667 29721 29779 29814 29833 29850 29862 29897 29903 29911 29915 29936 29953 29964 29989 30167 30221 30912 30931 30966 30996 31042 31048 31055 31059 31083 31099 31105 31180 31330 31449 31462 31530 31532 31534 31536 31546 31559 31576 31603 31607 31613 31618 31627 31632 31659 31661 31674 31686 31701 31729 31773 31820 31836 31858 31869 31902 31922 31971 32071 32073 32149 32204 32254 32353 32448 32496 32586 32593 32654 32718 32723 32729 32832 32884 33130 33291 33446 33517 33570 33577 33604 33654 33657 33678 33724 33779 33838 33907 33954 34059 34202 34227 34231 34265 34282 34320 34373 34413 34489 34554 34648 34669 34707 34747 34783 34807 34830 34869 34899 34906 34915 34923 34931 34945 34961 34989 35041 35058 35079 35123 35465 35469 35484 35495 35503 35522 35534 35541 35548 35557 35567 35584 35600 35654 35662 35670 35680 35691 35709 35726 35742 35760 35767 35785 35802 35809 35819 35850 35869 35888 35908 35918 35937 35950 35970 35990 36011 36021 36040 36059 36069 36086 36100 36123 36147 36160 36170 36175 36179 36197 36216 36235 36240 36259 36279 36304 36319 36323 36330 36340 36349 36370 36384 36392 36412 36438 36455 36463 36474 36505 36510 36523 36545 36560 36569 36590 36608 36617 36661 36685 36712 36727 36744 36758 36789 36813 36844 36851 36865 36880 36899 37444 37477 37505 37534 37542 37579 37891 38068 38145 38162 38180 38195 38217 38267 38277 38294 38316 38375 38533 38557 38687 38712 38838 38856 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-10.99.12. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-10.99.12 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-10.99.12 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-10.99.12 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-10.99.12Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountMSGTXTS626 5024 5065 5081 5099 5103 5107 5117 5126 5132 5138 5141 5144 5153 5163 5176 5184 5195 5220 5232 5741 5773 6265 6554 7099 7145 7249 7335 7371 7386 7404 7412 7420 7447 7451 7455 7458 7461 7572 7757 7985 8461 8795 8824 8839 8854 8862 8876 8894 8915 8966 8982 8992 9012 9058 9088 9141 9198 9309 9430 9474 9507 9546 9580 9587 9620 9697 9703 9710 9717 9746 9858 9864 9875 9892 9909 9918 9947 9959 9969 10070 10132 10152 10272 10309 10365 10379 10400 10437 10647 10822 10971 11006 11058 11275 11589 12113 12475 12765 13158 13293 13306 13317 13463 13642 13773 13907 13927 13960 13979 14062 14177 14318 14443 14457 14565 14658 14687 14707 14783 14800 14818 14834 14853 14873 14890 14902 14928 14940 14958 15159 15398 15425 15442 15498 15560 15620 15651 15675 15734 16110 16140 16157 16265 16375 16515 16589 16665 16743 17235 17455 17566 17597 17724 17760 17888 17915 17955 18001 18217 18341 18409 18509 18514 18550 18586 18600 18623 18656 18660 18685 18704 18730 18735 18750 18765 18784 18809 18821 18843 18860 18873 18885 18903 18927 18942 18959 18972 18983 18994 19014 19043 19072 19096 19131 19166 19193 19380 19429 19461 19509 19606 19739 19785 19977 20007 20329 20458 20598 20738 20855 20990 21034 21077 21085 21095 21107 21119 21127 21138 21165 21199 21235 21266 21301 21337 21384 21404 21421 21439 21444 21451 21477 21493 21514 21531 21548 21566 21583 21596 21627 21652 21683 21714 21749 21776 21829 21839 21849 21855 21864 21872 21887 21891 21896 21900 21935 21945 21974 21990 22016 22033 22052 22073 22089 22102 22107 22115 22130 22156 22175 22203 22221 22232 22238 22244 22265 22275 22286 22304 22326 22343 22356 22377 22397 22417 22428 22441 22463 22470 22495 22510 22530 22542 22559 22576 22596 22615 22792 23076 23386 23566 23777 23965 24031 24078 24133 24177 24197 24226 24238 24244 24260 24264 24268 24276 24286 24298 24313 24332 24368 24379 24390 24429 24441 24451 24461 24471 24487 24505 24554 24575 24620 24864 24890 25144 25159 25185 25242 25276 25311 25453 25470 25519 25540 25556 25585 25590 25595 25601 25606 25645 25680 25710 25765 25798 25844 25858 25937 25942 25996 26010 26020 26044 26130 26178 26284 26318 26325 26340 26367 26376 26415 26422 26444 26463 26479 26497 26529 26548 26565 26722 26753 26760 26769 26777 26784 26798 26816 26835 26845 26857 26898 26943 26972 26993 27016 27035 27073 27079 27087 27091 27112 27129 27138 27157 27303 27345 27855 27863 27887 27905 27949 27954 27959 27963 27994 28007 28016 28062 28188 28279 28291 28355 28357 28359 28361 28371 28385 28400 28427 28431 28437 28442 28451 28456 28483 28485 28500 28511 28526 28554 28598 28645 28661 28683 28694 28727 28747 28796 28896 28898 28966 29006 29051 29126 29192 29227 29308 29315 29376 29440 29447 29453 29552 29608 29884 30008 30119 30181 30219 30227 30249 30298 30301 30322 30367 30422 30481 30550 30597 30702 30845 30870 30874 30908 30924 30949 30997 31033 31094 31148 31229 31251 31290 31327 31359 31383 31410 31436 31450 31458 31468 31476 31490 31503 31515 31539 31580 31606 31623 31652 31976 31979 31993 32005 32011 32027 32039 32046 32053 32062 32072 32089 32105 32148 32156 32164 32174 32185 32203 32220 32233 32259 32266 32274 32291 32299 32316 32340 32359 32378 32397 32407 32418 32432 32450 32470 32490 32499 32522 32542 32553 32568 32580 32599 32618 32629 32639 32644 32650 32668 32687 32706 32713 32732 32752 32777 32794 32800 32808 32818 32830 32851 32867 32875 32895 32915 32937 32945 32956 32979 32986 33000 33022 33039 33048 33069 33087 33096 33127 33143 33170 33189 33209 33227 33248 33262 33282 33289 33308 33323 33342 33887 33920 33948 33977 33985 34022 34334 34511 34588 34605 34623 34638 34660 34710 34720 34737 34759 34818 34976 35000 35130 35155 35281 35299 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-10.99.12. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-10.99.12 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-10.99.12 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-10.99.12 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-10.99.12 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-10.99.12Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-10.99.12Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # Rapid commit support. # Safe to enable by default because it requires the equivalent option set # on the server to actually work. option rapid_commit # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostname else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime [ -z "$rdnsstime" ] && return 1 ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers [ -n "$rdnss" ] && new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime [ -z "$dnssltime" ] && return 1 ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search [ -n "$dnssl" ] && new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf return $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" # Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..