'Vg=r0@vNetBSD/earmv6hf ramdisk 08r=g<  r=gBkct tr=g@@<@T 08r=g<  r=gBkct tr=g@@<@TU r=gt`Ar=gr=gr=g$h r=gr=gr=gAr=gr=gr=gnA.r=gr=gr=gPX`Ar=gr=gr=goAr=gr=gr=ggAr=gr=gr=goAr=gr=gr=gAr=gr=gr=gAr=gr=gr=gmD!r=gr=gr=g (08@HPX`hpx$r=gr=gr=g (08@HPX`hN$)r=gr=gr=gpxK$(r=gr=gr=gM$Cr=gr=gr=g (08@HFAr=gr=gr=gCr=gr=gr=gAr=gr=gr=gAr=gr=gr=g!r=gr=gr=g ar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=gar=gr=gr=g ar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g!r=gr=gr=g4!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g B!r=gr=gr=g B!r=gr=gr=g!r=gr=gr=g"!r=gr=gr=g"!r=gr=gr=g"ar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=gar=gr=gr=g ar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g!r=gr=gr=g !r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g!r=gr=gr=g !r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g !r=gr=gr=g!r=gr=gr=g !r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g?\!r=gr=gr=g>\!r=gr=gr=g=\!r=gr=gr=g<\!r=gr=gr=g;\!r=gr=gr=g:\!r=gr=gr=g9\!r=gr=gr=g8\!r=gr=gr=g?\!r=gr=gr=g>\!r=gr=gr=g=\!r=gr=gr=g<\!r=gr=gr=g;\!r=gr=gr=g:\!r=gr=gr=g9\!r=gr=gr=g8\!r=gr=gr=g:\!r=gr=gr=g7\!r=gr=gr=g6\!r=gr=gr=g5\!r=gr=gr=g4\!r=gr=gr=g3\!r=gr=gr=g2\!r=gr=gr=g1\!r=gr=gr=g0\!r=gr=gr=g7\!r=gr=gr=g6\!r=gr=gr=g5\!r=gr=gr=g4\!r=gr=gr=g3\!r=gr=gr=g2\!r=gr=gr=g1\!r=gr=gr=g0\!r=gr=gr=g2\!r=gr=gr=g/\!r=gr=gr=g.\!r=gr=gr=g-\!r=gr=gr=g,\!r=gr=gr=g+\!r=gr=gr=g*\!r=gr=gr=g)\!r=gr=gr=g(\!r=gr=gr=g/\!r=gr=gr=g.\!r=gr=gr=g-\!r=gr=gr=g,\!r=gr=gr=g+\!r=gr=gr=g*\!r=gr=gr=g)\!r=gr=gr=g(\!r=gr=gr=g*\!r=gr=gr=g'\!r=gr=gr=g&\!r=gr=gr=g%\!r=gr=gr=g$\!r=gr=gr=g#\!r=gr=gr=g"\!r=gr=gr=g!\!r=gr=gr=g \!r=gr=gr=g'\!r=gr=gr=g&\!r=gr=gr=g%\!r=gr=gr=g$\!r=gr=gr=g#\!r=gr=gr=g"\!r=gr=gr=g!\!r=gr=gr=g \!r=gr=gr=g"\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g \!r=gr=gr=g \!r=gr=gr=g \!r=gr=gr=g \!r=gr=gr=g \!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g \!r=gr=gr=g \!r=gr=gr=g \!r=gr=gr=g \!r=gr=gr=g \!r=gr=gr=g\!r=gr=gr=g \!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g\!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g!r=gr=gr=g !r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g !r=gr=gr=g!r=gr=gr=g !r=gr=gr=g!r=gr=gr=g!r=gr=gr=g$!r=gr=gr=g4!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g !r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=gar=gr=gr=gar=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=gar=gr=gr=g ar=gr=gr=gar=gr=gr=g ar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g?\ar=gr=gr=g>\ar=gr=gr=g=\ar=gr=gr=g<\ar=gr=gr=g;\ar=gr=gr=g:\ar=gr=gr=g9\ar=gr=gr=g8\ar=gr=gr=g?\ar=gr=gr=g>\ar=gr=gr=g=\ar=gr=gr=g<\ar=gr=gr=g;\ar=gr=gr=g:\ar=gr=gr=g9\ar=gr=gr=g8\ar=gr=gr=g:\ar=gr=gr=g7\ar=gr=gr=g6\ar=gr=gr=g5\ar=gr=gr=g4\ar=gr=gr=g3\ar=gr=gr=g2\ar=gr=gr=g1\ar=gr=gr=g0\ar=gr=gr=g7\ar=gr=gr=g6\ar=gr=gr=g5\ar=gr=gr=g4\ar=gr=gr=g3\ar=gr=gr=g2\ar=gr=gr=g1\ar=gr=gr=g0\ar=gr=gr=g2\ar=gr=gr=g/\ar=gr=gr=g.\ar=gr=gr=g-\ar=gr=gr=g,\ar=gr=gr=g+\ar=gr=gr=g*\ar=gr=gr=g)\ar=gr=gr=g(\ar=gr=gr=g/\ar=gr=gr=g.\ar=gr=gr=g-\ar=gr=gr=g,\ar=gr=gr=g+\ar=gr=gr=g*\ar=gr=gr=g)\ar=gr=gr=g(\ar=gr=gr=g*\ar=gr=gr=g'\ar=gr=gr=g&\ar=gr=gr=g%\ar=gr=gr=g$\ar=gr=gr=g#\ar=gr=gr=g"\ar=gr=gr=g!\ar=gr=gr=g \ar=gr=gr=g'\ar=gr=gr=g&\ar=gr=gr=g%\ar=gr=gr=g$\ar=gr=gr=g#\ar=gr=gr=g"\ar=gr=gr=g!\ar=gr=gr=g \ar=gr=gr=g"\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g \ar=gr=gr=g \ar=gr=gr=g \ar=gr=gr=g \ar=gr=gr=g \ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g \ar=gr=gr=g \ar=gr=gr=g \ar=gr=gr=g \ar=gr=gr=g \ar=gr=gr=g\ar=gr=gr=g \ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ar=gr=gr=g\ !r=gr=gr=gi!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g ar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=g ar=gr=gr=gar=gr=gr=g ar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g!r=gr=gr=g!r=gr=gr=gar=gr=gr=gar=gr=gr=g!r=gr=gr=g!r=gr=gr=g!r=gr=gr=g B!r=gr=gr=g B!r=gr=gr=g!r=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=gar=gr=gr=g!r=gr=gr=g!r=gr=gr=gar=gr=gr=g ar=gr=gr=gar=gr=gr=g ar=gr=gr=gar=gr=gr=gar=gr=gr=gr=gr=gr=gbpf!r=gr=gr=g $r=gr=gr=gh$r=gr=gr=gN$>r=gr=gr=gk$r=gr=gr=gp$sr=gr=gr=gr$r=gr=gr=gxAr=gr=gr=gzm r=gr=gr=gw$r=gr=gr=g{ $r=gr=gr=gAr=gr=gr=gAr=gr=gr=gAr=gr=gr=gAr=gr=gr=gAr=gr=gr=gAr=gr=gr=gAr=gr=gr=gAr=gr=gr=gAr=gr=gr=gAr=gr=gr=gIfN!>l;|QDeӳ+} !buN AG9|vi-8B}XXA zLWAZWZv. _Bi~jm6G0=i>\Sen@ |IOW{)*{iUU7;ݫUA\Hr!^ۜNv)Y wK51V-jNs,H̄(t"KP@g0R'h2K*^n $n[t¶$K:3vI!Ӈr#zt*n~(. X :( sj RAb(acV$A-&g,7&Y|.AHū%L(Wd 5-eߩ cG373z&v,WEZxXWf,BYiKVXĒy);k75<)M_gFMG{|ƘAwB2>\Mkj"W>W~Jt . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(48!4 (  !:%:%8LL !:%:%NetBSDpmAPaX NetBSDearmv6hf4p@-D0D 0@`Qp(@P`F`F&a03/T@ph_$9$A-`0`` 0PpU(pGpG@Pq`P03/T@0US _$\@-dPQMI T!T1 P`0 0R0418  0S  /S 0SP w00S4 0pp WI2I0@3)1*03/ T@p_0pWH2H0@3(1*03/X@ d 0 P0 0^$xd8$L7$%@-t ttPl@dphP LJ^`POU @P @.r9rx &lK  P@-@⥝O-`00R@,2t(Mt@0[m gPp@tt@(  R  @PSp0: S ]`0SЍ @P0`0vw9 0wpS0S)P0 S0 [ P  1 0S;00 0   P 0s s0T TH"T   YP R & &?:lss &zH0`  BR` pRp RX Xp/ & &@-l0 sx & 000/<&pC-؀-`P p0M @&{ A (& A{{z`P$0  ЍpY@<&b%vx &@- M @00@  P % ЍvA- l1X0Zp 03 O@P k0S@ (( @0X;0% ?P-  U @0`V/PkX`! .pk0-S @| @PhP ULP@ U(p0SX b%vvP&wO-6M@T  @P Ѝ  p` @5Xp0S 5%0 0 |5X 0S_d50S&<0pP(@~v0SN50S0p NpPJ400<T$尠E00CS0 &Pᐔ Pp  PYU @0 P00CS0 v&0 X80: S  +Y +pP p Qt  X0 0, 0X3($05x000 00 Q00SD 0 0 `Hp8  p 0Y 1(#00 H  0P @P㴂~ t0S@zK"I 0R 0[0YY]820#0 qp00 R0S 100S  0 7(t Pʨ0S;a@T c@P@0 ?oR20S 0  H1 0R0P( k@bP c@0S "P0S P XJBTy P0Rt00!xP `&b%@&H&L&D&\&<X&x &w &T&<&y'&l&wp&0@-MM@P  p  ;0U$C dBP TTۍЍ08 P ,(0P XEwb%Rw]wT&Q@-@ TP DD,P $ 0P@b%RwiwT&Q@-@ XP HH0"^P $ 0P@b%RwtwT&@-\i0 ~wx &0$/@('0$/''@-x@-x@-1x@-Gxhd@-1   0 0 Ѝ\x8('@-1   0 0 Ѝlx''@-1   0{ 0 Ѝxx@('@-0   0l 0 Ѝx('@-0   0]00 Ѝ''@('<00/@-0   0G0 Ѝ''x''<00/@-0   030 Ѝ''x@('@-1  ,0 # 0cp Ѝx(' 0@- 00 $0P@N[Ѝxf%,0C-`A!圁!ᘑMpW0 |! R0B=00 B  T90L 8 R<B 8!4100!0ЍdPP =(p 0 R`Gv@0(S  P|am (_&?$00 0(0 fS0V0? 0"`aQ8 4@Ђ`ƟUx &Q(('60 p@-0 ?0PYP@@ S0P  00S/S``}8PXfp40p@ \1P(AD8D<pT*'x*'M_S('()'lp@-@(P P 8@` 0TTP/pP8(PP M8X8P 0"p('x &@-8@P(P 8P 58@080i(' @-@@>yP $000<0   R`-' &('@@-<04@pl0l 0 0  L00S   x & H/'L/'$/'$0\ 0S P/'  L R/   /@- 0 MR  !pxpЍd d@` Q@X  B ?@< 0Ѝ@q.'.'/'0Dž /'/'P `00CS`0p S00 P0S X0X /X &: S@-  S  S/ I* S  S%|@=A-x1`@pTXPM !X(@P10S D10S- 010'Ip  @0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?; 0T00S .'م.'/'0AH/'L/'D/'T/' /'х/'$/'s@- P@@P `QU00S @HT DЍp0t  Q \0 \@.T )P@%U`/'h/'p@-P@Tp0 0C0  ,B @G-@0M㹯(3$30S` V0Ѝ0 0C0{ 0XPS !,Q0S 20Sm  4 "; $qp| t 5⿰0 0 p,H20S 84$ ($  20S  $ 0 : SK0( r" 0@"$<10S10S51!0 0H 10S|10S : S0: S u`x81p 01Rp(1 B?: 0 'Q p| 4 pP^ 400S h/' /'.'.'م/'0A8/'/'A @/' &x & 000/t/'@->0 wpLx &@- M0P!00A00P!0 0L  p۬ Ѝ "$ 0P @000 h0hj pX   DH("$  (0!t/' rцO--Pe@PQM Pn c>0Sr   卬pP 0S P } t00CS01p0pЍ0S P PPpPX ⡭) 04 Rl$Up0! 0 X 00CS0pp YX (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx 0 P 0S  tP`P X0: S P8PQ P <X0: SPX pPb0S 㝛 ᄲ  P= ɯPث  R $ɫP «0 ¯S ,!0 0 H AE! A ({{ z0  p圫00@0 P <劫p lP R=0S  }X0;X0XP rP ;=0-S  e]PVpPp0S  DPpY@t/'wx & &0 ,<vwGUivs@-@ `PPN"0Ph UЍpU \@ 0 P4@꿇g%·݇A-A~M0pSM P0` 0`AP<p! p~,P <@!1P~܍Ѝ0 0`!P< ~,PPʈ< ~,P `0 0Ps<x W eQ \10 00P[<0$ \1g%m 4^00CS0 0 /O- U`DMp b000D$000 0000Spp< V"4`0p Q 30Sa4PZ|PZ <0`$ 1-000 0K4$P;0$0V 0030p Q  #P0 0;0#0V0030d#P;0X#0L3000DЍp(0: S W0 S" -P 000 S|2"00"00 0R  Rz2`2Vn `i S0% 00 0I3qpt;0S 0㐐唠0 0p) W W)2`V%  ? 5 10 0R  S0R 0!CQ:++R:0'WW~Ta0@ 0 4T04[@T ;0W ` W00l W~,0 ~l0`Z BP* BP*Q*S  Q T0`g%/'h2'\k%g%'/'9$g%-g%Km8@D['H['/( .g%/'H[' -@-,BPU` V0bP$00 p?W0 pGWhPh:0 SV.00P ЍP#ڀ;;S 00 010Q P?mPppD1$p0pQ Q(% 00$0SP ( .90S0090ES0090S 90ES $0Sh.90S 90S 90SPU 9(0( .g%/'N'Њ-xt!0SX@-dQM0S T100CSD4.Ѝ0S0SS/ 0070S S00.S0S0@pT0pS 0L'1Qo 03p T01Q00L 0P000S$ʲ//'g%\k%8mgG-P`0 P ,p@P"ڴAQ"0Q 0Q P 00Q9D .ЍP 0Sg%/'ˋ@-xaPMP d1@0S2 SU@D;00U0pp0 00Q8 -Ѝ P0S(0S 00Q8  Pڌ0U 0?i2  dQ-0 P 0&P8 0, -g%/'*W|H['mO-rM,M R(`RX0E@FP0 0S 0 00 S(0S `  P"L2p00 20,"JJ?00"Tn" ?܍,ЍT ܁0S =! !!0`* 10St1pl1 0010,!JJ?04!00(q0(`01娀(0 C0J 00 $0 1 0 h r0| `j) ƿT\k%x &/''`['Œ͌'p6'h2'(P['g%-C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S R1 A#+ 0S pP (0: S0 0 p10S10S P㕿墿P t0 0 0S q4d 1 *00 0S000p000 S(00(000 P@0S 000S x0N2P 0+0t00P 0X*g%h2'/''''''^/'\k%''`['P['A-MM, P 7# ,G P6",RB$0`SF 0`CĂ0S2o+p1P} 1Px 0 u S( .p[+lY+h2Lr0`0CSXXP+M+HK+DI+@G+<U+P,1P000 06+ 2 `ލЍ,+0S  R  sS SS YSRP+yS+$qx +l+<+P,1P 0S8 41P( T(1P *0S(*PP Ȫ1P0000**'g%/'L''ߍ$g%g%5\k%ʎx@ , c'Z{q 4D` Џ00@-@FpQp``k%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S *@DT  A0d#0UPTP*PV0S pr*@X`ꓢ" @2/PL0 !ᓢ#, 08Pk%Dj%h0'\k%i0'Ր'O-Q0@`p@F d[ PppWPH8* ЍPT10S  '*p@ 0 $03/P$ 0 R T @ Aw  80 3/PuP\\00Sd \) Q < 02/P " "'h0'%\k%Knp6'i0'@-AMP/M7@P+ p`pMP/0P0 Uh0h *AލЍT0_"/0P0 0@0 `*t6'h0'00CS0 -0 /0O-S$M00`Y P$ЍP0,03/P00L30S, 0P! 0p 0P0U00pPF0P0 000/`F p -+00`00Q Q P0 S  PF@[' PpP1+4$ 2 垟0 40p谖Ӗx'0@-PM@ ᑴPh00S Ѝ0 $ R\ 04 0R\ '0@-MP @kPЍ000S0: Sx%PᦳPU *0D 8P 0V*0 ', 'Ӗ0@-M@, 0000S# Q0S 10S  P'0S% X0 "?A3c000S&!h0 "?A3c0 aP *0NS *0X Ѝ0*0< 0S ppk%lk%MbJ.p@-@P`P p ṲP $0X*0 Yp'u@-!@ᨲP 0D*0@ D'O-P0`/Sp/M/@P7 坳P. mp /00 ᄳP&  P!00S  cP xP0 Dx Ѝ'G-@P 00/S (QP 00Q  GZP)0 0`0S Z뤀夐p0 CP)0S@$<jP@D0+ 40 @ Dx' '''A-M`P@pP5(10S Ѝ 0RP  0RP 0: Sv$P &P\)0 ]ỲPW ᣱP H) P W0 @?'8, Vg0@-:(4@: SM=0P - \ 00[ P0 Ꮂp 0: S ,Ѝ000  tꁘ:P/  0 fA-pQ?ZdV`P(0H!@1@0S/0(DS7 (1!0 0 =  "4S pP(p0 *0 40Ѝ@$<@0(DS PL(DPL(DP= ;00 0갖''pk%lk%x'O-J#Q30` P (tJM Mp40CS񟗄4,3#P x30S ڱP0: S* XP2,3,0(So0S| (4S~ 0S20S 4m0C?o2 000! "p"<p,(0 ",X#(Z/ Z\20S0 0 D"J>0@Pz=0 CװzS Jލ Ѝ  4 Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40"Pz P#1P' 0 `0 + G`\ QX00O0S0(4 008 00''''pk%lk%ǘ''"H/O-p@M W 0DQ 0S08 0<000SPP0C080pG0S 0`S : 08 0 x! x3  P< L'@0  0R X2@ @? Q*9'@0 :0嘰 R ᾚP` dЍTT 7  ` `@~`X'T'p`'\'Rs@-Ѝp@ 0@`PQ&08  ݮP&0 ꖙ'~0@-@MPP00800S =J"Ѝ0'G-`QM MJP㠔@ Y #p ƮP 0p 0PP=! SR J(Pݍ Ѝ#PJ&8 = $ HL0RP J(L0 00NQJy&8 PTꭙ9™G- QP 9000aq@T+00CS0pT0 0S0T@ 0 S@ 0 :P 0S@ 0S0 0 S P ''j% & 0 0 S00@-@R00000S0@000S `#P LP40P'''' 'p@-PP 0S|p `@P` @P0/S000000f PR @@@p,G'h0 RX R  H R/< R/ $R/Q/ +''' 'l0A-0S X0XP@0P`PpT R S: ,0@''Ux &nC-b@ 0,MS0S.,Ѝ0 0P50C S= #X# #X#"8#X#X#L#L#t20S 0X0 00!P! " jPPP  0!$7$!2 0!0 㓝 Iz X B$(4 : S>  S8  S%  S04 0L! 0 J $!1 P6 S  S0  S04=! 0400S -ЁЂ ;Ѓ"040+04 ܬP$0P 00   0 P''՚ 'p@-8M@  D 0`P`U`$ $ @ 0ΞP8Ѝp)A-t1hM0@S T1hЍA`Z(="(<p@F1WpP0 0000p084 40CSH$0r"60"$0( 4 CR+x hЍB>'PS+<  tu'U05G58 YR@-@XM="p:(⟓0 XЍa7@-@Ppp*P Q Ѝ0 0p  tQ Ѝ0@nQ0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-PP,0CQ@0#S : P$B0WN%R0CBSB 3b 30g"PpA0NQC S*p P@-*0S ^*00 S R( \000Cs R@30 ? SR@*:@ 00 Cr@ T \A Cr@T2  0a0Cs R"  p@-0C@0 PR#S : $B \N%R02W" 0C@Q `@ 0!PpANQ0 C S*80P @-  //'jA-@8q8`Q PC-PQPUPQ S A詗A\:UP0 ddk? 0:S@ 0S000 \!-'&x &/s@- `a0P PQ10*@PЍp0S @mR! bR kR% + 0*S xS SwR! /QP0@P0$+* &!PP@P0PA- 0S,`PpP b0P# X p R 000R p0000S ,P0=0@PᏖ՛'s@-@6`P0C30 0  R R00P!@P0@( 0ЍpPE  00'@-  _O㎭x &)0 Rr @-/\k%@-4@4LO(IO FOCOrx &]4.O-px =@ \Pp`!0, [/00 `B' O-lM/PV$oPm@P p`0p/小0/ `0@ ?/@|p??A0s S  R`?`/0X CRSE <zP񟗳7@51@56@5@5@5@5@5(7@58777 7@5@5@5@5@7@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@5@566@5@566@566@5@5@5@5@5@5@5@5@515@5@5@5@5 66h6@5@5@5@5L7t6@5@516@56@56@56@5@5@5@5@5@5@5\44@544@54@54555@5 5`555555555@55`N>4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<=????????????????XClC?CC?D8D???LD`D`DpD|D???DDD?DDE??????>?4?H??\???t?????????@@@AA,A4A?LCR@P꼃@2PH |- 3@ > 2@ 9`3@ <2 3 T2 @ .83" * 2@@ % 2@  2L 2LP 20A00㬁堑 RK aR eBp Q P@@@@@@@@@@@@ !00000 00K1]PJ `1J  P1I  0I Hꈁ 0 010L0㔩1Pd H'''L'Dg%>&\k%x &' &D['/'('lk%.''pk%'''k%k%k%k%k%|k% 'Dj%'lؠ &ߠ۠rj%Сn:O r$''hk%''X-- x &I 'p['H_''`0''''''dk%'\!-/'nL' G 0.'j%&''@g% J#٫L#իJ'0   0G 5가z0P  , G# 01F  1@ P00F j?P`1*PE 1E  1D s1 1C1WPC1PB $2B  42A  D2A  T2p `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C 10 0S3# C*SS8C0U Pg000Sv|30UӈePE3PhPN0000S 3 Y0P  /'l0P/`0p@-0 PL@LPP@0@@P6 ̪B''N}x &'A-`  @PA?\+ \ *\.  Q R( [\SPQU !\@@]^.!Lo \0S8 /0S0 R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^  'p@-@@0/SN00N P\SpPQP`Q*C0CT030@"L00Q*pQc@-1MP M AaqQ P/P T 0P0Sۍ Ѝ.S@T|`l @ @*'!T  Ѥ'O-cM M33 "@p 3]PW0`0 00S 0f0 0 0‪P`` 00 ;RSVz @0 0;T* R`DV:  cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 \ 0@&P\P   (0 0CP;T+ 0S( `0V"p0S 0 0S @0S s  u0l 0 x/@T *0S0T00  R S 0  p' Rx &lC-`PMM RP  p\SP RT P0S #  0S᷎\S R. gS PS$ SS GS kᢎ 0 0=pS sS0S00 R @@@(PPP ?v@P p pP ; ە0 0] ۍЍ该G"p'ȥA-PP 0Sp`p@PL P 40  R p`@@ @ezp'X0A-@0LPL`LpT  SV H0@p'Ux &`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0  04HP 0S/  00p0S/  0`0;  @0/S000 0D  /p'' 'x'Ѧ0A-j40@TPp 00S0o`0 00/S @Tx0T0oP0 SD fP04p'''2A-0@SP' 0`.S0.S0S/S XSdP 0 Q CR S.R  S.R0S/S | 10S410S 4P:4 CSR ! Q`V 0/S0S.00 p  00C0V0<0F `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0 0A0 B!"00@$&A-Q@pW :<00S {mk@(''pk%lk%hk%7@-@@Q@A@P0!!\S  q  10@  Ѝ0 @G-鸑M@TY `P!ApT 0S @T ҄@PP 0P0 0} QC ,P5]" 0`! A*00!f !QP  ލ P    #P] $0 P  0lD nچd(  ('Gtk%_wά1G- pWP `WY @ ^@P P` PAᤆᢆt@T 9 P`3 P ᐆP$('8d0A- @T`pH PAT P @('Qqp@-@@,0C\P \A@ \ @AAA A@AP:0Q00^A0@00BP0B 03b 30w@pp0 S  0 - R 0R$R:/A-0A R0.p0X!MPPaM\ 0  C0/S' 0 !  P3ڍЍ *R.@ ?R 0pC @@\@0@C0@0 C0 0  P 0` T P 04 $Ԟ $&_ grp@-`0Sp@e\ 1e #@ P嚅000p 0@-苭 900S  /H'0-h0^0 SQ0Q00PH' Q#p@-0PSp  l⇺P`0 r   H @Tp /xk%A-`p娀u@PP P@ P 0 \YH0@ LT00CS0 $ 0 8\k%$RH'M-`PPЍ8"7:0J840K0CS 2  `70 01 .  dd (l] <tX @ |qp}  H=/ 0$  4 =C@2Q! 1Q) ($5Q/^)040)($84K ARKQ  $ q++  @ 04(4 :(40/S0004084(49)($ q++@k$T' \'C-j4@0CEMS*xxxyxxxxx30SPP EߍJ(~J(J(J( J(S20d 0n00CS100 0=P  0 R ⨁0≎ᩑC  S@ 3. b 30  J(L0Pu[[P001  Є=Ђ0(p ZP0<x SP0@ LP00  0 CPP t00 08P` &PJAPP P >H'xƮ [>'// Qp@-(0PS$ l` 埸@P| t 0000X0 `%V0  @pH'دO-P`P Ѝ#y :0J84YqW V#/00p0K0CSt3l IPk0<00H3  a  d ( |qp  }? $004000JH1vP tp@0 B(1<P lb<0 㓍 H K06S 0S 3 CRUL4gSy K CRZ0 40r;;000(4 9 xS!04(4:(404(49(408400C /Q000Q($4S::  $ R(4 @0&"*4*0p000 02S($0 *4($040)($84  R KS 0 0 40r;;00 00KS8  0( $ T'\'8H'O-z4@SM- S `cV:60VS0d`F`0PS/S`S 0EoᨂSXA 0CSS 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R'0o  -R(0h )d%b#`0 ]$&\'T P'"X'D'g0@- @'0s@-0P`0 Z0`0@S P 0R@P@L  P@D0S00S <0ST P000 R  Ѝp@'l'Pl%i T ȳ@-L ^긠ܠРd8L(XTL @@~$ \1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP ! O-`pu딠P @%RB &R X*6! 2[00 @P@ P@ Ѝ@'@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F4P@$ P@ݒ W@'Dp@-@P0)Sp@'O-@`p04MTV TY T( T) #T! @$TU "T 0@#SP  ! 4Ѝ'0DSYG x@W'0I @S 0 0@SP'Y00p0p!o kW! uz! o0  @@P! b0  @PYWO'T@@p@P, @9 @'M$2DO-p`M8P谟蠟6!@ 20 R@ 0DS U# 0 ^ 00S^^ :U 00SY` p PU @ 0DS Ѝ@'lO C-`p 0BS00@SP! @ 00 TPP@@ Ѝ@'G-`dP0@S! p0 00PP@@'@-@MP}2`PL0P  IR NRpp PpEp@@0PS@ $|2Ѝ@'_PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P22Sp0@1PH0@P 0,S@20@l%Hl%X'l'@P/-0 /RRR00`'@-@PMލ0/S Xp ݌p 0RP 0RP, p@-`\1@SP p1D0p@11N0"SP VpG8yg`'{p@-T` RpH0@Q 8 PP H1pp@`'k%O-pWR 0S)P wB000000000CS020S @T  U tU`pW1q828b0400@/Sp?EpPI0S0/p0CS0oppW001000pA0P00 4w000 hFU \BU00CS0810S 00CS0 0W00 pR0S/S0@D001@ P  R*0000t/S0S P 0/0CS0 pG0S 00CS0001@1@1@`''|'@l%X'Hl%, A-Pp00`0GP 00CS000S B0@0CS0X00S 3X @06 R0S T$0$pQ@$'|'Pl%`'UG-p2B`M 8&0@T"U@P$ 0SM .S00.S0 00/SSC10 p PPB|ePpZ% ``VTJMPP@ ` /` E0Ep!q@`0-S0S0@T@@uUP0P0: SVP >PЍPl%t'`F$Q ʴ`', ô@-A$0Q @  T @`'ٴp@-L@Qg70P000S LT#PP 0S}s@@P 101P00CS00 #P 0 P0p4%wT t'`'`m%9G-pPp@R` V101 +Pp $Pp `b\TQ @0T! \0DsQS񟗀Ĵ$,@0 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 O 0 0SY00CS00 yO 0 [O 1 0d1@ @ @ @ @ @\@@`m%:DA-@ ` PR 0R 0S S*Op0S0 R O0S  OU  OTO2v xO Td@00CS00  O 0 ANHm%l''2dm% \m% 0@-Pq0 0嫗l'@-@(0Q p ,P   PPP 0/p 8 0  Ѝ0 r0 0'k%2k%@-@P 0S0S 5P 00 0A Ѝ'G-`0S q0P00#@儡T0SXm'@d1$@00CS0D10S *Ѝ00S P UAt5  R *P00CS00S UC0S CUP@ 0Sy#'|''˶C-c@PP^0M& S';,똓sQ@l 4X,,|,,,,,,,,,,S#$0@30S CK0S 2$P@@T L^0S 0S@ ,T ^0S$0 0 @^0S 0S$0S 20S TH+ @@$@++10S >H0S 6Ho^0S 0S$0S @TM$@P10S H,10S H 10S H00S H  0$ 6 $0?o2$0-0$ R  h00S G 5@OL<Kk+  ЍPl%'''Hm%G-PMp@G+0 `㠀堐堠APP  k+Vx0$`W U ^0S W P 0`S++Ѝl'4m%Pl%'P8PG-P* `0@00 0R0Cp0W S `S0p 00 P++S p0@*PD0(00$+ 0$ 0$/@l%Hl%X''A-Pp`@䀟000{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S S'Pl%G-P䑟 M^`AV $`*pWT0尡p0p00WZ 0S- |1|a4:Kl8K 6K00CS00 J 0= L00CS00 J 0 J  ]N^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 H* ЍPl%'l''\m%A-@ M p* 0 0PV@T/ 0S0$`V@ 000,P 0`@0T$0 R ^ R 0 R 0$0 $0* Ѝ`0l''Pl%G-`倂Fo@p0媢S' 0S$ L2LRH23}J8{JY8(vJVrJ00CS00  J 0 IQV000  'P7 V a< 0$000CS0l10SG  D FP~ P00CS010S C00CS0 VVp00S $0$0CS0|00S 0S0S0000T3I8IG 0}IPl%'\m%l'''|'p@-42M000000 20S 00S 1 `1&3II0Q@TI1HIPP& |1  1@@0S @T H1 YD@I8I$1%I0S  1$ ލpA 0 000 0vBP00CS0 0@ a0 00x0 ?00CS0 0S hIlfIL0HX00S @00S t'Pl%'l'\m%(x'/''9|'0 @-`o 0 00^0$MSP4P @d(000P pn&P 00S ?0 p000CS0(00S h($ЍPl%'A|'C-@?mM000@H0?_00?0 0P@,@(0@ ? `0d00@T 1PPdo0 `0Z@T pd0hP 0$o 0lP@T 000P0l $00`0S$'`0 S 0D0>60S >0S$0S 00D0$ 01C 0d>0S$0S ph@DnT@ xP H047S 7S) >0S*00S5 -0000,0(00 0p(0P =&0S(7S%00S 0 0Sd= 8  ,=, p@ P 0 ,= M8 = <, R , ,( y%P000<<0S @A @X$ 0 $ ` 0bh<<<f1 Hh@T: =p<P~`P H00CS00 G 0PppH@T4`@T @ [00CS00 wG 0 H@`@T0Hk PU#00CS00 [G 0 :,0Sh@P3 F 0,0 0H 0'p''l'l'Pl%lP ''AT't'|''\m%ldxm%t''T!-&`m%Hm%dm%Rx''!\'p' d B a9 G@T(0Sp0 t0},0 0s,!p)DlAHF0/'0 /'0 /'0/' 0  /'P@-@(P@<0 QP cR   胷'0 S0/'0@-0M0/0@0P ~P T0: Sl  S` PЍ0~P0 : St# PP'0 p@-Px@x`M$P*00S m#0`00``00,"`0#$Ѝp't'@-h@P$0'0 RP  B R    '//C-LM*8ⲍ8 p@<(P@0` D, ` 0CLЍ0`m%A-@P`|pWU vNU" 00w(p|''O-pWC R``%` P0S:S2UE@А @0S,W@  @^0T/S/00dc0 00S00P R:R0:SPPP*@DO`"S"@l%Hl%'@-@MP/p P㨐K  0 @ T9}p0 @~0!0P 09pWZ0S 0 `T0S 0S 0 SW}p @F" f`P T T T0@@T >0DS'A- @PM`RkhL1000  8p"XZU h CB Q PBLBQ8B 00AS 00CS00 sB 0* 00CS00 cB 0 ЍQ PBB000M 00CS0 TBBHD00S Z,z'ȷ`m%'|'p@-P@@Pp 0S%SpLP @tZ p@-P8@Pp 0R;Pp@Y - @0@ R0S P P\ 0k%'G-`P@唀0吐00|Up00CS0h00SG0S0 S 0S00[gPPp''k%|'A-`pP0@00 Q Q:R@ @:QR@P0SwppR %Rw@L%Ppp0V:SP0@w@''k%%A-`P倀000|Vp00CS0T00SA0Sp00Mf@T`''|'0A-pPS R+e`a@T"W p000Eg 0 @0 0 _a00CS0H00S G`QP `@''|'p@-P$@Pp0P0@Y @-L@000@00 f00CS000S@''|'O-PM/`@ 0P @@@ (h{P000 0S 0S 000Ѝ#   P@ |O=P @bPR R R R 0S 0   " R0""  " /R0 dpP>Z0 R"00ㄲ0  pPZ m P2 @ 08@00Q  0S/R10SZ $P %pP A0000S R  pJt#PS R O R K(zP0 * R; R 6"0@@DX P R  Jm T@0000S R    BR =D R9 7 a'$k%'\m%%'-Hl%2|'O-@`pM&PP'0S*[ 000`0p0Sw|2!| S6hB?01 P@PЍbPEUH\hHHHHHHHHHHpxH00p`@[ Q  V  0P!0X ZWYV M1 00 _0S& 0s1TP P*X 00SW0 0 S0 P 0ShYT 0s P ks@TGt''`m%QH''k%p@-`P0000S S@iK000 00 00000CS0p00Spp@ '|'0@-x@M0 0000\0P>00K 00CS0$00S Ѝ0@Ѝ0'Pl%|'@-gP 0S&KO-@p`SM%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩\0@P00S"" 0RPW>= >0 @ TW 8L> P 4>>0 R @ T Ѝ>>A00CS00 > 0 00  x100/PXP!  qZZW Yh>e>T_xPW[>W~`FdWxWtWq ~W 0` @ p`>`'꠸t'UQ 0ٸ}!`m%''/.DYvO- MLBLRp(0@0`V' VV:V  VF /V   BR 7` F Rxxxxxxxd! R  |a[  0000SH%B@P  ~p[/R 0/S 0vYP Ѝ}Y @TW 0 BR r R  BR    BR  U P Hl%L'X'Pl%`FV A-(A0S 0PS0 0aqP0S00 P000zb00CS00S P 0SRh`hp0P RP000Vb000CS00S L''|'P's@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `\@0S00S=STL00 <0 R0AD1U0 S 0S Y X0 S@0 S@HY" \YX0 S@0 x0s0S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x r SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x~^\| ]\Q000``S XSQ0 0 @ 0000xqQuS^ P[Sc:Q! P-Qe]Qb  \QQ PP$"`( *tP1 0$0 $`( tP%H0P6PP0 QPQ P !$ P80QP*0$0`P $``0]S0 S 0p@Y(\PP  8QP4\SSPP0 SP0S  @p4ꃹT O- P@M0?S*S3 [S;0^S!S00x|\/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xpPS@0/SR"@ R0A$x r RP R  \$$ЍsPX9$P| 0U0/Sd 00E|pP $0S/00E0S``0` xqQP 0S V/00D0x r RP0  Q: 0 R /00@>@0P .Z. B/o" R  P V0 X$L', B' |'0 q Q0@-0 @\C\0CC/x~^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0SL P m$$$]0$000CS0H00S O 0S ~0PL''|'p@-@ PTp 0@ @@L'G-p 0s0 S QA0P 耟`V `R`F@ V PPLX@S`` S =QQ RU  0P   PT 0G-p@ Mo oF0P ђ8a000e U00SW-00E@`PIPE@T Ѝ00CS0@X'O- R@@0`-SPM S! C RtlD?So @Sy 00C Sh0 0 W`0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P@7@p<(W@A0S 0g0CS00  P6FBЍ666A0000Q00S h6h pR\&TV(0S 0 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 R I 0  U  R~ȣ0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   O ~ I   0S q QAQ$AQ!   Q R V  BR + `w~   0 BR儡  BR  ~ ~  `K E~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  00|'\'V X'L'(Q ,Q Pl%P'' 0 0C 0S0P 1P0 R"Y 0C0PEPE0000C0$Ѝ0000L'Hl%X'l'DO- aXQ q0@ 0 R  p  000XP P X 4 0 E0CP0 Ѝ0S L H}1L008  @D0000D B{L'Ll%X'Hl%dm%U$Q O-@ brP0  DR40c0异Q} R    00d2T`P `8 T_ T@-@FT+: PR0CZU * TR Q  S0D2@ P80Z0Y0S@@T: Ѝ@FT: P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C0`FT00 0 D0C0CS@0 000000C0000{0000Ll%L'X'Hl%C-PpM@`᠐ 0嘀00000p000CS00 p0@R i@ЍF00pL'Hl%X'@l%A-Pp@s0A00CS00 / 0 ` V[000CS00 / 0 ` V`000CS00 / 0`.`m%@-!@-!00S/ Rk%T0QH0 0Scq o/P0//x'k%0    B /x'A-P夀0@000p `R$ 0 `0T @ `  0 0C  S000SAn'k%x'|'0A-P` @0p0W0 DP 0X S S0 000 00 0h0 $P   00T T00CS0 00SA4k%'4m%x'|'G- b B0 pWcr 0S .. 0R@P܁P0/!hP2b000r0S^00CS00  0S 0Y0#S  h P   hP/ 0 0p0P0 R R   BR   A   BR 0E0CS0000`0D00S .00s.`k%x'Hm%dm%C`Pl%\m%@-L@00CS00  _p00CS0@Vx'@-T T@08     00000 0$00x'k%A-P`@000% gV |`0Pڸ%p0PS Z  D0  0000CS0 00SA<'4k%x'|'@-4ap00MP0Bg@P hP(0: S$ 0  %gP  P6g-0 00 )gd%T!gL00CS0,00S Ѝ'zĺ|'A-h@Q0P0`0 PHpP<0`00CS000SA'x'k%|'p@-`P@00P0%P #S 0S00S0X 0000CS0p$00Spp@(k%'x'|'0/k%p@-@,`,P0SpSTpk%'ܺp@-P@0Spk%'p@-@Pp P0Pp$0@pk% 0 R/k% @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 '5rOk%A-R0S20SP`AT p p$fpp ($V$KP 9- 1N  PpWafp Jf 0P ޘ))):f qP fpS  gKp,S f P jfpS  MKpS $00(((`'T'k%±|>Pl%P'!E0S/p@-@PP1PL1DP0a 0(00R 0S"00D05#0s  0C?o2^0SPPpOP >SmP p0C Ao PQP0S*00CS0p,00Spp@,'m5rO'|'p@-@\P0P00 Q@00CS0p00Spp@ '|'O-@`LM R0 LЍOL,ؐY) PPY   0SPs  0 S S S PQ 00SЀ0S@LЍ0S}22 F!0R+  p  !R -  x",p 0 0H" , p0 sT K0{p+ 00CS0h+0p W +㴱p^ Z 00CS0Q+0 00CS0E+0 | 00CS09+0  Ѐ YZ+000u + #40  + +P S#4s+R 0 0p@ gd n+pZ*0㓉#ЀC'k%5rOϻػݻ=@- 0 S  .^\Q0  p@ S0C  C/o "P R pO-PP10 0%SW P i0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  &P T"@` P9P \0@00SJ R Q !" R @k%''7G-$a$C0S Qq0m0@S_ @ *Р㼐0Sʰ00CS00 * 0 R+0 R  0 S !c*'0t'5rOUEw`m%A-p@`QP00Sxt10P 0S XjPp pP@ gP`WP P11@'*@V Q@ T0`p0S0 *@00CS0)0S 0 0 00SJ 0 S 0 0t''5rOɼ5`m%800S /@-P `'8 P  /Q 0SZ//'`060S/P00S/D0Q<0  40 A!0 S00)Pl%T'\m%'5rOϼG-Q`0SS@00SjZqP000M:<@ 0@C$ Q 0000CS0L10S 4q000$100S010000<>00V00CS000S 0S @pWZ00萠@ 0 ZHNꙂ! P00 R @''|'Pl%A-`!@SPp% L'WVV |1N0S9 U 0S0PTP 000'''T'Pl%\m%|' G-pPE@P ?P1N0St `+F@aT @aFpaRN `㜠@0S0S 0S0S$`@Y 0 X 000 .Pl%k%jE'A-@P"P PT0Q 0S @rlP@ pP@ ZP@3r|06 R0S@@d`Q 0p) 0 0 Skټt'Pl%`m%O-PTdTt,M @P Y< U0!0S05 @nT pTU P300SU00S00 ,Ѝ 0R(P ),P t0S 0SD3 P#Zp `X*00SM T0 @@0 00 00QCZR00 RjUX *Y ^  pP\2 R  Y RQU@ )260S' p @ Y00P'  P0`0V 00% 0V0S(0S0S 0S06 P 0Q p$@I0S 0S @rԀ0U0X0S 0 S0C0 zd0SY UX k) @0S 0S''ݼt'Pl%.p@-@)_``Q000 R 0S <1YDp L!q0S 0 00D1  S ?` 4s` V0P 4s0``0S`0S\00CS0X00S wp800P0V0S D'k%E'5rO|'@1A-Q40@Sz%P`q0SP00CS00 "% 0 t&0Cp 2#L.Q!%PlP000T0@0CS0800S 'EU`m%k%E'|'@- @ 000t'@-@ @0p@-`@0 0 p 0Qp\ PU%00p' A- 0pTb0AU RAЍR R =RU "0Bh 'Rf 0 BRa bbb(bPa@bLb`) 1PU ^ S \R0 R  p ` Q\1 0 0A Q "Q" .  Q1 01p0} 0$ S0." W p 0p: !0}RQ 0 0\ $ `0" X00{ Uy 0"  @PEs' 8AOKRk%U[A-@` tMTg 0SdPUHdfdHeHe exddTee$f,fXf`g`gffc0 000E000PS V 00CS0l00SG E  P0(` 0`00'@l%X'|'T 000@0A00CS0/00S/'@l%|'p@-PPP`@ P T @D|@p00C0C0p@l%X'p@-(P(`@0@Dw00C0p@l%X'( A00C 00 0C0/@l%X'-A-@P(MHp@`DpPVP u }T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@?0 P RpS T4O-` 0l000S p@-XP@T T D0T@p8040@p 0 /4m%'R0@'k%'@-0@?'p@-d@dP^\Pp[ P 00008  P8 E Jp@Fk%4m%فA-DR0@T @ B 0S 0 @ 0r8 0 00CS0!0`)V*V V v va A ~` 0F S؜,,,,,`l V@0000 @\V. |V ;V&P @0 ;P @0 @0 Ppx&P@0 @0o|P@0 @0@0@0p P  00P000K 0 4m%k%x'|'X G-pc0@0 T T+P,0S)㰀" jPP @ @@`P  0R'P `FFa@@T 0 4m%Q p@-`0$P P g 0R$, (@R   RP3Pf    Q 1 00000S@p 0 BRp@ Q080@ p4m%j@-y0 0004m%@-@oPp@-+ @fP P @0 000p` P @`@`4m% O-С`P0 $ @CPp/0 CR00SY%3PB%V 0 H100SD (100S @ 0YP@0@Y PX u@PW W! V! f000 @(pGWoVP0V      0004m%DQ O-PKM 0 5@00 04 P00~400D$0\`P v 0S o9 40  |4 \t$0000 `SH4 ` ,4$ ($00CS0c 0Sf@pW 0䃟RPp *p0PC0pC0 Sڈ#sV@0  0 0C0Ps00090 000CS0030S0@2 0 2 0 02 P B1 2R z0u`B0PUZKߍ20S nd2h@d2d0p@00 0S V 0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PC@0000 9@!00CS0 0000DP3+ #.$@@*pb0PC2P \00,0-,M00CS0`fR {00^4m%t'Hl%'k%@l%X'|'0O-鸯帿pM0ϟ  Q"/O/0 0202280 `00P/20S0S 2Y HбDشȶ/Q00S: P.Q00S1 0P0C0p0000PbP.00CS0)<.0p210SxPpNTP"Pg KPEpE U0@#S?ꄫ\H@x8Ԭ0TLp6p P}00@ S0P@ A0@S7P@a0@SdWP@Y_ P H'P 0p@W`00@S"UwWX'PGNp0000Pgw<0 0CS00C0~00P00C0l0P@700@S0P@*u Y p0P0C0t0E&`0@?o? @2;R0S 6\P\Pp ?PPpppWppUpW 6;E S8 5:0 S0 U0C *0?0%3?P00q Q~  B  PA0U!*00%60%3?00q Q~  B  ?PA00q QPA~P•3U5*00%90%6?00q Q~  B  A0%3?00q Q~A• ?P B 00 r R P B ~ P  B u300%<0%9?00q Q~  B  A0%6?00q Q~A•  B 0%3?00 r R~   B  U?p00%?0%WUT@>P0 |P0 &PU000@$P 0Ѝ4m%k%W @l%U x'|')ERmH'D'Hl%$&T 'X'Hl%5R X'4R X V P0 ,  0@ 0 0 S0Q >W @<P >P" &P0000000p0p0((0 P -P 0(0  pO0ZP0  0{P BP 10 }0 01{W00E000C00R#PpIN}PP 1 " )00 0: =}P,p @R<2 3 wp BR *p* p|2  BR P=  Ť>= P2 Y%W :W5 #Wg}i 0P 0 j^"0G P wp BR pYpT3 0 @ R   B 0p3p喰P3?  BR 4p02!R1S $HQ x0H@ 00 X"0`0001BP11=tcP|4  wp BR pPP4HW I/o}W" R #p BR p P 0X0 'P02`5Qw0  0y0"0 `! $0  0G-`̠̀0@T@@0PU @ 0S 40 0  B/o"`f0p 0S 0 D U0 0 0[4m%W @-P0@-2aM0$ 0 z10< 010@0崼1|0000UPI@1| 1Q @@00I d 0S $Q. 4QG Q ,4  8000<  ,000 0 0 00 0 0 S00aߍ0  p0 `0 H0 D0 H00S0US,0u 0t'Pl%l'4m%W Hl%x'0y G-Vp0 004 P" 000-P6||L0$00pKs@P 0 R |0W` p    B0@0S 0 00}Wx P0, R_P}" 000@ 00 00 R, RP4  00300 0000    BR   00` P 0000 CR Sm 0 tP P`  ``s 0 0008 @0C 0 00`0 Sl妷P XC0 R   L000`0S.0 R Ӻ00 P 0 R000 0  P 0@S P 000 i`@`0P0|0` P/ 00000PU# T 0S F0@P0@00S0P0S0S 000@Ѝ0$00p4m%͡8m%Pl%A-Q@`Q` @ p0 P0 0X@p 0HP Q$@@`Q < W R    0 00 00 @ 0p0 `4 P /b`P l0 08 00C004`ЍRQ4m%k% A-P0 5P@. 000`+P p@``@@P 0`0 U000 uPPe``PP0S 4m%Pl%p@-@|PP ,0 @P P 00000Sp Cpp4m% P/0S/80 P/0S Q/0'A-@Pp`00p` P@-` CP 0@ pT@Ȭ PP  C Ѝ X@PBZWTQ N d PDA@m% 0P/'RQA-`Pp%CpWpPpW@ U B`0 R@CP P~0 0嫺B0 @m%A-`P@xpT@Q00C0U U .@P0 PB'p@-X@X`0P0000.00CS0p00Spp@@''|'p@-PX0@TpU@PU@TpPOBP'|0p@- PR @RP >B0 _P `3B/ 'p@m%p@-@tP0 S000C T  DBP 0SB,03O@dA T @0@p@@m%gfff'p@-`P0 Sڜ S  A@P t0 R@U Ap边0S 0 S A@갹0S 'H'@m%p@-P @0Pp @  0p'@0@-@ P  Q .@A0' 0 P/ R/'C-LsP0 U00000@0CMS񟗮Hp(` rA@P@2@V޹ tcA@P2 R@Ux20S Tq [A WA`<"<EA@P2V0S' `:Ap@! BpPBAP 1 噹 0: S/A00`l!x`\!l `V'jPP . 0( V U0S000  (P @Ӹ. 0@00CS000S ¸Ѝ@pT 0P. DZ@''@m%Pl% [ |'2Rp@-@P PP Up z. |娸@p`U z@p0U o`. pppO-P `ppW@p  0Ù`ȐȠȰ0S UT  O   0@  U  }T 0S@@ `U `m%QM0p"K<, Q  0]>p0T 4001", P X0 M IU00 DZT!-& \!-D'H'AS0SSxh R 00CS00 - T000 0i00 <10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ 'T'Pl%p'TPO-`@T.P P@(P ,#P0FpS`@ PCPBPP34 PP`tDa0S! 000S(U 00CS0 PT40S г00CS0 40S óP@U00P@`s䃟1 R 0PU TgO@`@VT @c儃Q0S 00S 3@@TP@P @卮PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X P̱̑@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR V'pVP 00CS0\00S Ҳ0U00 P :}O`m%''|' xw< \m%UA-@P P0` pUTA0S 00S Do0@0@000CS0 00S P'''|'p@-H@P02`S@20CSpV02p'40T0P?o20S 0S//'C-p@`1010r!Q0@S10C1 ЍqXPU X2ƼVPX&빼P 0S Ἴ''@ 0P/!!R /'p@-8P\2Sp@?<9\Bp'0-MM01`"R !R X"R   1 1d"1!d2S ,IPl1, ,}IP L!0,00tI@P$1, @T0dg;`0P, U @T 0S P۴00CS0 ! ^:>00 0$0(00D>S 00 9/;9"!031''t'' 0@-`"dy'p@-L@'P<0PPp0C/U00pR p@-T@TP0 0P0 %0 0000CS0p00Spp@W'Hm%|'A-@R`P  990PPEU`pp WD80S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S sDP`0000 0C0H''|'p@-@P@0SH00Spp@00CS00  Hm%0Hm%0Hm%@-@Pװ"%Ѝ-@-   Ѝ Ѝ/-@- 0  ЍЍ/Hm% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`-P$ 0S! lg0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' R Hm%0QHm%@-@@Hm%@-0rSگ0G-p0 P0R(0帐@0=00`=`\`F@VPpPER000 S=S B`` R`ĥ`PG3@Hl%X'@l%0@- 4@ 00C00 0 0<ЍX'90P P PR00/0@-HP@^ ^ R0L00T A-鸀(  R Z(p`@pW p0S 0QPU  0S 0S   3/P@P00t'0SfA-@PU p`pp0S'STP@DAM'᫠PP(  EBA\Y A-P0`Sp@    3/@PP@X #W p0@=S0U0 0 00CS00  0 00CS00 x 0 T z`m%WO-@00Sp 00P㼀✠Z  0>@PU* Ѝ`V Y   [ QʁoaP`0pX't',0@ R P=R/=R/A-`P0S=SPERPU@'@\0\p!0qV@pT 0S tPVpp@X't'@-1`0@S @  PPV 0 `i" Z h  `R Ѝ@["Dq   R <0 2/0`F" 0R , R  00 0000@!L@0P U U0 X00CS0`00S Ѝ@覭Y0#L 00P P ЍPl%c'X'|'-p0GM00`000EP  80  00 Gߍ0  0 gt'l'A-`p= P 刭@VPp EPfP0D @S= O 0V  @W`ЍA70Cv-GMP00 0DP00$0 0  Gߍt'p@-6X@P0`!@0U<V 0U`00 0p@X'mM!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    \$Ѝ\'p''Pl%@'p@-@`TP000T 00CS0p,00Spp@責@'|'s@-P@T@ bPP0 P00Ѝp@n` PP 0 @dV00000 00PЍp8S X'A-PpU`A0   0 @TP@ s0@00`t' @-@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =ϝ@@'C-pP@0聟rS``PW! 100S T! 0  ЍC^nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000  h@0 L @   W P 嬫t's@- P`@@P 0 Q   00 00CS000S dЍpQ     R T0000    0 '|'$Q A-`pĀ@TP0U0  * >0S R   0 02/0 00 0000X'0m%Pl%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X @V R@t'PP@-  VC-ܑp000P0`-S㴁@TQ 審@ 0@00`0CS0Uh10SQ ЍC蜪 Z@P=QP 0 @0 0  0 00 00000  0  RP 00 00=S Vt0T 10=S010C0 0P00 Ѝ'X'0m%Pl%|'  X'p@-@PTpu@p@-鶴P@`P \UNP@ xP@ IP@P(P0 P pV t'00@/ 0S0@/s@-@0 0P`0S 0"S U1r0!l%*0S`0T 000 @0C?o2R0SЍp$&@-M@ 63P ލ.3P@D 0RQH0PP0@-M@ 3P ލ 3P@D0 SPH0PP0@-M@ 2P ލ2P0RP 0RPA-@`3PI0 0SC P2UA 2PPPep2PJ! 0RA@- 0-RS# 0S0 00t#5 Ѝ0SX0 0P0S00 040,4P$S T T S 0@-0P!S@M0SPЍ0P{ 0SxPUo U U  Po U [2P? J2PPEUR,<L\| P  P  P  P  P  P  P P p0St00@!2T @10(S0)S0 0qop@-@`P(P} 0Sz00CSt 00004`foop^PXSP0`@,TV%@`!VT`@V@`@ P`@P`@V@)FcP0S0!SPpp(S0)S0S pp@-@PPPEߢP.U)00op=Pp0 \0!S0P p(S0)S0S 徧py7@- 0D\m%@-$0$0 00 㳧'\m%@- @4 R1P\ * 廧ЍO-@`@M!T0pD P-R lRC 5R -R| `@@P{2 000E @PppGWP EPW pGP〢倲PE0%S``PX噧pW ;sR R`6pTP`2刧PU W@1 000 PPP@U aDP@ 1 @p @P l5h;X@P *@@P0S0Sp@@p¦0 0 } `X0 R P!q *S0嫦 0R dS .pv   TTTs.o0$& 3' `m%Ui =58 0@-DMD0   0@@DPU#\.@0 3   /0P x, pp LdDЍ0=P '',-.m%a U[mMDp@-b00S 0| 0x 0p0p p@0   PU P@P0P H0H P p Ppx'x'''4m%'xm%`m%Hm%\m%dm%p@-@J0@[ 0 0@0PU@0004A d0 R 00CS0H00S ڥp@_@C0PC'0P Hͣ @0  ЍV@@T ԣ 0':G-p6P@UL@D£0P0`E (U0`@0'W'@- @R Q<< 40 $"P 嘣o:'7@-` 0PU 00  @T{ Ѝ0' s@-0PU 00 'R"R@@Ѝp@k @ᢛ`@Ѝp`@'0O-4iP0T0(9P @1,M01-%偔Px @0  00P@`V8 0S5 0S1LP T .p|80PEAU,ЍP@@\V $&(8P00CS00 d7 0$ %V0%S@700CS00 K7 0P`|寽0p*SA`p0.S0@*S7@pZ$â唽`p厽p@0xZ0WZ%Z A0Js R'X0J S4H/H/H/H/H/H/H/H/|4H234|4|4|4H/4H/H/H/H/H/4H/H/H/3H/4H/H/4S|40h3H/|4|4|4WЕXP gړ P Xc 0\\ s00vZ t 0 7W\\#LQ1 111111818181818181818181818181811b '\ \\ "\  \M \^0? \^0@-000fnrtvaet P0030  CA 1 01᫡똓\P `\ P  `  rP`  xs0 v0 t 0 $up B\0 0c 0 ct0  Z(l cv t0 < <"0P 00t a |j  v t  Jj 0Eet 0>^h0P $0'S"SS[T0S$ L rv t   0# 8긠0$0$ Y xt 0#v t   0t 0NVBT^0 <'`m%z>&=5$&D\%D'%儛0C- 0tqMP` dp P,@P 0 DpH,@PH 0p W ; PuY <YZP0P 0ES, PP P0ES^Y0?S0 -S00PH0,Ѝ \00S00H 8PH(6[ \  Efs@-0@0 0 \-XPX`Q xPc 0Ѝp@-00 - P[ O-Mp:㙑PAV0䁟䑟䡟00SЍ@P 0S =PP 'V00  cc[hP 00 Ta4i[D嶚P 00 ,寚P tc 0$0l[塚P 0 0o[ ᗚP 00 吚P Uc 0(0 `Q 0 S~P00CSH ?c0 0 0S\ 5y9[ y?5FL0K00M00P0D0 0C0D080;800,0/(#Q00,,#0,0/@0D 9K<@0(080$00= 0D00<00,0/+$@/0@-0$ 0d8 Ѝ@-@4y000@-@4q000@-@(0(S00 0(0,0Ѝ`t p@-@'PP# B381</@-GPD[`)U%\#`, 8&`&V0,0pg@-@4/8 0,0@-@4%8 0,0&,Q@-8 @,;( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8 @0<<@00,0@-$  (P T ЍtS@-'PTnt \@-'PTot fp@-0MP`0@-S00(00P0 0  P9*P 0( RT  0 0 S40(P03/Ѝp|;\ oA-@`PpQP-U@Q,P00  PP 0-U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Pp] ^ t_ x` p@-$@P0S +00PpL'Q+  0 BR@- N+ M| 0- BSs^0@Q ^ 40 ? 0 C  / /.T'L'p@-hP@`V P~+ps`HV4v+,s+n+0L'' C-MPp` @ T `U+V@P + @< 0$    0 S @     T    t h@9  Xv Lr@ @n 4j (f  b ^ Z0 SSO K G@>: 6$A 1|@  < S S  SP  L6 CVyP   $W        @u̅0ST  ϸl͸s* n*X@ |h*@W hb*t @ Lx@l 4`(TL@ 44,@   T4 @KV ` X@H~x<z 4hv `$r Pn Dj<<f0b(^Z3U@V LHD @>|<@l 0@4TY v)Vt,<*8 $"H@V S  W  2VxApr`VЍ00 d) @V   Q  (0넑0l  @( T☷l▷@ po %-5=HPW_flsy_g[ $,4<>OX^emrzGPXOWf @- )}&x &@-,0, P 0 0 t)m&\'>x &s@-@`Ú000 #S@KPḚ0S  0%Q00S 0 QЍp&0S/#Sp@-@,P$p+0P 00p\'>垕@-PRP@ p`p 0R" Ѝw0"S0SO 00SS  00@O$&@-T庒PL0 p@Q0"SPЍxp'@-T埒PL0 p@60"SPЍp'p@-d@P0S 0S 0SS 888 U   S$Ppp'$p@-Px@Q dkPP L0   P    pp@ @` p'0@-@PPM 0SLxD00Ѝ000 0?P0 0  '#O-Pp`PM 0S<T;$ , P 0S ߍPꃯ0Q 0S 4@s?0P P@ P@0 ST WpU: 0S  H 09/PV` 0`p'9OUp@-[0S S S8 4 Ѝ~S$ ЍMu0/7@-lP$ R\O;@ H$0S p (O O Ѝ0p'h' p@-@P 0Sp@0PS 0P0V00SpA@-ۘPD@D D`DpD0S$00' c DKx &C-P`PM 0Sx00(p/p0 @P" @/Q `0p0@0P T0p &PH$0@@ 00Ѝ 'p'YG-@0X T?' HRD2D1<#<6'( 4 2', (.'0 *'8 &'4 "'#4R! '!4S '!4S  '!4S h'!4S L&p!P0S t0&T!T0S \&p(HP8W zЍGċ0S. a`v`  0& 0 &0US !S|  !3 \&0US:3 0U #,  & 0t&pPv &` q0BB X "g (O-Qx ,@QdP0QL 4QP8uPQ$o80S,00 80<0S#<0P;^PP;WP1 QB"8M`㠱8X0apS wpR  < <0RT5P)0< S4,P0S9`(囒Q (唒Q @P0S0 BS `a 0ph R  R* P*da (Z,;L_qp'JO-;$M p*bP 0$S V ߍS P@T[D@hP 늤40 婫X ZS$ "$0f0Qf/ j,2!S!R !SS0̡1,21S 1P P P@0 0ꈡ|1P#>00 P,2 S, P 0 <p`#>00?s0 R* 0S 0pOj8 P 0S 0 pA1Sw j  @$1S j/ f/ j∕01P P%DT h'p'7^VEW}}.WEV0<' &A-P@p,P` %R 0R000005Sw D $0f0Q $L  p'h':'p@-0@rP  P$p@\_$0@-0S ,Pp'@-P  'O-@:P,kCM M00 8P( 8tP008H80p0SP :ᬇP  @00 0Y x P 1(p X峂 p@ ܐP$4 X p: 0 $0-P$0S  R$02P  P pGGqr岐P,圙圩$ pW 0S$00t f P$00 _ P$00$0 V P$00   @倐P pWa 0SY] 0 0$0P @; 8$ 1\ t$ 'YP( $0S  S;Ƒ8@0;RZ(( FP  %<P 3 P0 0$0P$0S ++RP0 0  | P 0 0$0oP$0T0 < P 0 0$0^P$0`0  P 0 0$0MP$0X0  P 0 0$0<P$0\0 |ӏP lΏP 0 0$0%P$0d0 (式P  50$0P$07 媏 P  l50$0P$07 {噏 P  (50$0P$07r jd刏 P  40$0P$07a Y$w P 0 0$0P$0x0P Hf P 0 0$0P$0|0? 780aJx0S0S  |P0X: `X0 H0I0@0t 0 ST 7 7 2Z/ \d0S 1 #0Գ000S05 0  3000"0$0 0 0 $0eP @$0!S D@0$0|2$ 2 ,z@pCލ Ѝ0S 0岅  QP0 ZP0!A"A圅0S 0崡0S 0Cs RS񟗚 j_ j__j_ j__j____ j H߮0S0 0S Pz  0$S o 0 S Pe  0$S~ { 0STss 0 Sk PI i 0$Sb ֍>^ p'kA#t(d on',''*;tKYfju'd $&6 s@-`0PU V  P;@P hЍp`PD! 00廀0@3V\d eM$00S k@-ܒ00m%p@-@5S4 0PSP p@@Pp0S 5S 1S "I|Pp5S T \Pp< HPp>(( Pp Ip''_edArdAs@- 1 AP(000(`;a5 S4 5S Pu0S q0S005S  Pt p0pPn"5S ЍpH DlP8 WEVp'fdmdm%0o'gd@-@P f/8@' 0 Im%d'md0S/!  -3@-Py T P 0S S@@ ῔P@Ѝ0@ Ѝ/ &p@-4@4PQ8p@`  @m%KR@-t@t0MQh  `P0cS CS SS 4sS00ۍ0h(tq0@-MM@` PP 00YSP ,ۍЍ0mP 0 x<' &@-@M0 vP $ۍzp@-@$P 0p@ W &<'<'T@-YMM@p p\YލЍ<0< S <fCPژ10YS<0<0HrdA3@-*0gj zgzz'z'&z'z{zgzzz { Ѝ5J7@-P0@ 0$S0S> 0S6 TQ+BQQ+ QK10S+ 8@0 ؊ 000!C0ASLt,t,t,tt,t,t,t`t,txt,t,t,t,t,t|stc0As Rxt Ѝ0zg{{' Q{ zg{{{ { { @h(^m@-\@\0MQP  HP 0nS yS0 $00ۍh(U.P `00CS`0p S00 P0S X0X /X &G-P 0p`09@P GzpGlT@Y @ 0@C~HWPp Ep〠 0  aӽ U H`V `` XЍ& r &O-@M MhP`ቬX%XTuTT0S0#!pD P @P P'p0 p( P  nTt`(p P  SP `Z^P<08 Tt`( p P  SP 0(0Ss`, p P  SP 0,0xSXs`0 p P  SP 4000$Sr`8 }p P  rSP 080Rr`4 fp P  [SP li040xRDr`< Op~ P  DSP R0<0 Rq`$8pg P  -SP ;04Qq`$!pP P  SP $04xQ`$ p: P  SP 804(Qp`P p# P  RP 0P0P|p`T P  RP 0T0ۍ Ѝ<' &df V@S o* /Np;[~O-M@ M0 (p PT `V:0S0`S5P`P8apEbWWnF `F`0E8ġ0 0S0A"S0#1` lop P( AP♉P@#" 44d 8P0S  3/ PA BP ,ࠐ异Rx%.A 5p P" 4SA4`S>854`P92a0C" 20< S :A$("YA x5|%.A  pY P0 x5< A B0qpAA 0Q<0PADx[0x5< 0RA| TP 0 000S P0`p尀(V R s S 0 0)0`PXލ Ѝ(m%df 3Vf Jf(<' &h(@ - BR0 R A-P@4 R1!, 0'0 "X0 X0 pݺX0 \׺ ( H, <0 08 $4 < $$$$P T 塺0p 1R0S*0X`p\PQ Vl区A裀Pg X(;DTcu-O-pᔀ 2MSR R@`aW 8QT ,[Q 00   n0@" h 8 ,   Y`@0@" R 0 0c !R21` Z 0S 0Cs RmSj꠆Ć  1 0 02|018QK \ (<0P+8唇Q* 8 0A0 @2<0P+8zQ *ЍOƹ0 0 020 020p d8 T ЍOsЍPg 0LY22DA-@Pp(D<匹`8SA 0`_o0/p/0p@-  R( R((,,004488<<DDPPT@TXPl XRl@PUt @ 0T0p  Q CQCQ}C'@-@t40Pt08Vf/uWEV0H @-P \PY Q@1WEV'80@-0@S K08f/M4' 0\ P0//@-L0 D<<塸8@8P(` R 0x &Hn%P7@-@ PT)P0 08P8 0p0 xA Ѝ0Np(vd0@?o2P0S@- p`P@P P P P@V@lPH@T@T [p0 4;A@@ Ѝ腡}p(ud0@-PM xdP@` ;p DA 0 400+ +Ѝ0p(zd@ s@-@ p @0  p0 j0`P   a0   Z0  hS0  PL0  8EЍpp(td@BOf~=0>( p@-@PM`P p  ( V V dPЍp (wH( p 0@ 0p(}d(@l~d(~0@-PM @ vP 8g@4P 0p0 b@Ѝ0p({dЀC-`0@Pp!匁匑,M00 cp0SP@TTA  Wp  08@eP qP p` $0Q 00S*E@P @QVW ?V 0cw R00tP 0S,Ѝ00* *  q`@T!-&p(|dԊ0*;@-P$M /@P p p? (G`F@ @p  0Q` 4 ;$9qp 0`p L,g P \ {>p(wdxd sIx &6g &gA-PM @uP D  uP $>"  0`0PS 0"S U1r0%*V  0p0S  0"Rsp^>PdPd `尀pup0 8U>0Ѝ3Mgp(ydC-p`@P Q 1>ՂP 03/ ЍC@@ R; 3p >Hn%p( 0@- >p(P7@- XP@T墂P D坂P804 p Ѝ0.Up(wdP7@- 64P@, pV Ѝ0p(d@@-=(0   x &O-p0$M@QP`H0 00000X$Ѝ t p= JP p 0 S 0T@0SxtZV XMW 0  @DX c zp@-@PP1P' 0P, 8>0P  G=0P 0P 0Pp@9p@ 0x@dp@,DU@@KPptcidyararbmngnts38 0D S/ 3C5C$1 4! 8<0/x(0@-4A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @x( 213/P/(A-PT0p(,`@@<,0T@@DA??@x(?0@-0@0 (20,200P!P30x(> 0R//G-`0(,Bp  P E@PPW ,20CS(20CS G0x(p@-@`42SM%^  E 82<"@ 0(2,"Ѝp@<"82E@d`,"(20@X"\4Ѝp@x(o%(O]g^s@-P`၅  0SЍp00S@p0"S1Ds@-$MC@Kw00  0 00x &A-`P 0p @Tʬ; /, s0d  ? }qp  RЍA< L`9 0S`@D@,! Ѝo%)?x(A-0ppP@`ph:!14P S H d" R S R 0 W \Ux(zp@-4@P0SW( ᖃ0B1px(O-PTM0$ (00#,0x0@08030匠s0<080S8 (2,3`K(0,4 0u~40$04 ?k~$0 0d~$0  00 [~$0bd";P :$000 "q͟ 0 RL0 $R0 S p2000#1-R0" 4LL`P@0`zx0P00S zP  zP  zP% L`ᓟ0L00 S> $v0g2< p%mE%KUL1;K?C$\"00}P@\2S@0x0@XRx0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (0 0,00 0h! @$PTЍ P @x(o%( &WA$&$# --s@-@(00CS0 +?P` Pp pp:0 P00CS0?0 Y@oЍp@Ѝ/ &QWO-a0 p9Pp/B$@0eO 0N{qp Ѝ  R ЍOa t`| 0S 0 5{qp `BPE,\ H 0S o%Wx(p@-|@P2S 0h`n/(2D!1!1U &"U 80U p@@PC @@Tpx(((G-b@p,+PP 9 P UsW剔LI J$ j,ແU0U 1U01 ;I0s@s \ X"pG' '"q!'|"",q!#34#sO8#@<#$(,0#$1!#(#80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ ox(O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y P,8Y 200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$zh00C0@@PAy`d1S  14P8 <   00P2S. Y  a14a8a<0#d1a#h#0)S b Z0)S [ R0 R Q !xP500 0e0< ;   0S8$x(fHh to0~o%!C'YEAIiUA-l4RUP@P@^Ѝp(0PPPB1P@$a$aTS  ЍA   1 1 0p  1 1!1<0  1 1 ?0 1!1<0d  1P  1@?0ЍA x(Fw0K[j{O--4M`@0P,0 q 0Sၴ0o_d\,P("/op" R 4 0  0  ( g 0U䢑 Zz @ pD H L( @` 0t0x0| 0XS T0@`t˟( PX=0 @`8 21S /0.30010204458<0 TTQ6 R:HL"T 1"R. n4Ѝ0(R0o_dP(0|D 0 P(u 0 P(l xVt  @D H L(@`0`XB(@ Yw  0 pt0x0|9pW2SjX 0h !? 09 ܂,i  R    0$  $  0 0@P`T 0 W0S `8p@W 0`S$0 @0u 000 V 0S<8Xr\" 0QwSR p 00 RW0`@0 0 `p@,0S| 0 007P2S XU9 @`@ |w 0@ ` R$'0Q0[002 @`S`Q $ 0 ^A$ D 0 H L@   @`021S  "/0.0010T0 320445 8<0 T @` @`2S 0 00P52S X?U @ `@ 0S3 :2S H"%>0 $00 0S, 1S) % X000P$  00SX0!14!8!<!14!8!<X $`LLD(`0 S( 21S$ / .0$40 81 <X S  PX 32 $45(, X\ 00$0p@`\3"Rr2S/ d20 00 P 00 00" PXT (00D#$0 #(#< 0'4 0'80'< p0 0pr0 @2S` BT0`lGPX 0 1<A 00@@',2`0C 00@@m(2? 00@@0`Fa ??`1`<A` 0@@,2`0C 00`@@(200@@@? `Fa?`?``0S 2S@ @TJ041S 0Sg 0s XPX2 0 RS  0dPTo_P(Lx(Fw J0(X ^S+}G-DBp42gS0屗P(r(b42SR  0P7U42S 0S 嘗PqЁ 42RSf P:剗42S]1!$1(1,ЍG$ 0Sd S ` d04兤Y2S  t` ` 0PP"PR S0SЍG=S@ D0ЍGSP 0Ѝx(QM(MSZ3o@-0@M0@ pp`Ptpߍ\ y0  0AP \ fyt02S 0S " `P D!SR ⌵0PWx(0@-Xa0 0LAP d2S8 P(!p! 2SP0U0 $pt" Rp\EU$p0 00P d2SP P@r Ѝ0P0!!1 o%x(md(<s(^A-@T2 @P5uP 0uP +uP@ `p@T 00S p`V@uPD00S @@ u@P5?(4o%A-Pp`!@l!i!000 0@@@A-@pT` kkPP!0@ Q@F!@uG-M d4 P@TPD tP @ 0tP(4 00(0 4QT(0 ,0@!4@ 0# 0@,0S @@((@`@,0s0000CP倃01P>PP0 !01P,30  ,3Q #  Mc0HT0< Tp@8 PA ,0S ,< 00S< 00@ $;[Pe&0FSʆ`!P0S -S@= jP00@@PD,0S ,^A0 OP t8800  0 R00S' 410XAXQXa400C0 lC.x0S0Sx0S0S C 0S C CC$0#4 ܍p PS P@?(0_h y8U; KQ8o%  0/@(0/@(0/@(-@-$@   x &G-P`pjx@0S Q 0S X|H U BT=Y0S 0S x@ -@(2-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @kPPݍ Ѝl!rp@P=0LLD@rOQP,0: S0RP00 0$PP 5P81: S  S U r$PPj)g)P%PPPU riPP @P@(B' @(8V@-`90P  0 00$Ѝ  sD(0@-4S 3/ @(@-mw0 @(Z 0$vaw@\o @(@-[w@^vvQw@@-p PL`@@0 7/P0 S Ѝ v^00|E(O- MM06@  @  @ 0p$000 (0)P(DD@ ܍Ѝp 03/0P0   P6 @$0PS (0SDUIP(`P 0 W xU euX0YpY 0 `  W p[ 0S P%5 ke@ u UT \ 0Y@W0SU 000 !00S# 0S,aQ2h00CS0"0@ T 00CS0!0 P @YT Y@DOoB 0Q   @OoB\ 0 @0  0 0 SNTE( & &U. 0@-M 03s0c00@S oPP* R!PP<A 00@  } 0PS vP5 `Ѝ0S i0S c0S\0S\  0/@ \0Sp 0@0 @vp 0S0SƐ w@g0S廐  @"  @0St婐 @D HP@ @0 @ `!0xP|"%#   T`    P @@``a M] x Zp h 0 @`E(E(E(6<$4Wm:QG-0@  0P 0S< 0  Q*E  $PP>   0`P hJ JpЍ!URQ 4& l |r0 pH00W0p $P  0Q0  1!0 1!$0 0 0( 1 0, X0`P\  P@ 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0p@k00 QP   q 0P /:P xy):pP1S1S1US1S 3S3S3US3S,  pP0p* p2 02 121300p0j00 QP  =   0Pp00S1<01@040  0j40  QP   0PA0O A0  9P 4A С 0R  8 eYKIGX`V P0EWm 06#++R`DX4 $0S,0,  RT0C:mD0"P#10P 0 # 0QL \0  0P 0PdPd@p!;Wy RRaArrAaU-Qt@-p@`P P00 P0!j 00QP  Ѝ O0P< !@ !0 P0j 00QP 4 0Ppy@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  V ,P000j@zG-X` p@PB Ѝ0PZ%V0 0iVU D1 1X0 X0 PO-@,M0p@l@$0`P PprP$P  @,Ѝ Ep0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0x!Sp sppP0 S 0 Q q     L 2Q0 2 q "  @ "  p@*"*  P0@ S  2"!"0  0@pH50P s s// /PTNjO-`@PpMP0S Ѝ X  H r0A D00 s/ r qh \7P0p@P q x0 ` !P 0 00 P 0 00 `  P s0 `P pP0 0 P`8P [ /L`R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0* zO- p`0P\PPX $P  qQ0 0\Q@T(2 R@0 P" R S C0BTX t0D s  $ 0 TX  R 0 0 p p+P YP  L BPTR2 Q PEE    * O-X`0pM@PP`Ѝ n0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/QP *n  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"0# 0f0 QP M P2!G-@P`p,P0S 00S <0s+@qa$0S  0S 0S,0 ( 0  `0S/P  S`pl S HDpP@ q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hPP0P Wp0RQ@0F!{!! {NT!@-?`XP\@#@3P@T@TpW @@T`LF(O-`@@M18 00TP0S<0T D0S Ѝ1@ 00 `P0DS%0 ᕈ0 0eQP P0 Y:0 0 0eQP PLC 0 P<0T 0BE(!!O-M@L0Sp<`@DH S:P PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:"i"5""E( A-@/pp0%B?[`0S T_0ES PC elp@@0T?  C0E(0 PKn %/E(O-pcMW , 0 [P0 S~@0Pp(0@@D0 0$04@HD0' R$ X0`1#b3<0#000< 0,00d<00 QP cߍ0P@4p(0@pD0 0$0``0 K2#  , PV002800aL0`F08 0L0SD00S   80< 2800,000d<00 QP (1 0H 0  RR R0(10D40L0 `0L0C >d \HP.  (10(11  , B 4 0B0 D0P D0[140S  QI@(1  0I0@;+ +j P(10(10@4 40 0S\ 0@ F /o@0(0"s R$ 00, P 0k0p(0@0$S@0! 0C@0 0@ 㓢#X0X 0 PP :X R: U$0p 00pP01So p U'0 pPf(@\Q UpW$ P   pPK/\j g0x!P0p00pq P$ b QQ#hQh  0 U P p$pu00000 ,p$@Pp0S*0  Q .b A0 b @ @ bρ LG?@@0Cs PQ*W r0L 1r|1 8 <|10W01u0U`0 0\}xQ1PP|!R \$P PPL0sPP|!B0I|1@|Qx1U0P U* SR   1S \\TP@ 0 00000I1@ hifPP 1|!RI PP 1@b3s00 0Qs (0R U$0p 00pPy, uX000U\`0( 0$ (\T P000 0T 0P0 00 , P@W $0[f1Sc I`1 S0(0YRhfP0S 0Sl \olNR P0R*02S 0S0RV 0\2SU\P|!.xQP VPPy 00I@ s < |1P 2@<P PPPPPPL0Is0PP@1@S!U @[SheP=PU p|1WS  P@ |qppL0Ispp@P !SP d,PP 0 1|10|1#40L0s_?00010PP- K/\CiPP05VP 5P0h00h0Ld 0ES:\P P|!d1HrH"HP :0 @0|12PPpA8 ,80P'I0 [P0 S0 U$0 P 0r00 0000 0, @ D00S< 0,00a<00 QP80,R0 PI Pd01S\:0!XBP %4QIP0%8%\0 P@mE(!!"""o "zF(" #6#S# $H, %$k###"##R$$$$%'%$G- p@r W pP\aPP Pp $PK/ hD08QP0Q:" 0PS00  Q pYxPh`P 80"8 R 00 05 !$xE(A%e%%%&%^&1&p@-@5%SQ%  5%QPR 5UUomQQp  0Q   0Q0  E(A-lP`5p@ @ 0% Ņz@ŕ\E(O-POMpLP* b5S 5唢@TE  cP@ ET XT 5d 50 ! S$5"R$%P0SOߍdP  RR @`0d B2" 0>` JQP d sd0P Eh0K/0h0 g0 @!,qr0d  01(Gg  j f  f,10,1#40L0sK?000/1001001#40>000310 00 000T0 C_(%,5QP Hd d0P b&E(&&J(&l&& &@-@ P o0 5E(0/J(0/J(0/J(-@-$@  u  x &G-P`pg@0S  0S X| #U TY0S b0Sg@ IJ(2-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @PPݍ Ѝl!rop@P=0LLD@rOP,0: S0RP00 0-PP P81: S  S U r@PPP%PPPU r PP @PJ(B' J(8V@-(0P  0 00$Ѝ  zsN(0@-4S 3/ xJ(@-f0 @( 0$bff@o J(@-f@NUfRff@G-`MMP@p`(PR0 `: SW/`i0P  rR f00A 0C @H#&.@ V& 0S UP0P帐`0PPJ0: S,^0"5@PTP&P xaP  PP @u3M`@ S @ Sa@PPZ jPPn UD e-H@+S R U<PXp%t!0# PU00`P00D! $@P2  Pf0S,`X PP0 xPP YW80% ܍ЍPnNPUz fFUv 5TrU .&& F&F F@0/p/p@-P@G $( $(0XRX0X00\00`0ddhhllppttpp@-@ P GGGDDG@@GHHGLLPPTTXX\~`\`0p Qp` 4dP0@ S p@-0@"!Rc0p@-@PmGjGgGdGpA-0@PJ04S->CUG->C?XDG9>:>C?G?n:>CF:G 0? AC>1G}C>G,GmF(GEnF$GE~G GX J.X R  $$((,S>,G}S>GFmFFHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqxF1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R, K2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P \`" :pJ"0S1 T L000 0(t HP( $0000S  y0  0X.P 3 p\tK.Px#0 0!0K 0 . @p x 0 0S 9r  P1 !.P Ѐᰢ L000T0 H d n 0P0X0x2 0J0  000r00S 2j0 0H 0Hh [ Z0# 030C  4 S 0040NP!lxt1 0U 0U0  kN000C0 0 S 8   0 0001   !p'0000 0 F!0vs  0 00S &*j'O($R('pO(Do%a'PR(''Pr D1 M080 01(P   0S  03/ RލЍ0 1TP  0 0t ?:#b 0PU p0Y 0 P$R(O(PP(U0p81 R0p8@00P0S 0SpP0Sp00S 't 0S 0T0S(p@,*O(*lP($R(z-*O(2**@-p@`MWP 1  P  Kp`V' &q 00S0H0S 0 0 $,00Stt, S(00Ѝ@LS&P0S 00`Ѝ*j&58 O(+O($R(xP(xQ(++TR(R(4P(U h+P(0P($R(O((R(O-3P@ 0lMpL0`#\P  ? 娢 ? |&0 Q2倲0S0 S 0d"S 3S LF@X Q420pg2P0Sr \`X00X010S, Q&00X0S  0 0 %*l!00ST06 0,!S0\P 0_PLL0 20 00 04$04L3 2$ @  *90'0S ^P X P& PlЍSv  qp@\t=`dO(\R(TR(R(4P(U +$R(xP(xQ(O(P(0P(O-Ph20Pp0@L"`V  00  Y0 Ѝ0k Ϡ?R g4G@ WULQ TUWV A0 %00100 @ L @TPTpE@TP T  @T  P T 0 00V02 0 %` 0 K0 K[@P 0 000\000 m%0`0S00000 O($R(+O-Pܣ4MX3Xp0 ~aPp0 g3G0 GA3B3w T 3(IP 4Ѝh`+a43 0p R [A 4000?02@20000HT C^9 @ @TpT0x6@TpT 0 0 0 @T p & T 00  04G000XC_ 1 0a(P 10010SY 뉑  4000?0失 0  J0  JY@">  10@(Ps 00 p4000?000S* A0 0000 0 @0S$p0Ym0 `00P v$ 0 00000 a$hR$R(O(++@-P G@%,x &s@-@P `⩿0S 0S 0 Ѝp,O-|EM` MP0S 0S L~p P 0Sލ Ѝ000S  iP J0S 0S 0S $0S\ 0S|z 0ShM0ST0S 0S4 0(d sS80!"70  0 " "t 0D@?!? 00? 0I 0Id!! 0I0 lpP0SS "04 0 R0  0"?  0,0S)(04,0AŸ80/R%78 <0PP0R [0" |0S lhbPUt X@0S HDb@PUn M,0SP@PPDP~H0S  `ɽCn* l6xl$|0S lnl0p00S0P0$ 0,0UA:000S 0S P H1 H0S 0S,0S _P  %P   000( P 0S# $P PP PO(,,,,,"-@-c----- .%.G...../}./W(8/B'  X/O-H0PSp`M W0R0: P p`0"M,"0 S G20SQ $kЍ@ 0Աԡ 0 000CSY?00 1> R. P!\!0  S P  P (  . 80< 0 @80< `P0' P 0 $#0 S@ `00 R 0SQ Q\ 0:9S(J0O(d0R(O(=7y0O(\ RP 10H0J00A#FPa`ppPU0 \:85 @5D0LT 0 b32 R p'@ `글|$\5S0c%0# pD ? 0 ID40S<40W SW ,4,t`V0`@0x@S yd0, D 0 0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A  Ϡ5  0S  u0S\000 T@T`V T0?  @`@T` 1 0X20qA000P0P0$G !H0 00 pS ;*00p0 VTX0 @ QX`` @W0`3V5 R01<`7: R 0@ 0  00   0^0 TR 1VS0` &0P   W@*  A 04H 00\R(O(TR({O(O( R(R(R(4P($R(Q(q2x &O(O(U @P(222S(2O-` @ 0Mp̰̐ 0 0  BRЍ ;PP U QP ` {{@ pQ RP Q @p(S(O(=70/O-dMX G0PpP0P1P 0L1L H1 0,0SdЍ0S @d0,`C0 `00@ట 0D RpT0 :u`P 0RA0 S0T TX0S @PSpt0pO(O(Q((S(3x &$R(4P( 0000@/00S/p/4P(00S/0/4P( 00S/*4P(O-@M`PV`@@M :0S 0P *S *`0080< 010S y0 CP0 X P )X P|9`0S 0S H)E8 P00 9 #R0p0,0S010005(0 01?10< 000800$p 0P @pfy a 0#cD0 @0C0S F100S 0y  CP 0sI0 S$ 0S '00P|7}`{ 20,0S0100404<'0 01?1$'p0pp00ppP*0S  KPc 0 1.`[?PW @p` xp. .80< 0 80< 0@0C0Ɵ .0 00 0Q.*0S  P  0" RWލЍ0S 80< 080t5 0< S `c0 00$001 X.`P 0S 80< 0804 0< S tc`0 00$`S!  Br p 4.x ⴑ..P@280< 0 80< D00C080P<.\SP$ .P $PPP3P`080<9h3 Q0 *300rP2 0 0r$X!p0AS񟗴ꄝ,xxP0SS 3 00c20S40000?P t2 >#R0؀2 00 #R0tQ& l20S`20ST؀ 0 -P  : S000 -0 0 #R0 Q   0tFQF?d!d  @10 S& Lb#R0 š!ɡ0S  0R ؠP1  000p0P``0P00C0X?P8b  $R(,R(O((R(, 36!  R1Z 10SI0T!  0 S<1`0 ? <00 20!谟00S0H0S 0 04040c/0 $ 80QT $0 0$0404 L3 2   ^[0{ {<0 pPpAO(\R(TR(R(4P(U 6P(0P(R(O(O(00S/0/4P(O-plMX @2唒唢00,0SlЍ0S @d0,PX<0 @@Ph000P㸀$@1 0 0D RpT0;:<`1 AQ \`X00X00@SS0زp\t`d`V %P 10S  0 c@P5P 00S  0 0S  Q\ {{00õ O0Q  000 P  H 08HO(Q(6x &@P($R(O(67O((-797A7O-oMM@PX00 ?0|2X?0SX0S $5S40SX(PYX0S $XmX S R잟f>`0Vd2 P\20+! `" d" B?00!X d"B1h21$\Pl2\Ο\0C00p21`t2QB1l2>V 2l20CL0=SLq Q\20B  0S 0 ,$54> *'>>0S 20 0`S0 $5B111`R B- 100 S  $|Ќ0S%  0帀- 00$%BR0Ө`S<B11@%L0PP X ZT PN 0S  <P| *堀N'p<d<0S 0 00\0 bA?L0D<5A?X0 =<0T0.H0>; 0VHRQX0h0@ @0>8 84<ϠQ b${ S W,0 Sa?^ @PC (;0S @ A>+@B@  CP:"  @0\ 0 0009tJ*&h:\:0S G0 0؍ߍ0<00<`/  `!.0|i0S pd, : 0 HH #00 4y+1#\Q  0 Xi ?蘟 a>0pS90n Sn 80S 0)S 3S 0S d0 080S 8 0S@8`0`480`N (8D8/˃2#\%R  `  0 ?d h pB2 `b7"<68+?P囓)<D TP 0RT%ͱ7DpP0W`C ?Q `,00C[qS  S +1#\Q  0将h ?O0$S 6!0S dP#509U ^9R ,20,2(  2`Sh2/0^>0^00/\,$5St2 ` 0h pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0P3 !D0 R  "0 0000 0 0P1  "#b2*# 2,20S x%0 0T20S _H NP 2p"S\?"0STT< =P VVP2 H r#0"bST 2"TS\?< b#i0 0<30S 2@#S?d?0`#S\L P  !P 0#S\ 2#Sd2/?L c2#90 0 ppS $S00 S0`@$Sd2?/0?`$0S0\0000p`X 2R`嵟\ 0V $S`0?0$ 2Sh2/0^>00p`Y7 0%S0\000S7呫!"TpW`l嵏X7 0%S 0\000S7呫!pWO-P`@DDT(p  W @899A-Q0 % C@*r`! 10" q0SU 1`0aQ0  a*z"1t10S H0 0T 0@# 03A0S4 W@ 5*< 5R"000S  0 0x@uTP2UA-t0Tp Pd0 0S L P<0 0S O(O(o%:P(0P(4P(4:9:S>h p@u0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//$R(O-x4MP U dDddtd`@qvL:8D80ŏ 0 P\kP SЍ ?10 Pz P\PP0S 30S30S tWl3l#0Sd `#SX{ P L0S @;0bS  s*0S @"\5S 2 2\5\5" 0C?o"20Qh [řT24 ᕁ(Ud $2 ?^1:010S?, A!(Ÿ0#\ P  0B ? 0Sf0S c0āh 0S W|!\5St1\5P l10S(` XA! L!0 0@! 0 *[ 0S +0 0 00PsS@hPİPPHT* 0R A TP(p 8R(P(R(;:R(O(:dP(:LP(::4P(-;O(8  R(T$R(D;R(`R(O(^;0P(XP(\P(R(;;; 9O- 0*MM08xPpPP6Ԭ 80S  :P6 p0: S X ]PލЍ48H0,hSO 0)00S 00 78 7 $9   ` 8 8 [V``Z`P`L7VD 17P Q ၾP 嗤xH8P0 0H86 R>0 0p 0<&0&0P7p0p(60pw>0 H0p(p2S# )51P )01P ).pVPZ `Y 4[ 0SY?관X V.+04  0 ,0\:PV, 춝 Q3C ?/rPPe 2Sl3% 8 S20#"20#20PC 2SB4$040404X02P&V20A2T02@2 0%00C`0 `Fb0 0l G/H  ?`0PtT#0`P\`Q=S/0P 5` ( 2RV0 S0S0c 5*< 5`3 30S .0 0`20S 0"#0 0R V 10S `2R\\0SDz2= C ,0"00 00t 2A(07# l0`0S10S!0 R=S0S lC $0007 p 0L%000P%X30,3q * 10S T0 0R(DP(;HP(<dP(8S(!<1<P(pO(`R(J<zC<4R(8R(o< <<<<=F=m=T=->=K>=h>>=>T>>O(>;?,??M??+?3@@@PP(x@O(A=AfAA6`P(:BO(R(zB@P(BO(PR(LR(DR(HR(TR(XR(B0S sPq 5*N> 0:#: 5"(1g 10S 0 000S(OP0q0*1G 10S }0 00<cQ/,pP 0r<0*(2' 20S ]0 0倂0 RL%r0L%r0H00q" T 000cH00SP<Pr*220S ~+0$# 0 00L40q"  400cL00SPs*330S V0# 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*Sd4\40S !0$ 0 04t R,5S0%45S R! t004e0SP*#$5h50S 0X% 0 00刅(0S xQ$ U0S< x 0(%0S8Pȅ*5;50S q0 & 0 08%<5HSR$ ' H00850<S_TP*6 60S C0& 0 0܆@%D5LSR$  L00@50DS6%P<*L7D70S g0' 0 0 7 70S ,帇 0R" 0Rz7 0SQ `@ΨPLX p 1@ Tʰ8 @/  @!. A@O@@ᬨP 5  0,@e$)P0 ( 8  Q DI ϠR 5l)p) x)F)p@WP)pp [ 9 z1 P, P'Qڨ0Q, C 0 0S sPz*:, :0S b0H* 0 00S N0S0QQ 0 0S APz*::0S 00+ 0 0P M0Sh M0S M0SQ^  "Q  M0S&! M0SQL<Qk M0Svq M0S0 M0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*6<{<0S 0 - 0 08=0S 4=L=0SHm*T=\L=0S 0Mh =j P%L5s0SB A-000=0L50P5?T5V>X50$E- 0 0B0T ӣ1`R.B!!@tN00 00L 00*> >0S @0. 0 06P0 @DT@8 HLd Lc B 0b03"4@ `P Z( \?0S  G8 H4L0d @ B b"30D?0S  ,0p00Px6@ ἦ\6PPE ^0D& 5000460S 1S  @+P  6 6 @Q -U @ 0`P @@  04 8 E5P l50S pVlP 0 0  `` 0  0 0 4 8 P 씟 <0S_oP`0 4?s0 S +0Sc^Pd0 4?s0S `p0SfDMPg 04?s0V:PP/PQ 0Sd2Pe000 4000 Py c0ScPd0 0 0ipK0S 00 0 0 00  K0S 0 0 00p0  0K0S 0  0000 W0  0lxK0S ``v0`#40  A0  0`q`K0S 0@00.0  0 1 1Q1Q,+ 0S A 5< 0!00|!0x!0(pCSq #0p R0 !80Bs00WP ļP0S 0@PT0 Ql \  E/ !0!X< H!UR(@R(O(# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT FO(2FR(4P(0 \P/Q/ Lœ0|   ,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> YS*Z3`30S '0P 0U`dSTS圞Ps喞PUU00Q A'P 0S ??@#wuP`"hR0"00S8 lr003Pb0S* xO0S* 0R0E>0*X4 2p610S l0 00S F\P10S E 1TQ `1*X1` H10S ?0 0H10S <E (1P 0*0`00S p0t 000S d0P`} 0Zw 0吱G荱,R(R(O(Y(3HO(~@R(P(0P(G-`pM0/10SPP@z1@61001000/0 0  0    0P@4P@ 00 ?U05:00 0000P00S KЍ00 ?0pp%&` ! Xd00 0a'%v 0S    $R(H 19 Q0  1 Q 1 8  50Ss > 1) 0 0 0 00P 0Q. 00! 10 p40SO |e>0Q 00 0p00`P 0 R=  _ğ^ 0P QPx1Q 1 M 000|)>Yr `yPm x3 ,Ѝ8oPXjPD3P0QSu? y ٓ`33 $`Q0B$0 @$0h cPX$(0\ $0R. 000V0K+ɔ H2 Q$``! @$0.P$`S00@ ı0 0B!2"30 $0V' 1 1S2> 410S t=$ 0R00 00?000P+ 0(P0$00 00{ $0 0{000 0 R  000`@`00S '>O(s:n:>R()IO(+LI+lIII'I4P(^FF^IO('s:n:>R(O(@R(I(DJO(JyJ0 @0SpP pO(^FO(Jp0JJR/G-P `$ 0p@V` 0@`` V`@&!D( `G-@P4S `pY00qzuPt t 0 0! ##P @?Ѝ_ uP :^F: F^p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  0@`Spp `J 0 U 0 0n7Π ^ÌVQ 0V>  0P" G`p P b72 R0V1Q0V"0   P 0 P$ ` U P ``ЍJr 2 K0A-1àQ`P |0| ||0@Sp࠱ P$` p@QL ࠁ PQ Jr e Kp@-@PaSl0l ll0C800S   0U0080P4 PR*Sp0 2Kr  KHK ,0S/`0@-0@  L;,30,0080S 0  Y0@#Y(_KHK s K,0@-S ,0, ,,G@TP @ xKs KO--\MPpU`@8 U0!@3 @#81S41@D2s2@Ds1@DS@D5@D0  0 00P] U0#03?\[[UX~ `0P$0<5Q 4BO0$0 =D 0XR @"!L0<p(08p$0 0H(0 0 `,0`4  0 4$HP $0 PT40  (00 0LP,05S00SUSP3S` 4 $ `UQV  0 00`F<040 C@004`300DHpL`<0@ RS80 0 ,H0PpT`_@P,Ph3Q 0Q+ 0CQ 0SP THpPL`P@ 5T@P" P0ՏT`@V !#P` T@!00P0 p0,03(0?D00T P rHL PT0RP H9t`0, S24040S@p( D0: 0 P  X Z 1!< (H >`y400 0Q 80080p0?(00T` 0RZ@p (0 0 P 80S0 0C800S   0发`O@  D e$@$\Ѝ0$0Y(KLBAWKK0s |KK5LAs NBAW|LILTs 2Kfs  [LG-0,0S0 P@`00qW40S*IЍ!  0P@P   l@PpyKxs $ KA-`0@c,0Sl0l llTPpQ L0< H 0P@DT@yKs > KL? C-`0(Pc,0S0 (p@uQ |0l x@PEU  0P !  0 P P ЍyKs O KLQ X0sC-Ђ0@ P@` 0 00 08P 0&ЍpY(R(LX0sC-Ђ0@ P@` 0 00 0P 0ЍpY(R(LA-0PQ |@`p0P R   T0! @P 8Y4P㛧+dP(Y(MY(hMHMp0@-,@P,0S ;00Y(@-,P ,\  D ЍY(p@-P@^h0h 0 SX0d0R 3?p@006.4 Q#3SRpp$R(4P(O(27@-0S S+,Ü2 R0 ELi `Q |x3PC4aQ* Q( PD&P <4B 5*< 50d30a3 220S _ 0 00@ @7.Bp#x3 Ŝ ' 0P `XA 5*< 50d3\81,10S * @0 d3S, CQ,aQ$ 0AS#~P 0@a3d3*.0st00S  D0@ S Ѝ04O(Y(O(Mp0MMP(0P(4P(Y(M N!N @- op O-0p M##$0H@` (0,0(4 0S SpPs0SP-$ 00# qp*,#:lU tU bU8Ip`P*,_ F P@0( 0% 0 0S 00040(` 0,#!R P P0V ~ЍVp F$px$P` dj$ piP$ `P0V:P0V  $ZP$ pJ0S 00a$$0!D P  X 0 S 0 00$ 0S [(0,  $ 8~.p S 0 S 0 00$ 0S [(0,  $ 8Z ps 0   l 0 Pc 0 ! P0p :N&o%GNfNNNN.ONG-p@P` 0P V  00 000G 00`000O-0` mM$0P@t004080 0 p40S+ mߍbP AP LP `84cP iP0p8* 4@0 0H4: S@ @0(0D04,0008`0!P  P 0 0! xHTd âp 0Q= $ 0! $∑匱@P 0V$0 0/S<<`V $*pPpy<w0"<15P0<0 `P< \v Hrp< 0 0 n?C0 n?< n/0P < <=!$7 0#$0@0P!SH `V|s 0S `0S  R$ R Z m0$H 8 HPp`G0$pR 0$ pK ppBZ (,PQ(,PQ S R `T}O&o%Ozd@OOOOP $O7PPfPPO-P-@p`,M,$P ̏p($0S0$020S'$p P V 00 0P0Nd 0 "fP AP PP \^pP$}p,Ѝ`P 0`P , ?o  0 0 00 `! p 0P@qp p Up`P&PQo%*QUpJQURRRRSS*SG-`p@MPf@P R@TC^t# E@0$4$ 0840 ;2p+p )m”px H4$$: S! R B.T tpD $4S8 (4,$0.B.  dp 0 0"dR04<,$$4(4$t0K>Ѐ 0 }  E  00`d$t؀E0  i P0`P 084S   0p 0Mp 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY"ZSoSUT{Sd@SSd@SSST,T@-@P 4B BRP ˜p 8O4  YЍ@YЍd@bTT@-@Pp P P#4PS 4 TTUA- @P0TP p` X` p0 p3UIU$$ QEAS 0Ŷ r0"(Ѹ0 / 0T 02 /$4 0T1 / $4 0T1 /O-`P@p M6` P̀PP `000004따 V:Ѝ 1 00 0P0#`P1 0 0P UPX aU0kUx &UaC$$0A@-! P@- x`R@dfЍpP ^P 4Y R 0 \!-UUUO-P_o!R0`@tMR(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 P m0 $8  P P  P UA-@pP`P 5/p 4 5/p 4 UC-(00pS4P Ѝ$d@ 0 C   0d` 05 0  0 `WP UV9VO-0 0Pπp@ጀ儠T Ѝ` Y P `V DHp 0 㬀@\!-w mVA-P@$`$p0 @Tw VO-Pp$M `@Ȁ뼰0     Q  x0 p `p X0 X p`00P0  $Ѝ0w Hx VO-PQ@04p 00` ЍP P0S* E l`P0       04 p p#p p04pp  VVVV0s@-SX`@ P`0 ?o2R0S  Ѝp\!-U@- iR sR aR p` 9iWp@-P@P (`HPp Jp\!-1Wp@-@T 40`PPBpp\!-LWiR@-- 0 aR bR LR( .sR% tR@P 0 P0S`00p`(j0 pW\!-^Wp@-@ M\P`P0 0͵0,ŝ0S ⿝ {Ѝp0WG-Q@PM Q  ЍA~␀ p$`P phB~0 00 ` 0PP WWWWO-$M@`H P 0`$ЍPP 0 0 0 $0Y!<#P0*x Q P0 0?Y S0SXP pY0 P pE04 PU 0pop $ pP 000 00 piP ᓃ4   \ $  0V,S( 0 `$4 80p{ $Ĕ{%!#,[PP { T P R*L0Sg 0p^ L004 0 000 0PL 4$$   $ 0$$?=p6 WX1XOXiXXX00S 0@-@C^M E$匜E$$0Z 0*P*Ѝ0 @tq !r"`#XT 80 , @dP8a&p%YYYZZ/ZMZaZ.tZZ0$ 8O-`LM P4   1堡報D0!Յp  0S# x! Rh!LЍfR lRG  F 0pS  > P @P  6o 参@ 3PЀ % 偂T * 0 @  T @  @ P@ pZ\!-Z&t~$p% &LWZA-p`(P@P0 p!`P @00 0$0@-@P$0S 1@.O-[[[H[O-4MFX0T$00\, % 0   0 004! 0  0$ $0 04!$0,0tWH 0Sg     R ^ < R  W 00S(000( `S$0 0 $0V0DV0A$00$` T0 0 A dQ! 0( @ 00 0000, 0p4ЍT0 0 (0 0!0( 0 `0 0`V00V(00ppO-M<pP 8EJ@`UU>@`0S@ ` 00 0 0@ 0 0000SpR `Ѝ 0 X XZ Z0 0  0@Z  `0 00 @S`@@ `000Sp @`   @ ` 0@T` T'U@ ` Q  R0P UpP0 0S 00 0 0 RU Q T0Px _ P0 @  T 00S0p@ `f[\8\Y\[s\\\P/0S//P/0P/A-P`P P@ pRQ  P`X R T@-@,MP@p`WP8C,Ѝ $ p`ⳘP [W@- X@+P HHH0H巙@@~8@8P8`@YT㤖X ]]w]x &]lx 'R R R @-@R R/////Q^ Rp@-0@P! R!ꐍ$$$$$`$h Rꈍ$$px$$$$$$$ pp B R"Sh 1@\ \<T0 L ppppppppx p^Y(u^O- 0`T@PP Ѝ0!S R ~0Pp0(P\4S 0<0$$#0P8 S ~ R RP304S ڠ0"S1@ ϗ0 b  403/p 8 H0 0($P  P 0$ 0 0S (0, Pp^WEV^^x p^Y(^O-0P`p,M$0  ፁp@20S$`}P 0 0!  pT AT fT h2@,ЍsT00$Kp0 0 00@!8qp 4 `0 0p04S 0Q41!0  R? 2R502F. Yp p 0oo`@ B!np@ R@ 0R R 0St0S0  00` 0` 8 H00 pppW$00(p,0`_&_8p%Xy x ._X8c_p^$Z(G_ xA-@ĔQP MP  An``llph`phP L&Ѝp ( 0 4W___G-@P:p% U4 d! A~Ⱀ尀 p $$ 0 P ! `" $`p  H00`$B~ 0 W_`G-P-@"MHp ЍG20SIP`2P|,( $ $R  4S  Ѝ4SP 4S]P  0] 0"VU R z $ RQPF 4S4 P:P 0H  0pP( ,!?o  0g0 00 p|p E 0"pJP   U0p 4S 4S  0 Pp%&%`<`o``Q*QU20SK@0SD00;@ DP 0SD0SA \^<40$ 400#qpp, 804<0^P$ 0I,0  RP bU@qU PH04 8pPTЍ0$$ `VlY0Y `0 XW0 0 0S" [ P;0W0 000$0 0(000qpp 0 QP Р 0Z-p , E'p p  $ Oa&p Vp%aYazaO-@PDMCnp F#d m~pL50S <+DЍqP sP 80bp#  0*qp PPp0#F0$$q`P P  0@l(0P0  0 <0 0$0P P 4  0 (0$0,0  4 PSw 4,  (WUXdgP 0T 1"H0 0 S :0 U 00[ 0 40P40 (, [0V [(Q,UX? U0U0Xd?P p (V,#X02 0>p8 0  U  0 08P\ Q QXXx!!  p4\ P 4 "$p0 0S 004  $ 0$ R40H Lp $01S0S p0`v0&h$ r/0$0s?`ph7 4$$  b&p% b"b^bTrbbbp bc.clcPcccC-P0 @p`$M!!ᜑ P |p*0S00 P 0SP0SM \^H 0T' 10S#!Q` _.NP. a@ P P \ddddddddTtpT T  ,$ЍP`c&p%'p@-P M(@,`6#"X0P0 0͵0,ْ0S Ӓ ㏒Ѝp0d@-WM M`pf@T 4G0S @^< P尒 0$$ 0$$0 xd0 _xP x x卒x 0Ml兒m0 $8P}L{#< Wލ Ѝ1dId`dY.tdee f,dP `00CS`0p S00 P0S X0X /X⠓ &@-MP@a qPxȦئp@X`h`Ѝ@9`5 000 010 0!pp%Ѝt!`h 80TPL0 0 $ 0 P 0  @TR Q2P  Ѝ@ $m0 8 00  T ppxՑ1S1SDPЍ@ȑpdQ.dwdddddddfd0 ddd%QdG-PMM`" 嬑" 娑D2㬂@r夒TݍЍ  ᒑ ᎑ % #`Vj L儑  .  `0";0 B6BP [e0S8 1B"BZB WU $ !P0#{P%$ !0#X? m0 $8k4503#$ b@B& 0B    0S 0CS 080   0aaa11b? dSeee<.e"et(edZ(See0Wee,dG-0p P`@M!ဂ P pzpd20S$ePD@6 lP`Pa@ P,T4<duP xP  @ЍPP #pJPPP0S00) P 0S0S \^ 0 Q  m i0p帠W X T Q K   p ;-f&7fp% dSeee>afA-HM@Pp4  ` 1 0S0耟D0 yp T$  P 00S0 TR lRxiHЍTpT8Fpp ~ff&`'p%0 Q /0@-$M` 0 0@P!!dq [yp$0S00X P 0SC0S@ \^; 0T 00S!  0*a@ P ꔱıܱTt0pT ,T   R$Ѝf& q%'000000000   S /-0,M$00 0 00 00 00 00 0 00000000 ێ,Ѝ$gC-` M @ P   000sS 0lSp` P$0㓆( p lp P 0㓗) p ЍpW`Vp C-`PkHk.QkVk N}kkkk  eG% &O--@P`؊zM rup :0S ЍO, 0FS iS:C>`C$TSP YL ЍEP@P Y7P9P_0P0 K]P000$$dXPR6]P p2]P (0XPL R 80 CP $0   Q4 EEP 4Pa0P 4 cPq pP00000W000000S 000$0\P X\0P(0 fPP <<<S`P S$epPP0 8 4 EP 4`P `P @ =CPn H 7CPh @0 SD00H0 RL0$ 0`` 0qp<  R$4 "#qp 0`~ ń$4P `$$庄$4P`Vl\`P h\P -a|&l^\P kUlgjjjjjjjkk kmeG%l+mImhm0@-@M P  H 0 0S`p< <S 4ip$K0Ѝ0蠁 m'im@-SM@P, x0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`pT PD Sߍi@mim!im@-@  > 0Ѝ10S/p@-!MPM@P% PA. (01GP A!HAQP8 0`0?oS c`2 06P. 0I0:0 0A. 00P0P A A"0 000̥ލЍp`0 0A. 00PH0P A4 4A@v`Z(8`(0mmmn2nms@-6PP cP \ 0`@TЍpP  00SQV   y@ꮁ P800 Ѝup@-8M@ P[>P 1 ! WP \0 Q0s0S00!\PP  X@5MDp g  \< PW`MV8Ѝpn ȁ noi0@-@BM M  ?p 0S 7  /  0(|P(@0S700$0/ 0h (mdP(@0S Bލ Ѝ0ᛅ@ᓅ@ioNoco0@-MPAW@P [P Vl0l l1[ 0 0S ,pЍ0osoՁ nio@-@M   pЍi@-M @=PC0 x p  1Q0r R0s04 1p`Ѝo oiis@-`Pp@ @@P=P0 J@Ph六&[ P@ L|@WP 4 skЍpp op+pJnEp7@- P@8pT T\LV P@00 <<0400V@ Ѝ0誂 \n]pgpoJn7@- P@p\ \50H(@eV P40 00XV@ Ѝ0蹂 \nqnRngpop@-M`LVP0P0Ѝp[P@Uxh@Pd0 D&p<8 P@ PP jxqpppip@-$MpVPf00$ЍZ`zh@Pp 0 XpL彬P@ P`@ p$㷬juppip@-B  Ѝ0p0@-M00 0  Pp `5h@P㇬ ` @pp P0 `pR00bS 㭃pj㛁U 㥃Pxi q#qIqs@-@`)PP  ,p Pm0vbqp@-` MP@zUP ?Z Ѝp P*    Y  PU@JDuvi 0@-,M@ P;P0 A p,Ѝ0 0R0s0S 0 $0YPP  (U@JDrq Ȃ foup@-P(p@`@@UPH0H HHYQ P īipgp҂ op@-T @r;P?00Ѝ  p  acxq܂ @-pq@-M T@P;PD0D DD08 0 p$@cЍ8  oiq@-M T@/;PD0D DD08 0_ p$cЍH;  oiq0-M $00I P  KЍip@-@0|T P$0$ $$oT@]pgp oJn00@ P/a CRWC/A CR=C/@-00@- M@ Y0( 0 p  Ѝip@-PM `@@⪔m{G 8 8 mЍ$$; ?0qq@-J@aSPP תmpPL``P00 00t0@`Vm`` PT0d0X @ @@@@oI03/` qq%0qq rx &r////0 L0L0/q%0 T0T0/q%0 \0\0/q%0 D0D0/q%0 d00d0/q%p@-@pP 00p00D S 0A0CS0$P>P 0@pq%@-p0Z( 0`P/ R/q%0 O-4M@@!2T0.  DP|pďů 0$ (`pVD@PT P p1cehT6l PP@ &p 00JP`p R  P Q R/6 0TS $ P\(P  1/P s{@0S  |p "SR(0S`嵩\ 2/P W0 [ < ~Z()tɚ;|7tO-MMPp  X p`%㍩ pP$ 100$0 ⬞- W |p)a Jt }|p Q Xڀ 㖀8 p$0Q ʀ$_ X@T #X00@0 0R|P局@S 0 0  ,0@4@;|p 0d0Pl0q 0X 40,@,|pDg 4<劀 g0H0S $P31{H0S=I0S:Z`@T 0 3/@: " &렒M0S:00 % p"pM0S  J@@ B8@03/@r J☙I0J/{pNI 1R㦨a`"%J` 1 0 d1 T|p 1 d\!1 H`@#%Jr!1 @ t1 x!|1  P@Tf 03/@ 03/ݍЍ mMt[ttit~iu utq%iuiuuvZ( vuuuizAtS? #v,v6vAvYvdvO-@PpP  p T P@PPT!P0`P \PPU D1O0S 4FF}W P.Z  P' ^9P! K0S 0 L0S 0M0S 0 N0SO0`S PPV ~ bq( nv|Z(\ &@-,MP@qpP PP`(  p0S h㋧ H6P00< <0 $q,Ѝ@ny<`(8i(y yy@-P@ᶔ0 P]yG-@PPP0 `@ Y㔀NUpAUᆚPP  *pp H H@@@5e@y: 2y<`(eas@-@{[P@P00ЍpUP UR@P <` *Peu 4z<`(s@-@Q1P@P|0| |$TPT)@P T` Pdu( iЍpJ{: y<`(A-@"PPP0 `@TTPPp ᶔp< >FJN@: y<`(?z@-@ \R6PP0P PPL 0 S@@00 >00ЍGz y<`(px &Qz0@-M@OPOP OPpOP d0P P P P 4PEp GЍ0J{4zy<`(7izs@-@塓h} ǓP L}HPH`ԓ P! ,}Ѝp}@z zG-M`@PK ZppP"(  D  ߖ yp% (6( px" <@T t8Pb}l2P\[} UR T Ѝ0 P?b@På $@xp 3}t 0R *}k)| |` `p}tQp R%P\} |mKP;ЍGcQ\ 0Q    1 0P|P0 RSᶒ || # |0` R P U 0pD` P\\\@n m8i(izž zz yz  t0  {{zPp@-P`@MP V  N`P C`C 00pMTpCA-@T 00`PpOT0 p `@@-MPP}00Ѝ`0 00p0@ 0 P R0Pe 0 p 0 `P0G-@(PQ00`(   P1r0Pp*0X!U0"R0 4"010"SЍF0P% 0 , [p 0 @0@-@P FC@ O-`@pP,(0V0S 8`P$P$P 40S 04S 0S(0p(`8P0S$0(PGbO-M00 X$000Ѝ 0Q`?  0Q> 00 3PP; Xc቗pP ,,pa<,4@[T /R@P00 DJ0800X5Tj (c\( R R[^E"00aUx 000 Po0"CQj BQf Qb?5^ Xp<_PPV  Ჰ$pP z(QaXD 0  Bp= 0STz 1PP]0!i8!10#R0 0k8ZYaP Z@  0YPH@T 0CS 0 0r xC0X0^ :T 0CS wR0xL  @0aD\W@DAD\ 7@Dt@S 2s0@0t@0@Dt@ T130P@ aTl p LPA< DA0 0 0`0ui { {+pEpA-X Pp@`SPg00;0P^ 0 p 0 `P0O-P`$M@ HpX8 P W0  rPp` 0p0  0rV pWP ,q=0rH0S L*r q~%rjr`0Q r q8i(iiZ() i8iii U&-F$&~59EiQ_i0@-@PqA>;qjO-PMM@ 480L004 T4P4'S$0P0@ 0 0 @PE( 0RtP 0S0'U 0ʘ9 0909 09帰0|90x90t99q(@!!0 P i0 /C BRZ      -B 9$ B2"! 0P PE ^r PE0x800IppcppCppPpp Spp@BppA`\8 0PP08` p!0(X@"0(0(0S@ p0$ 0B'S$0؍Ѝ 0 0'S   BS>C0C''S Q:ǟ"!! CR   ##9C0C<"!% \'S>C4'>C2"" N=C0C Q 0*S ;S. RU 0C'S񟗥34 43344444444434444444444444443333333444S..d-l/d-d-d-/2S# St 0S R SG %SB 0R  t t0=p0( 0 B( @U0S 0S| `pp)pllllpW>o 0R 0p`00S  p0S `p000 p4H3ट娀XP0  @ op` o0S Z0t$S ZU0S T .Ho0S 0o o`p W1qv `pJ, zX3,003c1s0Sao ,, o3pGT#Pt# Pl# hßh Pd# Do<H$#S0S 0{o0S:  to5Sno0S- hor䒟h `0V V"    0ToV.No0S ,HoCo` pX1p 0J,0Y20, `&#Sq ,g,  o1H!P! P|! x Pt! T oLI  .plhd`\XTPLHD@P4iI3 d ǁ̄`(Z( $5€:Ɓ́}$?0Ձ܁ P"P) PV}5:S aǀ̀׀%,@p@-P M@` TQP0 aPp@@N Ѝpi@-< @]&P$0$ $% Ѝ蠂 $ }@-< @G&P$0$ $ Ѝ 0 }0@-MP "Mi@PۍЍ0@N P+ UhP@rNۍЍ0@gh0S0S1iSꩂÂ0@-M TPp@@VNЍ01 剖@i҂@-T @2&P@0@ @@I \p rЍ( < A}@-T @&PM<0< <  >pTЍC5  F }, 0 /z%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  UU ЍЍ/@-@U7i룃 0S/@-`(-@-  UU ЍЍ/-@-  UU ЍЍ/@-\00S 0  0000 0 pЍ`(@-@gHpgjgp0hp@ كp@-pMPP2 P0S 0@P 0 0 00 0Xp DlP@@ ((@,P0P4P8PSl00!031 0@-Mt 0@P \ɔ pPLPP @ (@@ 0P 020Ѝ0z%r`( @-@0P ,l  lix &=8P@-d0 !X|!T@0 6p0\ (0000/P e z Ph0h@-` |!TD0 6p0\ ,00 00/P e z P-4s00#q^0<\ 0000/P e z P 4qs00#\,s0Q00/00P e z PL- 0:# ^4 0Q$0000/P e z PL- 09# ^4 0Q$0000/P e z P 4 <# \,4Q00/00P e z P@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$00P e z @- 0 00 iP Ѝ\?z%A-P⬋p`@WЍ P 3MP@ p7@-P@U0  ( aQ Ѝ0osA-0@nS0oSp@ paP``NLPDQ0nS0oSRPPRPP'@-0 ZkShyx &O-MM`<(0p@-@C0P@'@-@ G0S 00S0?  ЍCp@-@PᾤP (0/Sp')p@#)Yn@-[ gd뛍x &O-p0000@P`ᜐ (,唰00 Op0@DTq oP0 P}P<}9 O4&T!-\!-nj @-M@A>0 0D@00 l0`p)0S SH "N 00,00 偎cэp@-@P6P (w0/Sp(p@(Yn@- fc뛍x &O-p0000@P`ᜐ (,唰00 cOp0@DTq oP0 P}P<8 }9 O4&T!-\!-nj4 @-M@A>0 0D@00 l0q`p0S SH M 00,00 +c эp@-@PᮣP (0/Sp(p@(Yn@-   cx &2O-`0@P(,p娐娠娰0 Np00@DT oP0 |PP巍|  bA+Onj\!- &@-MM0An H 0P0 $@_p 勍brfp@-@P<P (}0/Sp'p@'Yn@- ebsx &O-P@M P0`r"hNp)20 R. +x   &  x `!p 0 *00)0`Vp!`pz %uPfPMP9 9P$ GP g@P ^`]`]`]`]] ^`]H^`]`]`]]x^]UP|0 0|00|0|00|00|00pt`x0 {P֌{~Py_p Z,0p0Y00t0V0;;0x0UDo_$00|00|000ЍY00t0\!-َ&<$ -MMJNP0 @P300 |0^p0 `匌0 0N/0 4 寁000 0@(carӌd 7@-@P  E0Lo SϜ 0 V Ѝ01@-@y?0P@>@-@@0P@'@-@ D0S 00S0?  *ЍCp@-@PP ($0/SpL&p@H&Yn@- '@-{40 0,0,0(0(0$00 05d.a듏yx &C7@-P @DP00S\ 0 ߋ Ѝ0(p@-@ PX0 0(p?PP(ϋP`p@Ia(gO-@H pH 8C444f Lp60pGWQq 2@FPd`d0c0c0c0c0c0c0c0c0c0c0c0c0cd0cde0c0c0c0cPe0c0cc0c0c0c h0c8h0cxhh0c0ch0c0c0c0c0c0c0c0cddd e0c0c,e0cle0c0cxe0c0ce,h`dPhlhhh0chh40S = 4 40S 4 0<007aE08:h$0000000D30@90;g)P04P 0I 0(80@008 0yPP0       +  @   ' B ,# R#  # R" , @ ( "  )            Ky20  xCy0$000 T9y0 000 0/y0$800  %y0<:00 y08:00 y0@900 y0,000 |x000000@y0909Rf01r`0$000 0 0tS0,0wL0 0xE00007000+040 E Ѝ{%h{%\!-&b(b(b(̟ b(^ JPYcmx~l{%A-RMMI>0PC@P@(0L AH`q刁( `L0V\p0KSh0  R < (Lh0$'_0 ߉( h0N/@  0PP ` p,P.`0TP -P T0:a0\ $00X 00@00\0|00x00t0 0p00l00d0"aRݍЍlb(Аӌl p@-@PNP (叉0/Sp#p@#Yn R R @-r/ʑ0@-@MP`p 0"[000 O\PPЍ0P0 0 0 \0 [0P |s@-`/P0@00 ZP0 ;OЍp0/s@-`P@00!  P0d RPPP @@ 0`0Ѝp@b(2 (002P0/@-@BMP' 41010 0000000 0P fWH< 8Q`_H00BߍBߍ@o꠆: G-0@`p8Pp3 pϿ| D0Dv4<40 8p0m,j<0(000pE040p<0< Dp PH00ЍpPPL PG _@b(kmF O-$M@0 1@`Pp0 @T V0<00$Ѝ 03/ Z0p @' 0P0:@ 0 `  p00P LH0@3/pP? 0P 0T@Pp 0  {?P P @0 ` 0  _꠆O 0/A-PMM`p/Br P@1L# 4ND0@@ 0@00 0@pnߍPڀ@T ߍA8HꥆDb(G-`[ 0M@-@0PP :0PP`!X  00d 0 EP  D!08 0pp00S0 W0S00S0 p pP  iP 00`0SP0uP_uD0D00W 0 000K``0Ѝ 000<0b(4laDb(--0M 00H0 @P (4 zg Ѝ䄒@- U_N\몒x &O-P@M$  0W0p 0@"b0"@0@ "Hp20a0CS g@P4vuuuuuLvdvvuuuvuw0p00@0wp І! 0 uPÆu yP Ҿ0S Q |㥆  d㞆Kz \!! 8yP ⰾ0S Q   -z ' p l+߼_Yp t 0[4S08pS @p @Ѝ?BT!-\!-& X .3^@-MMCN@800 0@(00 0Xp / 0 ]"]!](:0P( l],c90P , T]0L]ލЍ4](]s+7DTeu7@-@P >0Lo SϜ 0  Ѝ01@-@90P@>@-@:0P@'@-@ h>0S 00S0?  嵅ЍCp@-@PnP (寅0/Spp@Yn0/p/p@-P@k $( $(0XRX0X00\00`0ddhhllppttpp@-@ P '$!DD@@HHLLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@Pݰڰװ԰pA-0@PJ04S->CŰ->C?Xᴰ9>:>Cᯰ?n:>CF᪰ 0? AC>ᡰ}C>GᜰmFᘰEnFᔰE~GX J.X R  $$((,S>,p}S>GkmFgHHLLPPTTXX\\O-@  $$((,0,0 P0PQȡ\5 S L5sT 0K TTpXX\\``ddh~h`lzlpwptttxqx1[ hpeb`0 `$Q*\5 S p0S&P%@ PSزK 0CA0Q R,z2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P#‚ 0Px 0`0報 C cà00d0 PS C cQ0@D@ @00C030S300C00  0#0030 3#00020SNd 0@ `?50 ST0T00  B 0Pe SX00԰V,ڨ0d0? 0 0@ `5? 0{Ϡ!Ϡ<,2  0j! ?b00C000 \aS T10S   dϠ 0@ `Ì0 1+0! 20ZWV40A8 0 B0 080$ 0C $ @$  $ 40040 08 R R` /  1> ( \g(g(U rџx &p{%>p@-Pl`0@S     *@00Sp0?00Sp0?0pp{%g(t0p@-0`S[\@ L00S000000B0E0pLg(p{%O-MM┵p,@ p51n_R0`PCSyqD51lQ Q@ ?F 0SB/~F? 0?F4Pp؍ߍ B@DŒ@0L 0@?DKd04 0BP0 0 SE0KSyq441(QP@/0p22220B'oF0f? 0 040hl @@D@ 0L0@?DdK40 0@ `4 0@<0#p R0Cs000 2s00Pp`20S7w 2袟 0 000p0k  `  *Z XZ0 ``a , 2\0Q0@/,040<090(08? $0KP `@.  0@őD L 00 /4;0tPP 0d0@ 0o} 01r 0`W Op`| 0 /\0X0`0d09{0?{{{{(,0 ` 0@Dő L0 0/4;$0 /PO 0l dh 0@ `Ì0 1p{%b(\g(A|%~% 80pW:,0 0  0 Qb(g(g(@g(Tg(P@P`P @4K P@  4ApO 3E4p@ d3T@  <SPp * <P tC(0S0,5 Sx0<0(5002 0,%S0022Q04S] 0QSUxx" 0 04 0A XSG 040A 8S> 0 4QS5 00 Q*S, 00Q(S# 004 QS1 p00W/0G,\3Sr1\s岌XX\1X0SHS X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001[S p4sP 0d0 a 2! Q$ Tg(Lg(t{%x{%\g((g(ߠ 9d g(g(ʡ@g(ATu0g(\g(p{%#T,g(|{%g($g(8g( S,QdS18$Q<4R:tS  @0p\5?>C00#!3x000844$0<0t D0p@p0|00pXsL5P5 P4H   ?Ỿ8@`D ?ᴾ p?`nt00F,o! L ϧ !>   0%8$4<4RR#22 p84<00x 0 08SoPM @8P@0 ? @P0XPP* ?W@PP(5#R0:P@0$- 00Z00 1`%"0 ?001>0Z`0 c2# S,[ Q [3?001> !00   BB`Q0P`0/2#$ 0  ?V`1V`#T0`10F 0I ? B@TP 0ἐͽ됈  00B1  BZ1 ` Y"B !!0 R0C!I0B ?฽0 `᩽됈 0  B!ZӠ!` S1B0 S Q9u @P`x1[ F084<ĔCP`0S84<Ą-0$5BPS,`QɑRB@L0 0 0000x60S|0` ?HL404P@0 @6ᆡp;'!LLp00R  Q@yL7\5?>C00!#4t x0Zp70(1#T a2!, A3 31 0  @P0 04 `  0H$4  E$ ( B, @%LV.  R*h ,(b < 8( X @( \ H( ?.@Xd@+@B@A.@B,-8 He `岕 @40K `0 ,p B8d A YZQ !0 XZ R Ŷ{A/  <pW $?.t{ 4Ą ß Rï80\@$D04 0H4( 0ĀpL2 R 5#< 5023pr0S+V}됺 z'z'{z {' 000d0 CSQ c6Rc(+S`PP @ z犸 z'(Ȋ0 (08唉+S,tqP 0  R0:1P000\tP2#00@Q@0 0cp00 R00&$0 0Sb@ R:P QP0 뀠@t9 j0JF 0+lK 0`0S>0S pbL0S L>0S 0q L00|:x*,8bP>0ScN C>`>0S303040404 0#pCVW*DtV.4P\oV.GV0S  ?0 PS?\5=S,ϼ??^ E?շ0 0S 04 l dLĒH 0@ `Ì014 ,$0S0S 04 T d ,04 0OG 04JG)ݍЍSngG-`RM@Xr tPP 03tP`  `(P P7  CGp 0S +ߍ<08 H(00,0 000040!04 04$0D0(0P WP  `GpJ @Gp  4s0,` 0 1        Fp 0`?`a8SڙjPb 0  0**0P0e % 0* mGd@edAGzd@G<GGGGGA-PCMMPp`;8 Hip@P  P0AP@EU 0 2 "0 CލЍp@-@P0P (qs0/Sp p@ YnR/@G-P `$ 0pᛶ@V` 0㔶@`` V`@&!D( `G-@P4S `tpY00qzuPt t 0 0! ##P @?Ѝ_ uP :^F: F^p@-@P`    pp@-`P@ ((UX0 3?X0pA- P 0U$PP(4@b*^ :^0 *^*X@O-4MX0p0\00``P;0 0, , 0S% P 0 rmS;aSMSASB0C0b0C S||||X|||||tSSU0@0 0DT dS$ 09R "P T 0U8$UQUDT P 0 sS @ @ @U00@@@ X 00 l P R`$\o h2 XSQ 0@H0坳$~ 0 R (cR 5-0$0刳0ᐩ (0僳0UC (0 , P(0,   @R 0 0h $d0F]0༟0 0 60 6O< 0(,(@2200UD ,0 00 Pg@ X% 0$|儌0@d0c<@LP.BA 0T00<0Lh5$L0S0c, h<$$<PU jP W  ^0L VR0400 & \`#  @ \ 110B0F0D0$APpepeC0CP!P`\` :@a*P0  `p 0 0d00,0\0000<402802$0 0Cs0<000C(00SE,Z`j p0S04#*&D:C7@ @< E) 0 ( "*E 6 !0H 0 09PpD IH&坶0SIp9 R050Fn0S ,0S fPI@ 00S40  (0Sm0C$0pXp<01 0`@Y80R\(0 x0S6 0Sڐ0S00 0  C02#`(0EL8LP pp APPXP 0R SHR SP`@pb Spv0 0Y 0:Y:V3006弗  04(01 00 JT  060 D7&0ص$(6Y:0TSL0S d0 P VX60S_pW}@0S H刪5L R d0 P# 0PDT%_oRU+XE&0#H6 C 0 ᓔ)6  5c0 씟 ဵ6U0CT 00C0CSX: Bkp5Y1 21[0!!!0 Sq`$ ᓢ"!< 0d0$&S: 060& 0h0.3DxG{ 0W4#000848 0fDpXl0SMf`F`VI 30SA UDW D3PU CL0S \0:`0 [} PP1 P# zp37?6|0X0000o?096 30JPp`DDl0}` Cp` zʹ27?X0000C?f &! 02/!"6 QP *dh"P P 0 |0姴PPP$"u v'`Pw!k 'P  6!b!PU:< U*!:0U:7*0 .*0 xp*L0S\^U@!%8%E*0QQ:BS! T0  6Psk(k(ϥk(k("Oy%%ަk(k(%QSNH(l(k(`8l(xk(ק3k(T %d &ht@ & 0ATҨ8d vЩ%%A%s  r(k(k(d  0P0 Sp %p%* 向  0p1Pm 0 !GP `U&`060U/0 x xƳL0S `0  P1#'$/%\17>lgX0|000->090& 2|0P ᙳ :0 `p 2& 0x@0Df?o2U+Du³&0#༳6` c|2HA H0 HD>GߍWAG-`RM@Xr PkPP 0kP`  `P P7  >p 0S "ߍ<08 H(00,0 000040!04 04$0D0(0P WP  `=pJ @=p  4j0` 0   t      =p 0`?`a8SgaPb 0  0**0P0\  0* mGd@edAGzd@G<GGGGGA-PCMMPp`;8 `p@P  P0AP<U 0 2 "0 CލЍ@-`pѳ  V@Pɳ00S0?0\$ 0S 0 %jS\F\GL \ gL|0 SDKT ЍE%KUJ%FZO%A_0 !,@-bP L%BDDP<@i/0:p  @\0@ SL00⵩  9P  w 0 @姩a l`PP#h#9p  O;P 4[H0aS 1L\ : SRQt9   O[@P@0j V@r@DOoB@b } :[P pY00S  ᛬PL $ pᐬP 3m`PUb@0D 0 t0 0$=@0D QP  D0@ 80S}0x S 10S10S00S11011|0 0180SK0 RS00 R0 R0S= /P; 0@S 00 T^ X0Si 1Sf 1Sc 0 Ԫ1C0S [  [ *0SR3#:\00<0S @!0S 媢P@ T <0 0P U8 PDJp8P@@0111e000W0`S`Sx0S4\0L 0H =0 0Tp+ p`PhC0S)2p3 p1S?V?`#)&p' a 1Sl)p Q1SAf1S Y 9p$ m 2"OKK@0DP?`|KL0OK\0K@L0 0Z0T0Q0S<K[# [ [ |A [l0S d/80S l0Sd0h 000@0D0 %h0S  d0S  T*,800S0 [0S0S"  0C0T }0#Stw凪0S0`0S S 8g,0S , 0C,00`00l0S0|0 0S010S1h0S 1d0S$140S /〡40P(0&9H=9Y0P(0 (7pp(490P!* RbR aV000S(dR0(0S00[X1`$00PV`5U0000A00Y ,`'H뀵U p $0 pSf:Yf 00p` uU ?֩$0`SM: !@R&0S $1 S&40(00p000 [ 0R5 R4*P !RP5P"S4U  R$1SPP$Q$1p SR U ~DSRQ SP" 00S<0 xP3P%P5 0CP0l쐝Y [  0Da0P000pP1+!`GT0b#02b#b&$0X $0S쀍 [& Y$: [;00"P!,"T0 S :0㈀$0['00,"P!!00"P!? 00Y`T00 !000 30q W5j:0+a& G$  +! 0  ! [\Q [PQRU10A+!0 Y0 0@c&0t00 +!$0@G0Ө0S1!YV*8)<`d t$&ŭժr$Jծ'Sد/?&>Xϰ)Y0ƱԱ '0Am HLOWx & r){gfffD URRaArrAa [0 [00S$0, S00R 0, t  [0 [00 jcU*3!A$$1QR0X@;101S0S0010 [0]S 03 !p515;000$ T0;P0S ;0S,0 y;1\0t;A?0X0 k;B?0 !0C?0040`;1SL0 PY;X!dS;hQ;Dr tbtRQI;G;$QB; :H0S yލЍS03150p5 [1 1S|0 ] #>H026`GPP cH{6#>CI6X0 T02#H0奬$ [00H <080$4s0`0P0#4s0d0,0#4s0h0@0$0Q l #   Xt  0|04Q0X080 S ,40S d8 o80 0d 0h~;0p$040S& ["$q4 0W0W03 W00S pZ$pp古 0S  p4p T  ( ) p ^Z [$1< C/oS" R `0 [ 0$0 @ 000000P00d00,00h00\0001010100L0 0 1$00(01,0>03I?03)001x 01100 0$<2?@1c4 04v 08#$0 #(#<l 0 0&99t 9>Q X0Q40S00|00o0 00 R  ST (X#0'?   4pT TS ` !R R S 0 S7071011H0T RZ*JQ\0 [0 0+ S  R   0S* 0H0< 0J?oR20S R(0 00 25 010 0P B24 0180S   k B*{@- S-of A 8 / eA@00@- 44@4P\P 0B"" r)-@=B'8~)0/p/@-a $:7Ѳx &G-`@ P p&!>0P U0 0  P@ G; 0P\0&' 0La R 0a U   r)`!-vs@-pP@ 0  g4X 0TT8LЍp P `W40 8r) r)@-03S   8 Ѝ䱳@-@p$M0 0S ` P41 00P 0! 08))81 l8 4\84L8@DpQUVPE:$Ѝ8깳0zj0@-4M@ 0P0S ,Q 0  R0  7  0$4Ѝ0@|8R  (  0$R 0S 0S 0  ( 4Ѝ0@N84Ѝ0r)7Xy @-L2p`8s)D@-0 L@ R0* 0s# p0~)P `00CS`0p S00 P0S X0X /Xa9 &p@-`@P8!R#<10 <10 .810CS81V <1S 0 <1l0 h冝d儝`0Pp <10C <1$0 810S81r) % &x &Ps)0@--@4MT 7A`7d7hQ 7`"R d2RK7 m7d2SA |= hk0:{PPS['ΞkHk>[E{781 < =C * + (+S  PPP7 0 @@@ zj{ k{[+S[j74Ѝ00B:k{{'*k{d+S\7?@@-C6?Y@ps)r)ִ %Lt)t)9p@-ިj0d2S4r)@0@-0S0@d2SȨ`2"R2 %r)@-@ 081D 03t,  t  t  0S (8xS`S)?S DS . x0008Nz*P0C 2K+ C (K0C+ 00CS00Na0CS$#0%% &##l&###,'###t,,#X-##--, ⾖  wNPK 0@P* 0@0 9 90Sx9 00K  K A ☖ 8 QNPK 0 Q PK. A3K  {  4NPpK P 0K. 80  a p N@PV P80S 7  I  NP>8(<08808407007,07(07$07 0707070707 070707072   MPK PP ,70St'0 0C!0R3z T70S0Ss K - @P PQKh >PK t0@PpS K> 0 pܕt`@@hP0V#T00  HT\HX0Qt0pW p`R000QSL00D0QZDD0@j0 `X\0X0S 0PV)PP PP K 0P@0 K. D2K>x%x 0 &1 `@씟D@pP @ VG|  0S$0 0C!0R3 0S0S 0`0}P `0wP c=0,C 0  R+ .t 1 0  d0d0`@ 4LR p 1  1 S 01 \Q \HHB/p@!bK L0 S1P00P0P D0S( X3 R  h1  X   `pH0 S   \0T0 S +`,@0SJ @DUY<  ǔ  LP0S|& x 1 ⵔ ` nLPcݍЍ ⨔4  ⢔  [LPPA0S, P  ⎔  GLP ⁔  :LPv u x .LPPj@d0SXT000+ XO|PB' PLЄ**`~*(D~*x &.KH \7 L @~*D%0lNd2;~*GV 0Ll!EeMd\~*(~*gfff& , t-=3Uhx&6HYbgm@-<00iS03S !9FP-~**l0@-h@   Lf @0a 0\ W؉*ى*@-`0@Px0 B0PU1 S2P T0p0S @0R<<C 0,$ps0 Ѝ@%\~*(~*s &C-PD1`0B8! Y!R!tM@p  10S O0 tЍ000iS00S 00S d `P !/W @ 0  P ! ᔜP000 p 0p_ W@000@%\~*~* &~*(~*D%#`0@-@X0 B0@T1 S2@ 0P   0S @%\~*O-tQ0S hhM @P 0S <@al1G-0S \\@`PqP T0 :@18a P8qU @T+$PnP@`0S 0D !0R3 PȐ尠U 0S 0S   -#P0S0S \0S  - @(~* &P~*~*؉*\~*0A-0S P `p @T V @\PT$@ 0S$p$00X`@(~* &؉* O-!1 RR0夑S M@P|q| 0P0: ЍS DP8`P 0  V [-000[ PP@:SR  0F-g Q qj`P0pX0 l000Y000~*(~*`~* &#h*P~*F[kx &2O-0S  0b0% 0a1PpȡP@0pP00Z: P0 *@@ : W0: R0*0 S( +0 R S U0:W00#03RQ00S Pq 0000 S  Ph] \ X,000P@ Ѝ(~* &h*P~*`~*dkx &C-MM@PQ 0S  <0 dK000@T0S *@p㼀 T0:ۍЍ`PP@p0 ? Y 7  000PU+ (~* &P~*0A-0S P`||p U0(@TP`0  RF000S .@(~* &P~*A-p`P@P +Xp0S 0X0 0C?oR20S ,DoS 03x &aMp@-/0@Pݖ 0Pp SRp*@-8E 0S$0$ 0 0+(v~*x &A-@0`0/0000 SPڤ/0>+b T0 P<P0? 4 00?**N%0@-@0 0坔0@0Ѝs@-@P`P @TZ TT_+?0 00?႔+"+R  + $Ѝp x &$0L<S/ @-階P*N%@-<$p @,P$0@0N% O- 2@`pVCMz Qp@0DWCߍ`TV B/ ! 0R ?s0 0 F U@`1P0 S8Q 0S?(h X:0000[4*0S 0 0S 0 000R*Q *0S |T`WQ0/3?0 S 00000S  ` ~*ȣ* &/C]h*(~*O-X3p0]MS DDY@c@C 800#0n)00RS #0c)jp"& URPP "9R~*W 0"G)00RS[ 0"<)xjph"lLUPP"L  Pp DDB@@r0PSY : SVH`P؀/0 ;10L<aS$ 8 <8  @ ( D `  P  `\  T  ؂X  HZP ,? *8!88hM/0>+b  P<BP P +`0?0H @P VVPPD . )L P EVP3P|]ߍ(~* &H~*~*~*N%*N%B' h*'*GelEE*fx &N%w@-$@0 00: Sh*G-@ q `0S+"P 00S IP0 S00P R HRڄ00S th) Y `̕P 0 Y00:$00S $O)P~*~*x &B' O-AMM`P@mpP8 0 840 AލЍO/0 009/P7 0p!p ( d`Q D D @P <⁕PD z@P@  ) ) (iPD b@D z`Ġ崰TAލЍ0A. 4B   R ; 0 0 (D E@D ]`0  0 D ] *, x &FA-MM# 00 /R @`㨀pPP 0S P@ۍЍ0 D ,ڋ`D @P 0V CP`B' *p@-0@ @P ?P @ p@-@!@<O-3tM0 S pp.l00RS\3 P3P#0L?'HC4#S<88tЍO, ^($PL    =(+9(p0@`00"آزL<` 'L\0@ WI < h`VV#W   @Pp L<0@'pk0PxSiSbP 0'0@$ 000 ]'L<0@ q `e`T|L MTtЍ0 0C0\10S 0`S$0` S\!X!h0SS   1800S d00X00%90P!Td0 <'dg!(~* &c~*H~*~*N%N%x &*~* ~* *<Mj@~*+}A-MpM`@PP 0ppd!d @P TTS'L5몘< 0J'ۍЍ aD D< !pPU   U`k  p0P #'|m x'$0S _ p T0TP 8 'cT8 [E2x &*~*h*!K@-$P@-L@4#S 0  !0#S 0 @!N%0A-@P` 0 P0: 0tpp ?ؑ0@$aH00S$`0J(0 "S $[+p0(C0AУ͡ 5/0(0#R00 #0Q0h2P00 (0S $7(C#5/0(0,0S3,0P0?0!#0,0@ W#P Aۍ<ЍP(0S  +p0(C0AУ͡5/0(0+p0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B0S 8#R00SR 00S \0l 9P tlx3  P8P0Sh~*T`* *P%Kh*~*| & 0 h*e@-@0SSh~*0O-wM< 00 0 80 4 @؂  P  0 @0 0H0@0LP0D`PP:P S  S  S;  S 0 ``p SK  S"  S<60S  ,,(60S B6v0S -PΊ 050S  fЍ50S P 0 L50S  <<K 0,000%p,,[0S40S  140S  P 0 0 8x"u" V0 00`40S 0 H 30S  30S30S  ? P8) 0> V 0 0 8""P30S` P [L 0 &0#p0 0020S  20S620S X@P 0 ]]V 0 0 8!!20S 0 $m"p0 00m 810S 403/ !PdV00 0IX10S00S 0 0 800S 0 4\  03/`V 4   00` h*x &(~*+ &$~*~**D%egg<ܣ* ~*Re~!/ 8e~**hDjA-1( 0  S !@ 1 1R 4S8 !4|q046@0t\a00S/ P0S  R+* RS-MP- !0 010000 QP 0PT 0$M P ЍPB*0P;C0P|80S050 00\0 0 @ 00 0h~*h*T`*P~*+K@-|cM0S llhChS0S Y]P0#0,,;4 R0 2r  0500K Pr5"0C590C990C9000Ph|n xѵ0S \2d"`2Q090 9  ЍO8Dp/00ᘙP1Dp!P PP0 00 e{P @PWI EhP WL0S qDp5lDp 5됹*%$p@-P(@P yPp@t%0S $  R R0@- *@- (0 0 0 0 0[ Ѝ/ P P PH N;D%5@-(M0@ #\S@3@#:@ 2 (Ѝ $ d7@-P|  @P .oPP @5yPQS,j Ѝ0**0@-QPM @4OT 5_0d@Oo@! "U  R P Q T%< @{ 5_U@,jЍ0%(Tr h \f %Tq @ 0[ u  @Q u*rol Q@-.@h0 \!@@QR  0*$ *0s@- @R`  'P.FoP ,ej0S ,^j|Ѝp l0!PU U 0< 4 Ѝp@'Ѝp@(%**{@-@T T 0( (  ЍЍ@2Ѝ@*"!Q p@-@P T p@<   p@ 0 p@ A}O-@"PTMA@ p` @@0@$(@hP PETЍPPj3 @@0hPt@/lT:TЍOT0 EW y R@x   ;y0P gyR  ,\100 0 S00C00  Q,4P `0 m0 0`g S` ` X`00CS`0 X 0@X0 X "(% &@-00C Ѝ@-0  ; ЍO-@p P4 aTAD -QP  P PPP@D`FRPP00SP Ѝ@-@0 0 0 Ѝ@?@-| x &@-@-QAM`@0Vp M0dK&aXQX!0T L0P 0{0 ,+Aލ ЍP0001!! ?t0= !R  0Gm@Pr{5 F5i{<T0 <B<@D@ \0D0X n @ DD2ؿ*+10Jz*8@-f*0@-6S Cؿ*@-,{){&{x#{m/l`@P" XzTW= t <p4em, j@L **@-K{  x &0@-h@  0@ 0\0CS @C$&00S/p@-8P@U``p840#U:0X 00rX0X40P80 0X0p`P -7@- 0@P00P R*0 B Ѝ0@Ѝ/O-PdMpP y@蠟谟 T0D 0 S =dЍ` | J ]  ^`u!0 k0 `00$C0  .0`  V0BP }yj$&rmC-@`Pp㬀嬐@"!0# U 0 pp p1 ؖP@T0S0v$P    Ѝ 0-,Mez 808"40!00!,0 (0 $0$ x &-7@-Iz`P @XT@  R 0@   000 Ѝ0@Ѝ/8%2P*3p@-PP@ Gz0S 0CS 23 0 0p8z)p@ hh 0 00Sp 0 0p#z UpP*d*<A- `(p 0epЍ P r0@P  PP 0epЍA_t01Sh0 ` 0X2TpT 0` 0S ` FP `aP*8% 0A-Q@1(pS1S` W 1SQU(W1S WЍWx1x QU LЍA <1ЍAkW(~QU0S) S S xU   f mxU  UWЍAO   Yx U PB DD= ЍAP*8% &2m .d4 0Q 000/ P*8%A-|AJM1MSh=`pj0 `Pw c40`0 dp0S JލЍ;X P0wA7J.H0 0A1$HpL  $`0P0p0 Pdpx Li0S8b1!0 P*G-xAp1 `S1SP V1S \$V1S VG 1jV 0 \ CGV}\\0  嘠EPe0SVGxh1S bQ 1S Z 0U GP* &8% 2jbA-a0 MSP@\ SQR$SQ SA 0hS 0 1S 9A{SprRU@E@PPVT <cA ]`P* &8% 2j0@-P@0$M00PP0 bp$Ѝ0 R  h,d0 0 1S0)0 000 0 P*2O-pq 0M08@ D @CT Ѝ0VЍOR`" 1!0  @@0ap Y PP  @@ 0 ap R `Z ttx00CS4g( P*d*2Y0@-P@0,M 08PP 0 lapf,Ѝ0 P  ,!! 0Q P0Pg7 08Q(} xP*8%p@-`@0M 0(`` 0 (ap"Ѝp R  +|P10 01SL0 DE1S*-KP !8P*8% O-DMhZ2 0S 0 000 (eP (P(0U%`(` PA@PDЍ`(Ppv (   pp$0 $P`pDЍO{(P 0u$  (0CS-  h+SP`p㨡娱唑( r00R0S W 0G0 0,p,`1!0< 0( (0(Ps p( s (U((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD"!!!! P*p%Ձ2C-M⬀p`` (~sW0P0 0000 AdPPQ ЍP@P PP  PP 0 `pЍC 0R  ,*0W400(00 P(t 0SQP o0 Pp0!00(YP0Sxpx1Sd0`DS PpP 0PS P*p%Ձ2X0@-P@0,M08PP0 _p,Ѝ0 R  I*0 01SL zZ{e[jKZfke[KK{K+SP*2bO-bp0MSP@M ET S P4"4*J@ Or X:0@8 0 :_p2o3ٍЍ|s p ss "R x) X R TX PR*1 21 0T 1S1!T0 0*T 1!0 0*tope0 < e _@e 0 < TP*H rO-{JM M`@Pd3 dP00 S5VPYi0 xxpQi0 `Xp$*8;EWLpO`k< p58 .x &O-pMM`;p.pp P@@ p p p0Wp㼱0Z:0S WލЍ0 0W@P\ @PLqLL?H%dP  1pZV㟉 1Z SP hZ.pZP hZ.20Sa00 0Zs0V9 Z-P h\Z.@)0T:Z^P hZ. |d edAl$*@@-0`0 0XPP 0@PT zXP Ѝp@0(PP DЍpp  O--tM< 8@40*PPʄtЍB0P(0  (pPU   T T T;P0t4tT$0EZT6P0X4XT$01P0H4HT$00SZPT(4TP$004 0S0R0S00 0 0 (0@` 0 0@TF*3#03  0303P0T0@؋P(0@`,@pW6*40S 0dS0ktDᅄ p 0`'pu  ;Xpl X `(fm0P02R$0Y 0BnS01 0<0S 08 S@ ?@0?D000S, 竸0相S0P ?a T0 4 JP 0L ya?L 0Hqa {{'0{H 0,0 0,0@0P00D0@ Bn| 001 00Xp` d?4 $;`p J? !4 ;$hp X0 0T0V {{'0{0h `Pʟ 0aP 0a $0p;T Y@ |{||݈}m}]Y#<Fo00SQ0勤d4 00kS& Lp0p$X8p p$;`/p} 0@U 04p$;h"pp h0` XPɏ 0` p0`$0@U00`  0`$000$ T,0S0gd0kSㅤ8 q 0pXp2 4``p$;p' 0U 04h$; pp  f! Ab! A{ {'{X0@0 T0  R! AN! A{ {'0PUPp Ǐ 0{>` 07` 0 1`T0 Y@0 @-?f (x &A-@`4Sp  PyT0DPEE$UX LaP00DaP 0-80 P $3MDPE@DL* p@-P@Q0  0 paP @0S \U$Pp HR0@ 0< 0p R$C$ؑ%*+{+++@-3400S (0 0 pp l**xX*O-\M0 MS1 HpW-Q`@`((Q(0 Z $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0l00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ$& &ܦ++ܢ+ܞ+*PA-@@P@T .@ P`p0Sl( d0 X@ P ,0< 8N(0@Aؑ% * ++A-@P@pP0`S00|0 R d R 0L 0S @!P@`T !괞+*h*ؑ% (+{P@-- 0 D+)P@-- 0 8+9 P@-- 0 ,+0P@- - 0 0 +*L+6P@- - 0 0 +*p+WP@- o- 0 0 +*+zP0p@-AM 00@0 0@SR- P1 PS" 0S00!C$;P 0S0\>PP 0T00aS0` 00S0``0 C;PaS` 0` 0R`0 0@0S0@T@ @0 Q000S0]'Aލp++++G-1MMP, 84 1ݍЍP0$C:P @4@0 PZ30S Scs 5@PQ |0 3@cs0S0S PU~\30S5 0P/ P30 043 0 $3$ 3Q0RQ300?o2&Q20S  2 0[P0002@0 0R R00 R ?P 02D"000 H 2 2QT100?o2& Qy10Su 1@P0001@h, ` 0 PQ0S0Tk ,PU Q 0S 0S0 0P+ 0! 0 00} 00QQ000?o2M&Q|00S  d0 0P000<0P++p X***+*++** +PC-p0JM M 00@0 0@S+ 1 @Jލ ЍS2 0S! 9P 0S0<PP T0  t1t p1 R0 0S0QY`% 41 0S (1(喎! U9PY#P0͡ a0S ?@$00 R   R 0 'l00QS5qp P0ST00@Y+ ++++*(+ 0 0 0 0[(+# 0 0 0 0P(+#C-KM MP+ |2 Kލ ЍP0`"C8P @@2@<2000,[P 2 0S@ 2 . $P0 aQq0S 0S 00 3@P .d1@0S t5PL1 `0P <1N`5|0@0 .I000 L0?# 808#+* +: . $J4 RsA- MPy& 2 ЍPO0S!K4P 0 1CWP 00|S v7P /P 0t W@h1d@* PP!@4Q@P@$J uW+  p@- M P# 1 ЍpP! 0P 0y#p`1` 0S@1D0 0S 1("P&P0 0S 0@T 0&`lN@P PJ d@ x?0@ ?E0 @ 0@3/H0T 00S00\Z&+ *( = P \*" *i U+A+0@- 0y  ++0@- 0 *+PA-PPPPU㈀ q"00P@lph0hP偅00`0 @00DT,0P AD++* +ܦ+7@-PA 0P00Y00 Ѝ0P6"0P%0S0P 00I0@0S 0 S  @I@00+TD0 S +<D 0 /P++ ***ܢ+ܞ+ P@- !0S000 005 0P !0 0@hP  0 0 00%l00hUPL0H0D0HIP0 0 00 ***iQ+} 000 0@-S$00 00 *<* +D*000 0@-S$00 00 *@* +H*p@-@Pp@0@- 0 ++0@- z 0 ++PG-R@Pp Pa!ЍP`P? P< P`TP5 1-PT. +-@PP$$`. U(1$1@W 10SV U00@ $ $``PK0 0  S  TV Up0l0@W T00S H0H 0 @@ S8  4:6c,*0**4*8*}*iQ/ k  @-j0+P@- x0 pP \00}ST00S H0H׃@P 00 0( 0$ 0+ **   +++P00P0Ss@- 0 Ѝp0` 0S P@P ⾦0Q R   L 0Ѝp@萃$Ѝp@++*(+   p@-4@PPb 0 p00]Pp*+E A-PO 0$"0Ѝr0S 2 ^P80S10S 1P@a0 ` B0崁S Cb"c! !    c#A P0U0CtQ00CS0<+ P?00CS0@" P7 (!-PS0p00 p P 0c" R  c&0P UR PE 00P0 0 Sp(0L0 0 S++*J * +++ &y   P00P00@-SM  0 0Ѝ0Pl  -P 0V)qpP@ 0 $0$U@00+*P00P00@-SM w0 0Ѝ0P | L-P 0u)qp L0@0P4) 0,0S 0000+*P@-G 0 PB?+"@- (0@kP0 @}긑**P00P0A-S쀟 00ЍP  ,P 0-0`P ,!PPP 0RPF@F@@&.p A DQA MA00+4 Rs P00P0O-SM   0 ЍP  ,P @P@ 0R@PF`-|0P 0BA0hph`h@Р0000 0<0 8F+4 Rs+(+*#Pp@- 0 0p`@PP P P@]*p0 ` S P@@ @000 (0+[3 b*j|**A-p`Pj @Pd0 A\P ^00-4 0 RU A** A-PP   R ЍAP  R  b@0S00Ѝ@`p+8%*00A-p`P0 AP @PLp @A=P 00 300+*p@-X@PP D0 p<00Sp@,0,0 0Pp*++*%p@-0@p@SP \0 pT00Sp@D0DÀ0P0,Pp*++**W\p@- @x@RP d0 p\ Rp@L0L圀 P0 ,{Pp v*++*dO-MMPQ a 3 ٍЍP0 #C4+P S@p3`X 3 | PP@)L?0`t' P00S 0P @B0S000p@I2/2@0SP$S \S0P0" 0   0  P#"00B   BR 0 D )bw?0 yD@0SPiR0PS 0 D)bc?0eD@P1 d1 0S x10SL1h`10S ,000CS0.  3?0 03/00S 0S 000CS0 S0  )t?00000i0 `X 0`S8 +y ++*U+$&*( = *i ***@-@P u00P o00Pi00 -d0lM T00S QD 0dp P,00ppq** *`*-lMP00S Q@ 0dQ P(00pp R*&*`*A-@CP` p0 0Cs0SQ3  9HPP 0 B RQP  00 0Cs0SP3 p@-`P@:7CP - 0S1PS !x-p@l-*`L)P %CP00 0,S!0R@lIp@-@P 00PU "C OPp00p@-`Pp@0P<%0 .0Sp 0h R00岡 Ѝ0 0S0C Br RQ"  p*TP/0S/0@-@Q0%Q#0S P   R   07W0C20s07W  Br$&G-`P(P @ XGP  RGPU0 00P0 10S / _BPe 8*P@VBP 0pS 02P p)*:PGBP p!*P :9BPQ p000 SP0S 00S1 @RđU0 p `FP0 0 U ))) 0 011 2Ѝ @p) P= 0S000)0S 0PS S St0 0S 0`S@)H0pW ),pmu`**C' *0 - BR0 R  P R $O-0@!M M P<@8@4@@0D@@@pFPm4` 0p 0S 0S 40S 0S HZ@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /PRTpKX`V q<5PUp@ @l0S ;8R@P dXP TSP DNP8 ( 000@0(@P4AP 4@P@(4:4AP 00(<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU <PPP @ @ PpW {<pPp3 Q  `3 N +; =0 080( S, $#(0 00 0$)0"0 0R S"  c`pPR  0n(P0 Z , _0%T00S9 llX% 0S1  + ;=0 00 (00$@0S0S20}S|& @/G@P00Y@VN 0SK U +HT;+ H ;+H;H` +@F;=0 00P$` Q(0 A `00+S2;=0  0`0@@DcT@@0P/PP0,00(S  T]@pB' *.`*N**VU ++x &|6**3P*O-iM Mh8dLlOpt͍40,xHD@|0 y0PL0.600K/p% ,An'@0k'4QDg'8aO?ⰐV=HLa少'TU01p 0S `PP Pd0sh0sl0sp0s0St0s tU 0S V|V?0S #'?0S0 /3PP''`?0S 00SV4  0^ 0 .=0S ~P' Vi<, p)0S  ~OU)P$.>M0 0 E)00 DQT /=0S-p= 0Py 0Sv ^&p>Ȫ uPPP 0S :hOPR>X :HCCPPW xPx0SV x0SZ d+0 0$ Py$P %G>P  0`!U/1\1X1T100p `10T1S 0S \AT! 0S |vGP l UT0 00S 00S P P%\K:KύU000,! 0!c8 8!0R PP000J880 10c/10:\`P VL 08 P巜PtPt0S8 0宜\e[U`P@xTv S 0k_0P0/PP80S JPPk/@ꐗ 8 800S Xk?/uD80S00?o 26$PP0 7P60S P 0SH%P 0S@%6Fp嘆VFP@3x)tv8bl60d6sP 00@T i= 3JP 00@T Z= $JP ݿ00PO ZM`nElP<Xt'(OP<K460S(`x@T*4!@&K,& &5uPU<U0 0( 0Fx & @5 h5@T O?00$ 0@4!&p40SdPYC PP4P$P& &Px (4R$&~&p0STP/X3Uc `40SI 4 r d&TXPx[&&p8|XP 30S @4LxXU4cb30S 4 @ 2&U@b (&UT  &`R0H0`0# @0HBP= +<P? y0 R (2000@/ #`pPDp@6d R(6(&((E6R P L6(F!  686`l0Əs l0l0(@T? V   %P團JG0 0  2 @R G0"0C?o2? G"0 "0A8-000 R ;R @BP t000 R RT 0S>0S00?'"0 40#.0S ?0.T0.͡@!͡!..R0l0"R0.͡0 #PP#PP0S0Sx80S#PP 岵B(L000.R0@D0$.0 pww0PppP0 PXSpX \\G\P #P U \ VpWt90S h90Sl9hyP $:0S @DT90S pYF1!0S   PZ0S= S E2#,: ,:` T00R0SE tPsJ  $P   BP Ud f:0Sf: P a** ϠP 0: T#_: 0;R.sr ZO".!0Q3/P\p;@ Z; R0;MEdh lp"0S,(< 0R.K @>0S 000S 000S 000S ߺ00|iލ Ѝ0S 03/0S ͺ00s@- P@<P  <P0P 4Ѝp嬑`P  <P 0 FUpP Ѝp@B 0S S0S  <0PPm0@-Mh 00P P10S 0S00 0 Ѝ qQa @T0 S 00S 0s 0 :7P 0 S000Bp@ T d@P 0|S -00 0S00 0000** 0 `*`**@-`$MpP 200000001@z70P/S:S y@P@tQVP $ЍUa7P@ R2  2 I20/0HPP":HpP@P/000 09@P004`0@@DcT@@00@0CcS1S@b+B' cPP00/@-E (0@  000E@*p*@- E p0@ `00S T0 0Lpp<0000S D@***xp*@-D@\00S P0 0Hpp8 10 10S fD@**xp* d0@- T00S H0 0@pp00 101000C***xp*+ -X0lM@ d @y180 00ss~ #***@-0lM@}0 0 00 0rS sS ld dM1d X1P0 00ssN,d $*+p* +9*[**3@-PP`@ @0@ss00V 0ss0000@? P UV 0A0T0Ѝp00CS0 Sp0 S 0 /RO-pTM|0x0?X0 "?0p 0TC0P`0V0X B@E0 @040SD H 8PZ0S= S DV0  @P*C0S C0#S C|0pS l1 R XaR 0# 97Ctp uTЍ  ?$0000  PPC0S C0#S@DT|0S ph@"\7$0 V `|#M"0 0 "@B **O-@BMMV@ Aile?0a>0 @@0P`46 pP,6P<B6  BR  P5(50S5V % 0U 60WU S00G00S(+ / 0S+ 0 S( Z000[9  BR q$5PP00CS0e0 x6 @P00CS0 L0㠴0 0 {P8$ ap0,TS (400  00BލЍ@3@30S VW@@c3!E'63 0p330S' U U# dT$30 CRKH3000+ [)[00E@ 0A>V0 `W4$2 2 2 >U[2000 p"00KT1#0V CR@U-[ 0S ,2  00 020 CRUT<10S@d@60 @S405  [ [P [ 10Sʶ50F?oU20S d10SX1p10S} U T U00T0SyT} dT([@ 0S10S 3/1V 0   0ZR\@\ 0YS P 9/ 10 XS P 8/0Fp*̣ d +p*+*t**++* +$&+L*-A-` @T A 0 ЍAЍ/0p0$ P xn5 h0h <o0@S RP 5/++p*̣ l* O-@sFM M`  @@ @ 0 @0$0`30(0$ 0,@aQ0P SCA40 ޑ 3 Fލ ЍP0 @,Q(.2@@Ȳ@aGT   2 P 0 PD0P|2d EP `"`d- L-0S 00S , 0(d  QPP d@0S00?o2 SP ?0@69P6 D01@p  d 01 D0(66S0d00 0d0A0`PS BP P 00S t0 |03'P@ 0 @00,`@0?*P*++*qV*+=*++-0O-VJMMsn0pFXv600S00p s 9PpX p6  h60 9P@^JލЍ,60 0 00`97S 60Sa5m=005إ0S# ̵0S5 Q S 5R "P 0S x500CSD5dXm00T;0S P97S, 5,4 % y0S 400CSX0$000(00000 PI |40000Sp40܀C XSX (4h00$ 0C h00d00`0<, CrP 3$x!>\ 0h0$<` ((0d $r 0( 3?$r / &<7R d3Z0 R0S R3(0s0?008'P 2X{00 97S0000 00S  x 0xpd8'lP420 00 0a 0 = `pH 087jP(; 97R_ S㴁 0S [10S. 0S* ,0< 1, CP8!81 R  p 0 / 1Z&P 0S 0097S;7$0:70?70>7='<0S P0s00[X0 R0S{ [X  Up*****?d***<**D*h**g+l+Uk*vK*+@-2Bp`WLM LЍ@ pPk  pe 00011 0S<0 ?!tq((00 Q 00SZ=9Q ='/?@#b!"/p89>0S 5>0#S 0(60 8Wpp %>0S !>0#S MD p6p 90S0 00 0 0GLЍP4城&00**p*Mbp*eB0A-H`D0 82Vp  R`RBR RB`2b  Q  ,*00EoE?AA?1 R$!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 ,00@ Y60 SG1(00@8 ~ ('T!000t, 00CS0,p@ TD0#/+"+ 0"%+?;#;0@#5;DE !>X@\ `U0XUڴ1QQ!0 P IPZ AV Ak{H{7{Z(0`4!dYP (e 0 P<(0@<fe0  0 @0S  P0S S (0dx ߿@(0l dٿX  .A* *@+ *0 +}%Q%%% %0+(+%%%x*00pp(KߍP@%U[0DE;@-2T0@ R0 @00S 40 0,pp2@ ***x-$M ?0 0 ᫺$Ѝ0-4M 00 0001P4ЍO--pMM,E,+ "  "4 Ѐ0 P0p PUp0( RPUp4d"R 0*Pğ^p0S 0sd0S "P @0⣠840S` $$1`$S 07 { A0 (> A{{:?dSd0 0#f3` 3R - BP  I# BRڛ h3h図"B \#0 fH#2ܾ` 00ß R#3SPS0 1"000f¾0`  $P(0 0SZP=9 =:k{L2 AP09k A { Q= 5 P;!%#3\QP  d 0 00 f!偾1@P0G10 R`dP 1*!3^1?^0000l!P0^`1 000ss(Z0S"%+0!gUp; 4@0S00d +@0 00ppMߍY@.A@+(+ *p* *P+( 7$+0+&8+Q0̴ & #&0&E&%**R&x@~%_& P P!,0  A& A k{I{7{Z\0Uze0P  ߽`F@<W00P<p<f0 ʽ@  Ľ@-20@Q.0@p@-Bd00` pd00CS01p ,P P00 @R0S"P8d`Qd00CS0+up "P \Pd00CS0hp000S 8A0QPA p0 0 `V倀p0 c`Pd00CS0;p 0@S P,P \Pd00CS0*p `V0 0 *Pp@h+$%&i+A-pp@`vP@ .S!PP l@P PE '&P@OoB@h+O-$U0mMS p/DPd n/0S 噝mߍ0P.0͵1!4PPd'0P0S SUpF P`4P PP P0CS0 0 p, P P P0 PsdJ.*P P &*P d0ppP 0? d`d!p P 0Sd0ppvP0? p P 0Sv0S dh0 P P d00CS01p\2\-\ P Q4280 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0\S81Pd00CS0p0 dL\0p 0 p P`, ^0#S^0C0 d~PXX Q*h+&0++$&& '*:'J Y'$&++''*+@-0 @0SP  $P  0 00@ x0 lףP T0 LΣP 00 ,ţP 0 $&'W+'' - BR0 R  P R 1A-0aS0P0P3U #P 00.S Ppd1lM `LA$X1P@  H,9$P10T0!0!00 (1( qU 0 ! ,0Aq000 00000P0 0 0pS000P0T h0h0 @U t0P$0`Zh**E '++*'(*I++)+++L* %((p@-@P X0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p+*+++`**D*H**+ H0@- 800S ,0 0$pp***x*A-@,Qp0S `0S pp"00`P00000S p`0S pp000080xT  ,p*+*+a(O-P"2 AM MR0xB p" R S4 P 04 S` 4S4P  $Aލ Ѝ4Sg1+Z;004P/S ++yP⑚ꉴpUp儑0倁 00g000000000S L1oV81<$1 R100CcSppW100S 0o9 000000ܺℵ4SU00|$@|PP,Ty P00+*Ч+*T*B' {((*+ **++(A-Q0qS0`00@S Q`Ѝ0FY)P P Q|0 R 0000@ Pl00}S0s00T 0S$@,Y h**+*((+$&+O-쁟a0AS000qSP4M Q 1X4ЍPF 7P0.0l1P00XVP" H@P$,!020$A$000 0@,  *9P 0 @ lP 0$0哵qp00P0}S0s00U 0S(@<X Ah**++*(()+0)4)+p)))@-,@02 9Pqث+))A-`P㿠`p㻠 L@P  8@P $@㧠٠) *$*@-@P+ 0A- 0@0PS0p`0P㬀" |P 0S 0"S0x R S  p`"R"^ 0 00+h**+++0@-M M P n H@%Pۍ Ѝ0Ph姘4/SX @ P;0@TP/P, :*O-@P`pW 1@@Pp3:$pF$`ܰ0X1 0!T@1`0 10S 0 SY E0W Q00S*00 000 Ѝ8+*@-*L0@0 <pppP0 0SP0 0)@Ѝ*ht@8+P  R @-W Rx000 0R/`0000/0S < S0C00S/ S/0C4*,*`*0*8*@-0 000$ Ș0S" R 0S0000S b0Cs R S             Ѝ $& &@-(A`0S0 0 0 0!0ἲp 0S:S50P0S0 0 000 夲p0S:S5000h `0P卲pTx00, 0 偲p(lЍp**|****C-@\ᄐpA`\P ^T1:00"\ \ L|9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR%0R0PMU20S2 2"0S0 C0GQ .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10Ns[00N B B ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0SP ^*0SPZ*@P0LG RX QP 0TJ*/0SE*<0 RS=*9 0S  7*+0S2*> @ S,*0 0 0GS$0P(0&*++0++/A-p`P @xP0  T  `00T  0@ R   `FVp`00CS0 XQ PpTD000`000 T00++ &$+C-pP`@0尐T+U \ 00@)ax0@P`0 \KtL00D P 0 ЍU+?*;+W+ &]+g+**G-M@ ` 04P0 43`PT V,P #TX T30S+ ` Q `V` 坰p\'0@00E.002 ,,P El"l-H'E@Xtލ ^p`0(T $e Qp TZ0q10@S  w 0$ 0/ 0$ ;pO'0$S*F>C0S  \X4 `$Q(00SZ=9Q =(/?@#b!"/0 0p4&0S &0#S Z&0AS  T0 0000 0p 0S &0& 0 ߮pw0LT P&<00V*x+}++p*Mbq)sp@-@Pp@ӯ꭮p@-@PP`!P 8!Pp0Sp嵔pUi +@-@ᘘP ,@-sP8,@-@tp a,P@-:P,,0@-PlMQ@00 00 T  40S P 00 P 0 0 0 PACcpW' 30S @@@`  L P v`UPJ P v0 S8 喴0P 00P02 刴 2 PP N00 @T  $ P ?0 0@T  w$P 0lЍ]P 0S !@P@E  X$  P@ M$T T0S @P@&o 9$0S @P@a +$Tw 11@T  0P 0p`Vp PP):&0007r0 0 0PhQ XP@`*$***Ҋ ,, &g++,    +**++kU+**++7@-Pm 1 Ѝ0Q0S 1 1尳P !70 CRhA R S0T!L1P 0S0Y,!S }P 0S 10S 0 0|@ @0 @0@0 @0 @0 @ 0 00S 0U+*+,*t**X*%-**B-9 +++i-p+l+s-L+H+++B(+$+*00S#@-@0M, 6# 0IP0S8u@0Ѝ0@*-A-<#1S4!(R< 03/3CPQ2 `P0R0A@SB-R姰@P; Rbp rP7@00S 00,S 00S0 `10 3/P00000S0S 11 03/0S1000囯}p0 P0 0 Sn000 PTq0 P00 S$R0000S 00,S 00 S00S 0 xp 103/P z(000;t0 P 000`p+++. +.bP%+d%-+t+$F2--As6̵+0 ̸+@-  0 H3 ĸ+@- 0ոȸ++P `00CS`0p S00 P0S X0X /XD &C-Pp@  l1s0S `l 0S t 0Ү`V   Ѝ̵+P%ĸ+.+@-=_ \  p( P@ ⹸P =K H ЍC @ X0/LAa#P z00N, N+.1.P%x &l6.B.0s@-@ |1`s0S P0S h m Hi@0 ₨0nS ]Ѝp訷+P%)+x+M.@-PMP T` P H00S@0\A PЍ @JP<<_.h+P%e.3.@-@80YT '{<1 ҫ+y.~.D0@-|AT 0S   0 XP%̵+@07@-LAP/"0P00  Ѝ0P% @-@0S S S 0\ \ \R@ R0 RG-P@ ?  圀? p ?x` @㺭 QT@D0 DЍG<s0 ᩭ@T*Qs00!ꄙ%.1.G-AMMP`PxB  d2d `2 剧T2 P墧 0 04R 0 0 啧 0R  0 S!X`㭍Pp@D✡0S1  s1 0S00SR&@@T  @T @;<1<1s0S  P0\! 1 (\AލЍP0S S  S00<1s0S p 0圠0CZ Z <P; 0 @̵+ȸ+~++ +d+|++p3 .P%.l++.0@-EM,P P8@P);Eߍ0 ,PP    _x0 <  W⻶TP峧, :S....p3 P%/O-`h3MP@ pPP呦L`-<#u03 ,塦UPE Ȍ`S00CS0%p00 R0ScP1s0S7 `$jP22l1s0S  pa0 0 Pp`1 Ps0S 0 ` 0 D PVS,1s0S 8 ` 0 S 1s0S <1s0S l1s0S 0|0d1 + RGL1P)  V 11s0S WpG'@P`!<1s0S0  ЍS R   RWP0 Uq0QLLD:꨷+̸+~03 |++ +P%̵+.ĸ+d++l+/.3/p@-BM,\@P3L1 D堥=:$!1 寥PP9`0<1s0S ΋ P00 { dBߍp ᶋ@`nUPp0eJ<R.+~|++ +.P%Y/+l+̵+G/p@-BM5,hN@P3X1 P60!(1 $EPPw9`1<1s0S d P0A0  Bߍp L@`UP|@s<ᓨ.+~|++ +.P%Y/+l+̵+G/0@-@pP4M\0PP <<0000<<0  4Ѝ0̵+}l+0@-@DP4M0 0P88 04Ѝ0̵+}@-M, ,PF A f 0 001 判1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍c/P%+}}iQķ+@-(@ $ڥ @ӥ̵+{t zt @-@>TϥV@1p@-@PPpP p0@-AM MPAލ Ѝ0PJ0!⢩PPl1LAd1T@42{.,0!P0㓥u&+@ ܳU 0S S 000 HIT   T lot  10D0 S B/o" R  0Cj/2Ru/P%V+x &}///+@-MP Pppp p尣l@PL\܍@肩, HP ܍,0 < !+/и+/.P%0@-MP MuP%@e0@SۍЍ0@7P551d dqPPTۍЍ0@D@ 5ݨ , ۍЍ0!+/+//00p@-"P dd;@PpPPPp@4<8P L|l1s0Sp0p@#q+/0P%̵+p@-P MP(P @R0ۍp@L7Sp`ẩ@P\ۍp@P l! r R< < 5| ,=ۍp!+%0+,00P%D0L0i0@-  IHxx &1O-P4M$`5~`=@Pu`0 `4$$厏p0Z$ dQ Y  Q$0 P0$404+(t%h" 0X$XP0PH} p@z <+U, U$$t @DOo0B$10<13 B0lS010S 0P   RG tS)`S FSI (9S /S 00C6&`a0CS

<r> 04Ѝ0`+P%@-`0S@ P0S 0000q20\ @`+ 76 7@-0Pl000p@h R R  l R  R4尣03/ Ѝ0Q PP%%`+p@-$A`1QS 0SP ဿAP00p000P P0 P0 tP  dd\0H@H  "  \ pP%`+$J 7x &$%ѵ+,0@-1s0S 0P pP%ظ+@-(0(@ 60@ N긷+ ++p@-`BM PC@0 S0`01s0ST01y0 ܣ0Pn00x0 BߍpB/ BR 000P %y0001갷+P%ظ++ 0?o2 0/P%@-AM|Rx u0b0000@000  Pڶ0 q ۜP 0SS WS BSs0 +ȜP  ,Vt0S 1@0S0 pW ≜1s0S ؀0S R     |P W 0@^S00CS00  S00 P0S꨷+b ̵+ +d+P%ظ+p@-PH@P@pbP P [P @P% 0/@-Μo/A-@PP" p00CS"|g g g g g g g h `V ,PPᇈP0 P00TAO0 0S P0000 !0S0R 00 77A-AP00C!SaXp `0000CSPhi h i i i i i i `00CS`0p S X0 X 0 "S  0S`00CS`0p SX0 X ! 嚡X!咡0 0P0 P000 `~0"S0L0A/0s0 0P0 p ܸ+ & 87@-0S S S \S ^S R@ Br0 000 Cr@T0 0 Br@T1 0 Br\1s0 P P0 8G-@HP2 pqp =`P`PP2 00PF 0P 5 V @P @0S@0SJ/00@PP?P PPP P 0!SPȠ8ܸ+7P%A-@MPP\1 S }@P `p崀  ecPu00u0ۍ0 P 0@ 0000S ፠  QP00 ZP%+8h+58p@-`@.PP 0 4Hp$ PI@ps@-@P` Z  R  @T|DЍp(R( d[0PP O<P K(P ̵+f@9xt yt 9+0@-@M@0(@,0 0 Ʃ@P Ѝ00,x0 #PPPP0S p00@SPp +P%̵+@- (,⩩A9+@-@ t  nlP  ę0P3P x弟t废h P X屙 CߙЍ̵+xt yt ^9d9g9~9f@90@-4MP4PW 1<1s0S 卟A# 0 9 0nh LzDS<Q8 r,0E Rb g c<P! 81PP A0(0S$4Ѝ0=RJ00ESr r r r r r t>h<`\XT H.MP%9̵+ &9799+>9' y999:@-0 @4̵+7-@-傁0 R   ЍЍ/ +-@-r㩜-@-#b0 R   ЍЍ/ +A-ARp`P@1T ۘpPCA`@DO-dM@P0P00P0 0 8p800,@400(P@`@P p0p,0SX ,0S5TX  @@[ X  ( 0 0 ( (cࡘplP T+o,00,00娂00T񟗾Xv w ?@d ๛00 S @. @ C< Ĝ0ЍC 0x%&<Y<s<<< &w< p@-MⓗP* 0: S0 0 S P@` 000uЍp p P @TPH0 0000TI +<<<O-0]M-SP M0S @p܄+P8 00S0W0S' 0S"디` pPxh4P ]ލ ЍOv/L]ލ Ѝ   @plW ]ލ ЍO0: S  SQ ዕPPOu ᗕP ᐕtA0v: S+<?$ 0P@``PW|  TP p  0 0,0 00 0S0S`-9P``GvH 0S 0` &/P V 'P z{ RW^R\pPS jPx!1Z[ d 05?2[ޔp`4 0S!P0!0v0G P: v?b  0S -v⽔pPvP-H” 0Sὔp<m +x% <<><=E:< #=8=N=d=== = &0 R R /0@-@P0R0  APCU 0APLU aC\ACP 0^0\0R0 0 0@-@P@@ L!P VIP00S D00S  40 /I #O4[Ɨ +p++|%@-J3@-VPp@-P@{p 000/x+p@-@P0-S@@p IP0Tpp0p@-0@S`@MP0@ o P@ЍpPU P S{0P0ꨞ%x+?M @-@P @.00S@sx+p@-@PPp00Spp@x+A- `pP@P000 PP0 00@-@P P0P00S@x+@-`dM qPU= 0S: VP1 @@?T.  S  `00@ C @ H00 *S ?0`?ZP10HG>P dЍ#? 0@-?A?D?G?J?M?P?S?V?Y?x+@-`Mb~oPuH[0@EP<0 P0$0P00:JP 4Ũ 40P4  TP00t<P00\<| LxPD40<x+0 9x+0 4x+p@-D0@0S 00S 00S  !<0S <0S 8S0,=t00S  \00S PH0(]0Sp@ jDP 0Sp+x+X++++0+/@-0  @x+$00S/0 R/ 8+x+00S?D<+0  x+0x+@-0P4 P1 +P00p@0-0Cs0LS ``PP"0-0Cs0LS rvp` 0  0.S00 U`T  Ѝ0 Ե @-@P P  P P ЍQQl0l0ѳQQH0H0 Ѝ@Q$Qꇸ?Ե ???/p@-P4@Pp@A0S +S90+Sp@p@@-@@@    0 0x+ 00@`/%p@-@lP     <00S   4u @p  x++D0@-0S 00 @T@JF@+x+@-@0 0 0@x+@- Bo 00S dC0 ꨞ%?x+A-PRp@ FqpADFqp MP GPp P`UX@DTUtl@8/pXVt @W@T*U A (??@'@ԧ A@$0 0) 0 00S/+pp@-@ P 0s  SD@p贞%U@O-`0S@p 崠)0   ?990 VY†T00S[  RP {@  Dꐞ%+j@P 0S  R 9  (0///+L O-䤟M`V 0IS(,  RQ0 R005r: 4) "P  2"RfpV  rq$ <$Q  $Q Q 0cx#P 0 {   {`  @`   0 PP 0 @@0bvyf`p{VX!SR@ 0?  0qp1tCЍ QP$0 0@R*20 R    @ @  " @@900 SP05:Pk09a 2 q4   10SO  09ϬRXV a0SG\C002LAP10SI `10SEPB  D1 09 0$ 00*b$@p 09c|p  RB 0P  4 l00St0PRc0SL00S\ O +D++% @,++d+P @%,800S 900//+@-`@0Sp <)00S000(0,0(0,0+p@-@0Sp Q 00h@Px00p098@00sp000B(Pp 0 ꐞ%+\+@,G- q`V= P@;U000P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@+,@-P \00S @ T S 9(,0 +p0@-@TI0 qp0@ @}00p+,p0@-^ 9 @ 0@&)60 P@ ^@T+0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/+P00010 0/ᴞ%7@-P R I0 0#0 Ѝ00R% 0@!"0@@qp Ѝ0@GA+@0@- 00x Ѝ80098<@ q|/ 00\ /+A-p`!PP"@h9  @0@  P09   t!09 r`Al++@@A-p`VY@  @ @ 0 vP0 0p0 gT 0 0v0@A>!+l+0P /+\ -P0S0@  P2:1S0BS /O-@ 0 -R  UR +R  >Q @`?}0:S X?u0cS .S bS S@ @0,S@pS wS ,>P ( 6P 3kvPx@Pt@Pp@P0 0  SxKPKP KPKP hP ^0$A++++ A3A+@SAAA%+AA +_AfAoA$&tAzAAA 0p/+@-p  01SP R t0 T!WP R HH0o@08 ,婍@"P0 +A+T A 0S 0S 0S 0S P////// 0S# @-@PPPR0 0`aqR R S R0/0 R /!0 R0S //@- @Pd | ع  0#-?003&?=r 0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P pq!l? pPpĕ ?`llp@@`@@+0p@-P@P QT4@pTT@DQ0`VC@S@ T0CQ @6@+@-l@PXPHP <00S,P++%(+%@-l@PXPHP <00S,P++$%(+% Q p0/+P@-mЍP@EP @ $@P r0 0tT! _P P0X!P80T@ 00 0 A0+A+@-,@1P,P+,%00PbA@0CQP//DA-RPp `@X@@Ѝ`>P@\@P, PP@@P+A-P` @P lpP ` L@P  A< $@_rT `F2FBFJFWFAFp@-Pl@P TPpDPpp@U p@PpeFaO-MM`p 0@P P0: SXerX  MNP  A@P> ᷸ލЍ R R R00 P P@ P @P PP 0"SU T 0S0C0 6/ NP 0mS PrF %FF %FP P / VP+s@-P@`$ "0 00 BЍpA-@Pp4` R 0S Ëp@F@-P`( @p0` G ЍP+@-`@ (8R808Ѝ 8 0 CS  8 0C 8P+X+p@-`Q@PRpP0S  傋$0Sp xp@0S S D0V@ ` 0V, `U  p@Y %UFFF $0 (((( 80( /P+ % 0( (( 0( /P+ %C-@{㼀`p0S Ѝ @oP0S 0S 0 ( ((08v9P 0 PP 0+P+7@-D@P@A@00S Ѝ0 7PP+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08a9 80 8 00S08S9P++0@-AM0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS ڧ 0`P++@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00P++s@-@8 R 0R0` (0 RP08 80 8880S Ѝp0CR80S 00Sʨ808P++p@-p@XU N8PE`V` D0(  p8SopppP+ %(080S @-/P+p@-D@0S PX* 8P 0( ppP+ %p@-|P`@l0 R(0p0CR0R: $0( ip00P+ %7@-@@P@P  AP Ѝ00P$ /P+0S/0G-0PS`p@U @0 pP0@@@ X P00-o+o @ P00+P R/z-@-4@$P(0,0P  $8 P+ %7O-0PSGp` 8(hS?Pp $8SDG(R008(h8! 0S0S ^ Ѝ0S08R00(hkP080h88S 08 ЍO`0F?oP20S `&0 S PpP0@S D h T P P P eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)0$h48VK"3P( 圓R( B( ( W(PV  !PPl>@hH80S 48PS8P m088F80X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 0寢P0J``` P Q`*ZXP@$ 0P+P+x+ %P+FB' 0 pC-@P M!00 0 B R   0.S q3 `! P` HP T 7 Ѝp0 P`000C/0 !GP00P+F0(8R/P+0$P00 /P+00S/ ,+H O-鬡MX[$ 00! 0S R`PO P:g@0HQSQ0Z00܆@P7 ppP0: Spp~ P)dp0 R'0 Y& 墆@Y  K0H2  x* 2XlVlЍKpP00,+ %+FrFUL F800S ,00S 00Co//᤺+++p@-|PPF@T p@``lT0S S VS 7Sg@ @+p@-@0S00S 00SM7P p@0qp  y00S Rpll0P@ QP0PL0@p88 SP@ P갞%+X+H+d+0++@-'=@24G-@ eT00P  00`p|| 00ST V0 000S T28 ++,A-pP1 @`0000  (P0;0 A' 2 mA0PP     P  5X A*+Fp@-}@Pp$R0%S!S0C Sp S}d  d 0C Sn$ 7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP k0S0ptp 0p@^ 000Sp p@B0!S $P j$t00Sp$dP`p@&L00Sp7D00`Vp(O'p@4p+t+,+F0FFp@-`@P 0p@M+A-`P0@@@p0P/00,0S W HT T A,0+ +a9 F\+/p@-AM0 70000]0  c0  ^0  Y0 T0  O0  JP`0S1 0 c<PU0 D<<1 40 Ѝp+FG GG#G.G4Gt+++l+ +>(+\+8%GG,+GGD%/<+H"H1HGG0BHUH+aHqHl+7S< iS0S P0 P P P 00K`P iV 0FcS񟗘H    \ |  H d X ` 0 ( L L D 8 \ ,  P \ L ( t | ` l 0 < 00E.U S``ydP ePeP= R0S`Fc 0SP0@_U0b ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  {@0#0P NP 0 a0CS00 0`.P  ` 00P 0Sa0@S @P000S AV"P 2,00 @0S 0$ o-P 0S.P +Ta0ES000+P +0 /UPnUU0ESf H \ p *U( @U6 !U[ Pq 0S US'T60S# PP pf0SLH960S 60S0 97R0<  K60S07S ;07S 00#0'lD/K10@S0 @007S9 :<#0CSdP .=P 0 j0S e`q0 S (0!R0*?0I$80S p o0 S h(0!R0*?0/ !R00 !ı#80S!R0F !R0 0!ı 9 49!R00 !ı\90S!R0!R0 0!ı !R0t*?090S 90S `0 S 08:0S y0 S 0  &a 98L!LjR00 !00<0S0 !0<00 eSd0C0<0S 0d !0<0~<$yP0rP0qi0S 0!ıT; [4 /U;0S0SVp @ $< D ,< H 4< P Bl<000!R0 0!ı<00<0 00!R0 0!ıR 0< `0000!R0 0!ı= ` `<02.!W?PD!R0 0!ıPH ,P P !R0>>0i?Pd!R0 0!ıP& !R0>>0Q!R0 0!ıt?`P0E kP ?qp X? !R0 0!ıv?`P+!R0 0!ıP l?`PM P 0`0,`IP2)P 00,00  &20S?V" 80 PP U U ?V "R0> 8P|P U U "B0 PlP U U ="10S %PXPs U U.P!0Plh!% T(P0` !R0L1 0S<10գ?0/0 $!0 S00C0 0 C!R00 0S00գ?0/0 00 0 00iS $0 `;P00S0802,+/MD%~HHHHH+++d+ +00S/+p@-@P/!ZpO-S`PpM``@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0d80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 )0P R* 0.P0   80 dP d [0J0C+0   /G-pȀWY+p S@00PPP @ ZPPE0S`0S P B0 0R R@0`Hp@-`R P@ b0P @@@ 0ppM-@p M@9p00PCu RT0Ѝ` `?Z>P ?0 `P?>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#+  0 ++d+A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ# 0 DPzdP fPP Q gR 0S 0R   R E0 i++d+@- @ @+ @-P@|,+H @-P@o,+HG-(2pW pЍuPP( P0`up`@P 0pqp#b uu? SZ b0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Ul 5 P @U(X0jP +,++Hp@-p@`PP<J,<0SV@` `<D IP +p+H 0 + 0 +7@-dP@ PiP 0S  P Ѝ0+Po/@- + ЍA-`QpP P P@P%U0P 0 P l @8aT @P 6/P'a9I`FII@-~|0p p0h hhP 0X X@0L L8P0@4 4 \%T%QI cIsI IIIIIIC-L1M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@ꤺ+++G-@`M0PSS003 @ R S0\R% :R R DZ Pp ᝕P0H3/0S@@ R0Ѝ4 P/@-Fp H( l*F`Ѝ00S @  d[*\0PT T D( 88qp I`+IIJG-@P`&pppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(Vp0  S P 0F@@@%A%p@-@QP 40S R SppQ0 QA QR P/@ PRP/p@-`: PPp@p>p@- 0@-M + srp@  * PP  000Ѝ0l+8+400S/@-$@P P@`+l+@-@P  l+P/ @-p@''0@-M@'rPr00S@)PaP DP OP AP )dP oPi~|0t00SЍ0 r0LP 00cqpr00@)`+9JwJ%JO-(M0S 0S F0@S R v P 4X ЍM D@k Pp 00o pPPP`TZP DUP  PPpPH0S P``30STPQ?PN ((@(!P3`00)P0`0 p!P0`0 3P T ( r^0 b rP`& 20SP `JP   @( YP rY |2 pd T2 )D2p@20WF0b,2P 0S P ( sP11P =)v&0S )/ 1X P DP Pd1 ]L10S D] 010 (0 yqp 000Sp 0 4P 8 0 R  [ R 0 0P: l X l+h+>J+K8+JH+p+L+d+4+\+t++8%+,,%9KP@- 0@l+00@-'P '@8+>KA-P`XpVWPU@JTXlP0, 0 l+@-zP@ @0 l+ 0 l+ 0 l+p@-P@@P Pp@7pp@-@`P*PpVU p@Z Pp PpA-@Q`Pp f\\U7G-@@` PР @PUЍp pP\7CP \8p0SkЍGl+@-W0@0S @yl+0 R/%R %R0 sR0/@-(@0SP00L+KKG-`dd@p00CS0 kp PP 000 P U 0D IS  VU\p@P@- 0PKفA-@0 0pR`@0S00 R0S@00`P0S U  KP@00@%A%O-M@`DPp!Q Zl`@pW*p%pP` P` X 3P UpV`QPI`00@0H0L 0`tЍ8P ^V@00@%A%K@-@+pFPPP Ѝ@謅@@@`H0H 0P0t[ ᕅ@[ Ѝk< A-PPЍ0S `p@@@?ZPP D00< 0`tW  oPc[oB' @-@@ `FA-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0U@h+l+C-EMPPEߍ@ 0@Yqp `,nPڬ嬐P ` P:T0S E~P @  N0pS<`P  z P@++A-kX1@0SGk @1RpP? ,%@ 1P ````P0p000 0`00sZ밀P@pW UpZW Po0StZЍ UkZ@,+KKA%@%KK`0A-0S@`@P0L js@p`PDZ@AZ?Z,+K@-@@P ,P o>J@-M@P ձPۍ@ ۍ1O-0S# 10SPpuP 0 `|R@0 -R` dP JP @ $@ ЍUP RPP I 0 r Y P YU @T ` vv`]mP ᳄T@@P@T 000d0&@qP<`$@ᙄ0SY+,+ HKJ0A-`V8@PSpP0 PЍA#nPk`@@@@0 `rfYdY@_YT ЍAOЍ,+,L6L-M FnP  @oЍ0@-@P0MSP @ST $nP&!@Ѝ0@T@0: S *@S+@%P%@-M@"nP͡0 00`Ѝ0@-Mo0P@w mPh0 R\P0 R\ tu p0St00Ѝ0l+@+8+/ḇ@-@EP P0@/R@-@ (0@0T8$@+@- 40 R\00S@@P+<+h00S /pp@-qp $qpP@ QPpp+@-P#P3#0 R/  P+O-q$M0S|10S%@=P`\\100CS0S#P`vu @@$P`0S00S$$ЍxP`@n 0 R  0吠00刐 00 000 0 000000  0P0000`0E +|+++ ++O-M ЍOv *O-P@4M(0X0 ,0ut@ P4Ѝ40SW400 ?Q)(@PPp@d00$0Jp P9P  ` V0. 8@p` P P@00Pᰳ尃0v V `V@P,0S3 l3X3 A5B)P30pW0 0 `P20S Y Y` P P `V@Y*$P `@T_A0S t20S  P0 (0 S 4  3&PK20S 0  @ 1 0R00S: P Pc p 4ЍO V000 P0d 0P@ R LA0 Pp``@P,1` !X$0u$0@P_ V Vm@P{ P P Pu Pa@Put$0X$0@P_|$ 0S V V0$0$0S E@P R`0 P+++,++++++7@-P@sP ,0 R  000 Ѝ0+O-`V =R+` =R-`8 t Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =<PV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd`  P `` e0Sv} p0Ps {LI%l+Q% &|MMMMVMM0MMMN'N$0 RP  /+0 14/+0 Q/P/x%@-04 ,    000+(+8+$+G-P㌐剀L@LPT`ppP MT M m ! h M M @`匀+A-8p@0PS` 0P0aP +@-@$ 0 @z+P 0 R   /+p00S/p@-`@mPPPpP 0S8@pPp  ++?Q@-@P00Pl0 0  ;D0'(<%(8#(4!(0(00Q+I+QY 0 0R  x00S U d00SX00S D00SX   +++++ +++<-0 R!  ^ !0+04/+0 R 00S P@0~0/0P 0/\!4 0 / B  0/++ 0 /+qp/G-p`@PpP 儐u U 0 0W 00V@00CS7P P 0P@P+,PG-P0P`PpЀ@ 0@D P V 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB+,G-p`P@0@@0W  S #R0C00C0Ѝ ;,P  j F 0 CpGA-0PP@q1k`EP q 0P 10+G-1@`p`P0 LL0 rS00TD`0PT@+++p@-@PPp P0S0@p Px%@-0P x%80P/ R/0 0S 0 /+00 0S/$0$ R U++UQd+A-X@ 0S0dS 0p(0,`P` pU` s0+mQX0QH0H 0.4 00/ 0 0+++A-@PU  ^"04P4p 04 R0PU R4`40 0 P ^PQ p0࠱`  0+O-1P0sUPP@PP0⸡p`@` V R0 SRA 0 V 0  W0PR 0*JPA `Y0 0 y W`@TP0 00  0` qp +@P PAp ` W0 0O0  0`qp @TP++,P0G-cpPU !R00 RS@ U W0S P*P @P P`@V0 0 0 0 00r  0@P`Pl`@W 00 0 00r  0@P`V@+,G-`AP@pl0Vs 0SP@`.P@tu TUP蘺+G-g@P0p`Pxx80@ p 00  0`P 080qpM+,800S/,00/PP//x++00CS0 Sp0 S _0 p/O-0P-SP u   E f5XpWP-X@P0S,@ 0R S%@T  @DWXW;X   m  0 ЍO`P c@`@ W@ 0A $ \C/xrQd+k< G-@P $`P( mpP ` } { [" d @yz  0Z P"p@ ;p Tt p@n T6k.sq 00P6 LB06PU p7n>BP0PPЁ  G;P +l++@-P ,0 0R C l+Ql0@-0`  ^ @^TSa04S '0s05S #l++0@- @P0 QA6R 00+G-ipP@P P|`PA`Ap6W @+00S/G- M`p[@吠吐qpp6W @ Ѝ 0 PU/P IP P 0 [+U+Q@-000mS Ѝ 0 Q0 >@P 0 S#  PPP0`0 S  Q0 R pV`PPp fAp00꘺+17@-PU0P( P@ P0 Ѝ000SK@PP 0AjP)A Ѝ0@H00S< Ѝ0@? 0 0$09 ,+R\+#R%7RRR^R 0 `+<07@- R P(0(@?@ 0 Ѝ0%+@B+@-P M# @0.S ]00S Ѝ 00S 00 00S000 l Y-P0@  0R 000@0,0lR%nRR+RRR<07@- R P(0(@?@0 Ѝ0 %+@B+@-P M# @0.S 00S Ѝ 0S 00 00S000z l lYĽP0@  0R 000@0,0M %RR+SR1S@-@PP  @M ЍUS@-@PfP  @> ЍrS0Sp@- Sp00S p@t, }l0p`xP p@qpP@ 0p@ v,+S++P07@- S STl0 Ѝ0XP@T0PP ? @ Ѝ0@?0 00 H%L%SP/L0@-0@S *00 $0$ @L+t+H+B' P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P? Ѝ04@P,0  0 10 8%4%,<%,+0/0+P/OP @P/A@-@| plỼ@0TxSPLHD@<8@tQ%SSS TCTgTTT UBU@-V0dSK@S!1 CRJT" R&0CO  R꬏ T T T T T T , T @P3 @.A C#R4 T ̎ T T | T T T T d T T L  T T T 4 T T T T T T T T T T T T k Cr \ ,0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~+UqUUO--@PDM`00PP*0 S 000C S ?  0p00C/  0?>pU:Y U :TЍ D0!R1@0P S 0,ST40, @0D@D1!0C 0 +%%C-PMP M 0-@ᏻݍ ЍC` @80Sڐp吀吐| 90PUr`8mP0P 9 @@ݍ Ѝ 8꨸%U+.U%UP@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000A%@%UV@-PM 0  0 x0  @l8d P 0S>000D ;0Ѝ,0P с++#VP @P/ 0 /;V@+P/00S+0/@-@0S+0/@-,@0S0 0q00Ѝ+LV0/@-,@0S0 0_00Ѝ+yV0/400S/(00S/@-8qp@+l+P@- 00@ ^S00S00 Ѝ0\ /%Vp@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0SX 0Ѝp40@0000$ U @+|+ӵVV<VP@-P A7 ЍRS+DSSS 0e C RЗ ؗ l l l l l l l l l E C CS -S 1 CR 0CrS dSWS ^S0Sj0wS     0  E000 0 FK N R WR Q S-00 0  Wl+,W800S ,00S 0P//+|++$0P/0 0 0C/+++@-PU  @B Ѝp`@ጹPppQ 00S0\Q0S 0S@V JP 00$Q00?W+@-0 S 0*( (U Ѝ * TZW+_W@-'@ 6"+[WP/0S/P 0  //VoP@-/#R 0LP/+ 0@-L   Ѝ+?W@-`MP@ᱺ0-S0p00Cp S T 00ЍU TP PTU $PT00W`jWWO-P$M cLP 00S S03/0L0$ЍeL0 @PpXX 0 R @@-PD &$PP 0@s093@!+P0P0U0 P @0+S3P !;╺;9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P# aK[  0 p0 @ =RP   R R tq000SPP000p00CS 8     l 0U?o 200@S 3/TWU 0 [ 0S00S0000SL@40 S 0_P&00S +L+t+WXW@-@PM @PU@`p0@ mPPU   c(A R  { 000CSc ȡ P ` P P P <  RyV)00SS# P|U  U Uc0?o20RP 2/ 0RP0 VW 0 {Ѝ 0?o2RP0U U U6W0 0S00S00W 0 0S00S000ESX RU U U , 0 S0R  c R U2/U~00SS 00S000 S000;S U000 0 1X@X\XwXXXd+s@-P`@ᓸ000C S0 ` 0 Br ^ ST00T00VЍp $`~S 00jW 000S/P/ +L+@-XP H0H@ 0S0S  0  03/$@XL+% 80S/S/ 0CS/$갸%O-@pM8Q 0S [= 0S0 0 Ѝ`V/$P  0P ! AAQ-P $ SQ@ S0 Q0@@Oop B0 R ` 0 0S Wp0p갸%@-,PP0k%/-4M @20S4iP 2     L2 0S 104Ѝ0! R0< "$01 S 10S 10S1 `11S(  L2 T!2 R (10P!000 0 o R  RK0 000S P 10S 1v\ 1P 0S~ 0#Sz ,0 0S P  0!@+D+,,++%+%h+@-D+@- 1 Ѝ@-P}9`p@m@@dp0 `Q Ѝ@-@p9P  2#kP+G- @$pP` 0 )!0 @@ό@0p\p3#@- d 0 Ѝ(7@-P@2"@? Ѝ0@B@-<03?B3c/ $ 0 0 :KЍMb@B40@-0@@T KP  0 %d+d+@-@0@%0$R/ $堼d+p@-k7@-@PP Ѝ0@(0 0  ~ Ѝ0%]kWkp@-@PKP %@BP T800S ,0 QT㧴p +d+@-P1@0pS Q*0 0 R0 ?o2 `I@@P ?5W ^@Q  㡴000P T @P 5` Ѝ5+,0+uk@-@P Յ 500o/O-|MpP @`; o1 Y0 00  \0ACX 0s0^YP P0@ 00  `0 W" !Q0S|Ѝ@00S0/0 0 0O P0 l0S0 0AŒ\Q0X0HR?!1P^ A A +/kp p p@0@(0@ 00/0@꘺+t+@0p@-`80V0 FP@ ӂ!1P@p蘺+t+T0p@-PH0Q@0a0Ӄ1` A!B0 `Pp蘺+t+0 0/!u꘺+t+`0 0 P0H0@-0^@P C0/t++<001P/ R02:/t+ 0A꘺+0Q@-@q|0A \0L1!0sr 1!0sr  Q t++@-`P 0R@T 0  3/0@0~rq 02C Ѝp蘺+t+ 0P0PP@/ᘺ+0 :Q Q .Q 0?Q  \QQR/ R//A-Hp`0P; R@10C @C" -0000|+Vp@-@DP0Ts 00CSp@k@qpp꘺+@- 0 @ Ѝ@- 9 Ѝp@-0@PSP b0Cs0S| 23 0jS BS bS 00mS tS@p 0lD+p@-d割`P`00XS;@@}N y,PVurp |+L+T 4%C-V0`S@p$M`$Ѝ:S/ %S .S 0 pX@0S0S x?S \S0S 00@ 0X 00|xX@KXBX DXV @LH,XL Ŀ ܿ (  ( p  PP50S4 P40S 40S iqpz P Pv P`4 iqp PPau HP0V{@ Pv3XI 00BH@6X? X 8 T X X X X X X X X X X X X X X X X X X X X X X X X X \ | X D h X X X X X X X 4 X X X Q0R 0 oqp 0 t2P0h2h"0 \ P B B? gȷqpG0 PP01P 1011111 P T1 0 ꏷ 0R0:P0P Pz0 P \ 0 e 0R0:0P XmSA Pc ^ PHH_ 0$P|+0++l++p+++8+}014%H0@-@@00SOoB|(0(01 0 ,+L+|+4%p+04% 0@-P P0P0^  @$R \0 P$@R@0^ @R \ 0 @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P 000@p@-@PT `0S`00 # p`0@0000 S`@@@A-PQ@` 1 P 1 PP7`ЍPۭp0W"0 S 0 @o0 0PP J000ử㴯* Ⲽ0P 050P+,A-`pV@0  ` \ Q(P  RPQ(SQ $0RQ? " $ \ (P Q S ^ U 0S P$RQ $2P 0S` 0 00`Q0S P \U 0S `0P 0S0Q  R \  P  RQP 0  0 U A U0QPA00  @-boP/,C-pPM@@8`0C`F!稀/<  AYЍ I/o0"P R  ? 0 Q   Y0 ? @,O-pP@$M0P`@0L00SF RC L R Q R*H)  H0 0@000000 YH  )-   0S0S @ 00L0`00 0CP$Ѝ@, 0   /,0A-0@S 6PT(`V0(0l00S@`p '(`0qp ޲O@00CS4눲X+,d++1O-`wv@ 0 0РS ЍO00S P@Đ00CS$ ЍO^qp  0Z qV Q ᎲP㰲@ Ѝ蠞%d+%X++p@-P@T 40@@@ @p `>.<.@,,p@-PH@U p@^Qp@I(0?o2(0,k,p@-P@v p0 0P !U@p,O-M"70@40pdl780<0`7H @04S S S צ0S  0 [Q0Ŧ0S 0  C  Q? 0   ^R000 Q\ S$R 0C 0N0P0000\\   0C R 0 C@%,O-pQpPpMW My@xcPJTpd3dC  \\Ls PZ PUA (3T ?Rۍ ЍpPS@DT2%P@ ᤤᡤ @@ 0 >"X '| Q@ 'T@"0S000P ;04P ST@ - Pp 0Q 1T QP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P? T0p0000,,@% &,$&k k0@-@P P |P lP \P 9P:@%kkll@-@P @P P P(@Zll4lO-|1M0S" @`0 ЍOdPp400 0 Ppxy&@`00S 000S  0P Ѝ P0 000 { % % 0S @`,,El++0@- LLPR^0S @T 0 B,@%0@- LLPR^0S @T 0L B,@%0/,0/,00S /,@-IP 9P9P±@-0,//@-L@ p0 P㘤S0PЍ,\ QR0* /QS QQ*/0000/@-@P (%000000/0S0C 0//@- 0#3P Ѝ@- 0@SPR? P W[`Q  r$` PЍpA-`pP@T@  A-P`"F$@p QP ,0 0(000dPЍFP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-@`p?PP@@%?0P0U0S P@s@-0P00`a0C@S  PЍp  000@@0 0 0 0 0 0\/\\A-1!0 f \[Pa@1!0 f[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CqQV 0p@]^S @p^404 0 4ep\000,(,Slollp@-0Pt @R RP D D <@D@ p@- @$&0,(,lC-1`pMQp@P0᠁ `0Y 0 p.PR l1@d1`0 LUe\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . Cr R 8" [T \[R@]S  000TT[T@  \T  \R(0 R Ѝ,(,0,l,00@-00M/SP M $S+ +S00+ 0 0 9S#\S @P0 0 d0IS@P R00ۍ Ѝ00@00 S00@0,(,9mmO-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S 0QU t0t Pp0 `db`0V P0 0v"P,,0,(,[mO-`M@@_.0 0\0.> 05d S \|.t>0 x&d Q8  T   (   t   0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ 0P  P 0S| @,Sv p0S 00@P 0S  00@[VX0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0   X 0 t,$&A-@P p0R`*W00 8 0P P 0O-鰿MO00PЍ080?PU 0PH0 \ R0S40 P0\0 P R 0SQ0A 0QES0=0C>S0 L L L L L L 4$ L L $ $ L L L L L ( L ) L L L L L L L L L L L L L L L L @# . # h$ L L $ $ $ L L % L 4( L ( ) ) <* - L L . . . L . SS4 0 PS0@o0P0  Q Q* S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0 k0 P^S0@oPL0 R: L `0p00)0S;{;8 00 [04 0<0S 6H0SWP80S4PU 0`  E▘P0800A E4 0T P 0  004 0 0 || 0:-00z040 0D:DR <00s( 0P 0S 0S 0( (.P2S 0 HH` 0S0`V: $ 00@ p9@y0S te 0DZ H0$^P x0 0H$0$0 S8`0V:$ `000 00C 00P0 \8 0R:L`8 0) `S -p ߕ7 P0   R: ` 7B7` 2'1 01S:p` 007 x20 S0`$78 00 pg04 0<0S cPy/0800 SP80Sf04 0徕<0S  80S0p4  H``P <000F400<0\04 埕<0S V 0400<058 00 U04 0凕<0S bL0 R: L # `0pQ00pY R  Q 5 0Y4000  P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ 00 0 v  PQ8 p0V `XDcH0p0<Hp<(0000S s04 0<0S #p PB"000Q0 0  0p V0`0  `0P   P\   p V0S` 0  PX80S0s  " *p0 Y04 0|*40P0 xt*P 0S 00Po80S0sl!l*p 4 0W*40P P*Pp P R0 0`pL<0p<S80SP4XM  0`Rl0%#0VB*000(,t,,,,x, &%6?ht@E `, sss0,s, 0&,t,\,h0pW(p0 1(W0 P0H  !  R 0hP 0 pW* 0$ (1 0X`pH0`0h<Hh`<x0h041 8d0<0 0R0((xQ 0{Q  ,0,p@-@P`Tp0wS {S sS 0p )P 0 DX0`@p )P `G-`XKPPU00Wp01@ R  p׎PVCGXpp0!S < CrQR22 (3 3 3 (3 0  W0 0 00 00 00:S 0S0S W00 000 0V 0S`: ђP 000BS u ,ssp@-P0@T P  P1 0S-l4 4 L4 x4 4 4 4 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@,- 0@-MMP(@P  P'W (p4W+ ( P(ۍЍ0tH0  BR Rp R/ p/ &x &@00CS0 S0 / / &@-,Aᣖ0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@b ,1@-01\ @T P#OoB\@T P P P QQ Rr P\ p\ P P Q qR  - ,0@-  `Ğ\ @ T\    %R     ,-A-pA0 5S$\! R  (P 8!V0  ,P !M0  4PP6 Aņ<0S 00 <3P`p夀0U00S 000\P P D 000 PS-T!,5 x &X!,;p@-@0` *T  -tȒd lP`PT p P000ST @ &x &*t,?ts@-@P vP7@P @0?SP@P` Dp Ѝp/㲡P@JP 0S S @0Sޞ00MUJ tltOt@-鲞 u-n*tx &@-0@<TQ T00 a-0001S R0Slp@TX` T@0$ @H4E-T(8  @,<- , ttx &-tttuu@-h +-$*ux &7@-@P}  ?0S 0@T o00 Ѝ0i0"S p`@-@P  p TЍv<0p@-XPP%0ATp0 "R   DS " @DIAp% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,P0P01p,8|,01//00/00/00/00/00/ 0  /m,r 0  /m, 00/V00/nv00/wv00/ y00/v00/v@-@≘s,00/@-@{, 0  /ἂ,V 0  /ἂ,nv 0  /ἂ,wv/00/00/00/v00/v00/v00/v00/v00/v00/v00/v00/v00/v00/v00/w00/ᅡ00/H00/s]00/X 00/ 00/ wrN.gb@-0  0Ѝ@-@ +@-  P,q 5@-0S04c  +@-  P,j @-0,, @-  y,O( 5@-0S04c,  @-w @-0v,s, @-  r,3 @-  u, ( 5@-0S04czs, < @-  q蜂, < C@-hp,< @-  `q, < @-  Wn,  @-  Nn,  q@-EĂ, e@-=@|, e@-5|, e@--{, @-  %m,  @-  ,  @-  o, @- 0],`|, @-  蜂,  C@-p, @-  q,  @-  ^~, $0Qa @-`|, @-@DⷖP d 0  0 0@-0 |1, p@-j 后0뀥X P|500xPF qPC >P' dP% <P g SuP5P 0CP  @@PV 400C`F V$P P P0S p400C`]{m1ST !0C B/!?1C_xP00 S11X@zP`PxP@a@1S50200D(PZ) @@Pm q pq 0@Sq m @r m o m 4m m m m m m m m pq m m m m r L3P#0CP?P* <P >P P10!1 NSPNQ0^ B жr0s0Ɣ P P?@ "0C S񟗊@m m o |q o n OWvPr P1aB P u*z1S'ʰ1 B P uzP 00P1 RE40S 3/P0f PP +f P,ЍPR0j \ 0Sp0W 0] 3/pW P `B P Bu f `ye00x00A>0 b02P l00P000`ye`!,&wx &-x]x8-RS$&4-x & 001/`!,P0 R0//`!,O-p`*@PP [ ! N0P @ Ѝ0d00 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @`!,xP/D0 R/0@-A1 P Ze@< `!,O-Bp0 W h0p 000: Ѝ`((0S 0S inP W000 @  S! S0 30S NnP W W 0 0 0 R @ S 0 0nP W0S ~W0 00` S P0PS PH0SPPn0 00n0S  nt0#?C S UWPU  j0X!0Cs0S;3PP0 PEBWt!,$& @VUUUO-$MHZS  R0P 0L`Dp> =0Y0 0S 0g v|BgvPmmm@`0l@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C 0DS0  0gmX 2 Fg0  B6"U P0{ P>  PN P P!VUA`E DIv@DP`0f ff@`"PD P AP;  JR !   ` D0!v0@0!P`1 V0p00@  \.`Zx`F`FV0p00@  DPEu@DU`E¨` Y @ {᷀@T`— R    B2V0S 000 0 0{$ЍO0Y S t!, y7$&x &A-lP`Pp `l@l@0T `P@ P Pt!,@-P@p 00T0* p@Ѝp0 000 0l` 0@ Tl|@t 0^P ⰰ t%t!,yPp@-@TP0Ps D` R :P 0S@@Q@pt%t!,@-@?t!,0ejt!,0ujt!,-@-@00{  Ѝ@ Ѝ/-@-00 l Ѝ Ѝ/-@-  ЍЍ/@-@@@-@@-pP@`M,0 0(; 0 00`Ѝ@- Ѝ0O-M P`@pk@kUjT0 0cP 0D0PSY 0SV L00SRDwPPL00PTP]y@DO@W =p 8PQWpV`KЦo`0 S`K0 p@PC@0 :PT0 0P00L00$T >Z  xq 8b v3b1bЍ00D R00S 0S L0X#3pvpP 0 Iq똰E}Edd >~0 EG[peP`EdE`cdt!,y8-@-,, ($ +Ѝ0@-P@`$0 0 K 0 00`Ѝp@- Ѝ0@-pP@`M,0 0|(. 0 00`Ѝ@- Ѝ0-@-00e  ;Ѝ Ѝ/0p@-Pj@jpt!,@-+7@- @}-B$h6XPU |% G00h@PU l%T  G00000S$$ɹ Ѝ0m,`F{,!,x &O-DAM@PP4q@ &@  ᆧ@}Pࠟ   PGGAߍ`V ~ R`PX Y  ^ =R@V@0 `xAUx &k 1@-t0O-MM 0p@]|`P2 VPP* P RP 0S0 0  - * LPPӆP 0 Q0 0KPyۍЍ?0P 0 50  0{5  B' ,00S/ 0P F@-,{,,@-TP }P <y)Ae(]"P@`FB' A-@M @0S0{O%P,  u0S#w|P  b0Sl Y0] )PeRB@PaD'D*KB^&(ЍP@R<I}P(P'20S JAP'.Ap 0$!P<} X $P 0)AT PPP AP p`PP 0q+Q Sp 06&V`T(p`AT-@p0T-:W?-Q  R@4Q p0Q  R@7AP `003/P 00  h0S  R l 10!@AP<|,,y,@-MM+@(Mw+(wB+(DwB+w(Y@PލЍBP@P 0 T @@@@@ @@@@/%'B(-?NB -MM+ w+L v+ w+0v @P  ?ۍЍNB 0@-@M Ĉ1@@##P @! qP A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*@P3EP/[P+W@P'@P# 0P{ P;{  0S 0_ Z(P @P4o0m(&)}*00<|,,aU`8-4-@-@M B0@@2?t#P* @@  qP 00*!R00$Q 3*@P  |0S 0` 'P%(6*Ѝ<|,,O-`M!  0X#*0S ` 0 SS 0{p0 S00C `@{0 S:2PP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@ U T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 Qu$&7@-@ PU c! {zC00 Ѝ0ll P X K!L  {A2( 0$[){,k{ Qp@-P @<00S   0 p@5 0@{,m,7@-@ NPU ! {&C00 Ѝ0PP | {{d00S L 0H[0 ,{m,z,UR x &s@-8Q`@a9igWy _c|__cx _c35cQ_5ye 0 Aj@Pxx 84mP C@?^^ σoyЍp4-x &O--{MpP`} 0p F 0S  P R ; 0S  됵P z뀥P zlp@T PeVT D;RJ0B? 0H*P "'B@P "B00 PP; P  l~; C;0S ?;[P ;; 4 s00x4"0{ߍ4[3 ,v0z"!`׋؋ 031,0l0,0L,0   L 0P600Pz?"!!0 #  PV  YP*U l @2 0S h2P <f0S hPU ]NL P0  FT 0  SR qo1P y 1 T 0I2 _z?0YC0P0SP @ 0V0 R0SQ xy0S/ jP ]wk  PS 2  {,H%ptbt@f@m,{,aCURo,U!/g,qxl0@-0,MP0 00 0\PPP@P DD@0Q ,B,Ѝ0@"4 L%x &m, -O-piMs?!0 WP 00iߍOЍ/lx5@PX1P L!L00#@P jZ` ~PPW0FSV030#Z0S 00W"h@!` P Pp0W0R@U80P , 00$P$m,h -O-p0MT@X   p$p) `V X @M'U` vPPvP@P c;H E0TPU 0'SP0U*S/ ᏇP Ju [ v0@ 0 0H0 =zP11Z 3 r0 p`PUQR ( <2S022SP0220C2   S`` v$00 00( 0p|xW  @0   (PU bb(c0U 2 J\W 0X0C?o20S \`$\`b}v@0Uk[[rv00CS0000?R0U 2Y$0S  r5S2fUvi 0%S @SJ B* BނD0 0t/00L 0.RP 0 0-PH00Zp@P 0A0 0X33 4Q5eSv00X (Sb@ 0U \bvz  0UX ~_v[`uk R :PP4W  \.WK0ЍO Ѝ/b* ht@4- &x-0@-CMl-PP 0S .QYu@P 4xpCߍ0 Pqp !,",G-p@ 堀堐PB`AT:00Z W ,/Z 000 %uP EQ 0 @4$&A-`Pp p@  ,p&p  Pf @#,A-Pu@uopl p0S DQ0Q.SP @$ $o o!,, ",@-M 00PDP 9  o 0PDP +  o J p@ ( ⛁ o i P Ux@&  o```p @&PPЍ vo ro`!i%,%i%,#,8i(%,{O-8MXd0 @+oT400)t0 ,+P40,   -8 4d0 w=C$ CTr ZP, 0.̟ Q(]?P 00 ( 0 0uPPPPP9@<,`0tD0D,Dq,w b\<I /  0p>0a Xvn |+PP\  v+PP;U 1sS 1lS;"000 PXP p@ v g! HcdH Qp0PKP[P{1@+0~( |P |P  |P |P |P |P |P0:4: @p A*0p 0HA;qp H0Sp:K10d*dLBP 0H0 H0A#qp ( AP/PH , $U t WPPP@;C|P@- , n)0xU)0wP-|P\8 0\8UXDy0 y>T. ()0z7;|@PEPS#PN X0 !\6SE p0 5@P: <5 |tl ` [7S'  H@8;(7@ P 0(A<AP\XP@Ps:4S 0 zP 0'APplP 6H'X0b@Pal\804'8\8P$W 8Om8 %rP0&08P 8=m8 rP0060&S\880\8P 8%m80S \&8P 8m8 qP000S\80\8U*P0S\80\8P@sT %0}B\8%0|:5T$A Q0:$R$ Q9ğP \0şW|t^H4   2E4SP  0@?S @P l4{ 0Q0:$R##TğR#$R#W%HR $ 3   Ts0S1 T`P 2@T QMHH#00S "0S 4#tr:3S3 TE 4"eP0  0@F0@P\dP$A?Sp@Px080Ca@,0,P pT0S ,q X >0S@0 <X+4AS< ". 0 0S DpDW5S x!!o0 0S $pcXnrXz!,Mm,kx &$&l%D #,,?;B' i%,C} p #, l",%,&,',/30NYep!&, &,&,%,%,"?J),YyP 01/p 0C-鿏P@,MpyP3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ ߍ3:B@-p`CM|@5yPlP#d0RXPP @ W<0080 `0(PCߍ0Oq,,S ,@-@ @`|,@-0  0 P @0@ @28 0/P $  h Ѝ䘂, o,z, 0@-0@XMP0  0@ P x x0 t0Ep@2P0/Q   LL =  2 0/R@, ,@3 Ѝ0!, ,`|,o,, x,-MM(TPxP  lj hj0 00SލЍ\0\ \VP L0 (0< 0,  q,l,p,x,m,,j,@-RCMX6S 6P \8lP XT20S H)2\6S 8$2020" (\2`Pr\8. q^10 ^[:4S !TQ\@i10 H:4!SO *00 0 B=p:tt$2@P) P1d 0T-L*<'0S ,!, $!$0S   7 gP\6S V 7@pCߍ 0 B!,~, &,#,#,^jC%,%,03","%,:zU>&,K@-@T^ S C @TR00S\0\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/ 0\ P0//!01000/ 00#0//O-`$MPA@T m p%P00 0S 0S0S$ЍP P00 S vS, R ,0S R : 8 80R:P#3///@-@MP Mp! *0 `p Wd5\\ SS=S 8 d3R 0 ,e0 `ڍ ЍTTQe@-`QM p@ ⟗P PP PЍmvPTP0 p3P@$U@@T @ @0 @(Ps .O-Pp0@0Mw'DPP /`ĐĠ0 R PЍ 0L03/P 0 t놁0 t  @$0S P @g @g`8|,p@-P`40@0S 0 p@n(@-0MQ!p0`L0 3/P< 0t@T 4/@0p0 |t 0wt 0@=$0S @[g$0 @VgT `@Pg @Lg@l0S0C@ ,$@ (Ѝ8|,  0S/p@-P@I 0000p@O-p@P|M Y0P,0+`,P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p`s`P 1,0000U/0 0L1<00 00QpP ,0<<0@D)@0S P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0  @-Z P 0P 0Pp PQ` QT{PQH "P <080P/,/(// TsKp@-8@Q0@P@DPp ]-Pp%p@-P@P  ef 1f00pp@-  p%@- { p%G-@PzMP N/x 1S FoP j?,%0`J?@`p̠( p$   $0t Y 4 P 3SG `t w w00? (̀pܐ0AP 0S0)#0C?o27 #3RR  0R6p7P 'SzzH0pA(\ CF QJ N`8P P4P @dP  ,0!4!PßF0#pXj2P  @000@0"0N?P0'SzzpH0AR 0 B Q  z? 0 0B,0!4!PŸ刀0#P0!pJ vIR v00I? 0011F10100 d84p1P8( s1S%4p ∠0!i 0Ad 0_ ,0!!0#P 0 ex ,0!!P0#0h pRe  &}DE*,QNEFXR0$&'Q`@-PM`p PP 0Rcp @P  xPP 0Ecp P@PQ 7/PЍ  @-0 0P Ѝ @-0 0PЍX O-aM,MQ 0`aݍ,Ѝ@PP WrPK pRrP0 QpL4PpUu80$P 00S 3/p0$Qrbb>0Eo`YG_FPE$rP 0000!*9PP 00S 3/pO003/No,P4rP (S("+"c b+bc`hP@``VBaV>+"c+b|c3\QQ0QUh $P 00S 3/p $QUY ` p0 `` pxb.;8/ 0 ``px`;".6/0S3   =c ic0 0ky`PxqxxU" b +`P  P]]P"u+"cbn+ "`P eqP# `qP [qP VqP QqP LqP VxT b  b` (yPB' ,,s 58 00A-p$[?p@` PAP0 @ p> C 01/@P00pЍpP@00003/003/$AO-PUMM.`h,@4Pt.ztQ` x(fEgS`V`(0$S^ 0(0(UݍЍT   70.07 00P00@P#Ppύ`40z(Y^ 4S =$7h400C27\4=1 V =6h400C26\4=1 0 00  000000pp`h , =0440a40s -1yv0 00 00000 0zfp` 0440?40s -1ଔV3 `v00. dpE "a`5@0[^ =2XL=1pP0Nόgph \  pv00$? 000,0(0S00Ӧ?$N?@/&#`@`T,0(04@S0S N?/$$44pW(4 0}10  A a "a a4!0p  1$,01(L!!,H48> C6$1^(1)0!4 $,10 (q,1 48qH!L$Q p{ \x^v #Ÿ@p#0Ÿ$1H0 0$4;ux2P p>ؠC\ $100$10 0: |0G80 ,! 06$H,@IS  GPp<PL ;JSH 0.$10B04!8C0(1}1S0}1$1S `4@@<|,4- &D YW%,,q,@|,0m,B^PP$030/0@o//BO-@P MMA E0*!Rp0)Q`U0 $0   P q Pp ,^*'0$0 |$(pP d4\,H ܍Ѝp 84"a0Spp0 @0 4p0SW00_ , R\  000x;8,9/PI 0  x8;,;/ 0 x8;,9/T08SS0CS񟗕    `        Sn "Se S P0~  R{ <p_Wv  &P d0S P"8iH8  8Rd0S $"8[\0S  "T8"`0S !J8X0S! S! 80L0@ \Q\0S ` R !8*x8 ̎lQlhƎ`Q`\TQTP⺎HQHX @1R<0Q0}P00P0)0YP0 U @& 'pPv 0Q  c, eB' &  58 #*1%Ut8QWjr||<|,O-UM0M*a8V"e&H'@u& pepT pW l&0 T0T !Q ,qލЍ7 )qWd ^P FP' P ! @P @p`H吴 XBGT0SXd \ T 0S 0$< 0P00,0P FaP14s10#5:# /&-&+&0S &&$& ,e lP0@DPD@ pe `V  L `p80  P 0 0 ,0ST0 S00 P0p800SS 04  0x; 8:/P00400ST0(pp S S x T T T T T p < Sc  SV 0 <04lP<0PL!@  PP ,0$  40|( P0 { 01PT $kP 0045S0+4^]14  u0 S r0 jM%԰ 0Ȱ 0,m,#?0|,XqM gÀB' 0 )rO-@AMT MXp P`L  @P`T $P```PP@Aލ Ѝԃ<̓C̳ @23 (4@$80*DP@<@T@X P \430$3 00 2 $02(408@Y }P 딢娂  t208@d2@DDAT P2P"PPm#P <2 8%PI,2 $ *20)ATp !0` XP&!2%0 Z@0S q#P 0St H0@4 000@0x;8 8/P6  %P !d%@P 0  zp @$$0 ,@pW:p@( %4 g"FX^p m۶< pm,,& 0a0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  PB*,,, $0@-@"!P(@*,@-$@2S 02*,O- @P@B`P@   PP@ `@p0Ec#రPU*[ ЍI 5P  5P @BI    R0S ep$&@-@00 YP Q P 0u\Ѝ C-`PJMM⼂```p 8Om@4PT_H(PeP8_ Yo`GFWI iP 0 000!00P < 8<1P#<@XNo<0S0 0< 8`PV 40,0&= 01@01A0000 h@@@@z,Y@0S7 0S(8JݍЍATkP0 8`$!QQ@0RT<0P 0 003/@#S0 S(0S 0S8s(0S003/@#S@ꈁ,P H% 0S/p@-@P`!a(0S  R 0Q003/@Qp@C@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> ho 0@o/b0 !!/1,10/yhp@-@4P0 `@Z1111p1,O-P@p`ԐԠ԰0/ C !  !0  Pk00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ1,8  0@-P@M/.k1, 00 0d0@00 0T0@@@@1 0 000@%P,pߍ0 1,O-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  Y0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- 0R 0  DQHa@1QRpB   !LAPAP)0 \A0Q     TTAU @@1,t"O-`BpX1MSL2X\1S,2V\X1S \QUЍ0C`1`1S\` ^1PS \1 XX1! 0`1V$ 1x C H0C 0~aP 0 S 0.S  Xcp `Z!XP Y0X`0 0YX"j\pP \!j000: SX1x 2 \1` 0 0 X1 ` SX10 2 $ efX1,x% 1,T  ` B' p@-MMPdPoۍЍpvP@`+qX P*+p;X P*+5X P*P0PŴtB' p@-Mu&q@l(bII`P5 g<0 0.] P (J5(J g6!] <F@P Tލp_+az,H   @-X@01SP@0S01S0  1,  O-p@MTP! c0  ~ 0z`尢Y p` 0 0dP0SߍP X%]P0lP0 a0CS0S  BPU`08Sڠ0S( R% S]0  0 a00, p 0d1劅00 0s0Z+ 8p P` M10P!h!R( 00@(O  00O0 0S* ?0!C  0 00t00 00S 0wUa0 4Jc& d@edAh2,n1, C-L1 @1 R0   A h9'Q   R 0<1LPDTPapH[LP [U `1DP1 [U `1TP1 [UP1 `1[Up!00, pm@ ЍC K Q 1,t 0"@-M@ 8P @oЍ@-| 0S lP \0 T0T 0PP0>L004 80<7( Ѝ Ѝ|,t,q, , p,x,@-p@Mp9t)0 0 0T00.00 06Up $0t !Ѝ1, p@-Lf6@0P H[p@˅-?@-P @ n R ,0$@+Ѝ0@ Ѝ/@-0  0P P L0L L@ 0< <@0 $@Ѝ蘂, o, ,x,-3M M T?P0  4dP do3ݍ ЍB' rY-3M M ?P3ݍ ЍB' 00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD\@00( (0P,T@|,Ă,,n,q, ,p,x,@-0  0 P <08 04408000 0 1Ѝq,,n,p,x,0$ 0!S/ / 2,0$ 0 S/ / 2, 0( 0S0 10 1/ 2,1,11<0@ Q !@-0 " !/1,0 10 1/1,@-Mk/.g, 0l0d 060 P000@ 0h@,Fߍ|% 1,0D D /Q/QQ Q/1,|%@-@0@ 0 0WPЍ@- @0S00,,0@-pAMrhPN @T  P<04Px9J/Y0Aߍ0C1,?RL,@-P@ [ 0P  T Ѝ{,-@-   Ѝ Ѝ/-@-\0X0@P D  "Ѝ@Ѝ/[h-@-\0X0@P D  "Ѝ@Ѝ/[@-4P P P@-@EYP@ *.orj@-4@^bP 0 P q,p,y,@-4@JbP 0 P ,x,z,QA-@@1@#PP1P#Ttpt` ^P t u`|y>>66XAX4-z,7@-@(P @f 0 Ѝ0 x &0@-EM  P@ S XP0000U ($$0x:@Eߍ0L,V1,@-pM?hA SXH1^ P0x ,!6 l)1f<X 0P H ` p 0000`0 0PP`P@ fߍpb020 fx:X JP (KS((J9 1,L, | N  x%u C@-@P !0`Rxz^aP &PP xZP`h 1  T (01I@0PX@T 5X Ѝ1,-x%@-@<0@- 0) Ѝ0@- 0 Ѝ@-0@M00  0 Ѝp@-P<@0/SpQ `Pp@|%@- 0P蜂,q,O-$M@p`P 0 P( 0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ$Ѝ x0m, {, ,o, fO--,M`aW$3W@pq[pPd $&WP@cdT00S@ h@WPPEUM T1T!TTb$00  @v$0VSS00Y00S "W 0 C H C$V0 0$0  0 U$ VRR   P # 2R @D d0@QV `P$ V@,Ѝ  A-`pP.@P!c fPP 6/UARpO-@ M$V`P Ѝp0P 0`0 VSSTP$wV-@- 00Ѝ Ѝ/h -@- 00Ѝ Ѝ/᐀ A-pp3`PMMP` pSp@u!D FV '(($$cp&  0Su 0CS2PJ{S0)  0z 0S8 0S r0S 0S QN@|^P$ 0 \0 L@nD2P 00b0C?o270 㧏0<(GA0SލЍ!7S*_P1Q! F?p@Fod!H1PI0 D 0L$'  0S q0Sv 0Sr 0So QN@P  0g0 @PYF? Q. QFHmo" 1 M @ P,nX  @|,Ă,   ',x%O0 k,m,   -MM P  P  uۍЍ -MM P  P  `ۍЍ s@-cP' P_P L%P0S * p* x* * Pu @D`EP Jv@TT0Ѝp,  x0|+R/ @-d|+\0XT0PL0HD0@<08}401,, (,4 T,> ,, P,X H,rX,P@-@ -'@0Tz,p@-@M L(@H@a0 #,0H ,0@@0N@h\Pp0: S H P O O܍p,a 8aQ @P@Pڰa <T@@O8 1!``|8 <(DQi T1 08808PP oQ P00S nw < R t00 00000 00l0p@ m(t(0S!q,2O,p,x,<, H ' |,,<,D O- 0CMSP0q `@e0!`0/0`SPW!000 @ @3/@P CߍW! 000Z 0SX 0 @mT W  00 0  0S l00S \  P0W0 ! !  000ꘂ,o,b0,Y   , 1,7@-PQ@0 SS 8A0 000] Ѝ02S    B' O-(UMp !4Q   M`#ß0/SCP3c0ЃC0P/UEB# 0SPHW|C1 dQ` PLP$ 0RP KP 5C^ 0 10S 0S6 0 1S20S lP`F $l2l"C0 SP!0 a40 0) 0R RP 10 1000`zRP 1R QA  1S Q00R /RSR UߍP 1 0000$0000 Q1 PP 1 8T1 .P  {, 0,|%1,  B'     K 8-4-,  $ +]    p@-Ph`@TU^pUP`IP  Up4%O-`MMp`` `T |PP0P  6,@ڍЍ n|P f|P A/PUPP 7/P@x0@P87?D @ \{0Q P0=S`  8 ⡰PV 5P 0P  GꈠlP@ PP0@0;9 7~[2] u #A/10p@-4 P@g^0 Pp@@-G-`P4 T^@T$ `V! p0F&04 p0RSP pPp Pp40Su p |^Pp@T/0 R/@-`p0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ P]P  p@C@-@ (@A-P@p`p0S 0pp RA05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-8pЍPƽ@Ľ` {p Ҿmp ɾ þ 0<`VQ Գt@ lAP\AP L=P @忳T  &}DE0 R p@-PMM`; p  @p i^Pe^PۍЍpA-@P  ]pP` P  0QP|d zd@@-PM Mp;P `T p  @0PQPMU^Pۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP\00/00/40@-\80S0 S0010\80S  0\\@!SR0(SS QU S!0$0S\  0 1Sp@- l@$\ 0P!QS:pQQ   P \ Q0\" 0 ,04S008 0803/P,000403/,, H0 , 4 T 8 X  40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 Br Rt01 408 00803/P,000403/,, H0 , 4 T 8 X  000/O-0@p 4MAPPp`204ЍO$0 L03/P$ Ѐ0 \ p!D@ Z["H* 0*P T P , [p [8``pp 0S:0P 004Ѝ0ꌁ,O-P@4`崁崑崡 Q 1SQ " 010 r 2 R  R V V $R RR 0S 1R",0S 0S0 0 0S 0`0 K3/P p  0!"0 0  `0RPH P00P0 < Q Q  Q R DR V ~ ? S @ @ O-0c(0M<00PSp@p`00 $ 80s!3r 0Uh0@l0hS@3` 0H@  83R0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0D00t2 p0 0UHL0  U00(, 00 0UP23U 4|0p0P<0SOP0 L T00SH0Sh000q p0 j0 ^0 000000  T0 S0 00000PX 00808/hM0 PpQXQ Q(00,0p 0#^p a X0S l^ 0$0p0 0(00,0  0#4p= 0C,8|,z C, 0 C-F`0pSPlM^tM0SXM0 S M0S L0SL0SGL0SHL0SIL0SJL0SL0ShL0SaL0S000$ R(000 "0A W(40S  0$S $SS $S)400 0$4 0rT0D( iL0SP4 PQQ008Q00S (4Q (4 $lЍC!W2W/M 4N tN M P Qb Q90 L3003 0,T0 lЍ\300T3 0T0 0HS(0p`@  0 SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@0 8", P0 k R>0 H0L0 }H0L0 vH0L0 oH0L0 hH0L0 haH0L0  PZH0L0@ 8SH0L0U lЍCJ!SH000050PpG0  d 9/ 000(0W0C,~DR ~ V y,8|,0   @ ? @ b  b T      " . 6 > C S C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``M0 0pp07/@-M0@ 03/P 0 004000 .003/ލ@-`,MHP E@0 0 0PP@00 RS THP pW TP00P00P0,Ѝ @T@0/W/0  0EH P00P0$&0@-$M@D0X Q 0P 00 00,0PH0Dd$Ѝ0 G-%p(M@PV `c\a `T^`ZP08 ,`SS0 Q "S `P  P !X$U02$U ` 0 V0 00 00 0% 0MPPi(ЍPA  L l W @ C-40PS,M80S,ЍS S S !S S a@P `p䐟`M`X 0 000 00x 000 0 00 0 0M&`Pp[T B HU xB O-P@0p(AMP U   唂  `1#0 !(p0#UP 4sP D00 P iP XD0a0P0\[@!kV 0` 0 @ABJA0  0x!C@ @0  P!-6 P0  (!D,`)pNIP@!@3P@GIT -` VT@D@`0@@< 0 0K-U0 0@`0P ت.h 00@p `DAߍ #"0P0RPP0y,C,  O--l5AM0DpP$kPL >@F`PB X,@0D ,`0S40  ,0 ñXT,  0$ p0pC 0$<0@0 0R80D <0 80 0S `42@@00]? 04@A00 00@@@6!0S8HP 0P40 0H03/0S,0@ p p0C @@0D @000`ŋpH0SOpP pv0,01v0(pp1@P !r B B@2"A$00v=  R B l="U U0 R80p@n0 R#,500y6000AߍD0` ⇑0L0 3/ 00`0:x  Q * Bq Bq BQ B` B  0FT 0@ X@@p0 0,(0 @@@@@ p@@0`PUߍ 06'0 pD`∀? 00*80A-0<0@SH04 `pPOV09O?V090VP:0Ab!q0S/A-@P0\03/0 0    `0V R!  B B" <10C)Rp0!P! 0 `PPp !@` B";000>000$0 01P0100AUk O-P@OM H(Sa1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,pP5Oߍş[@P TşT0@0C0p0NC2 VH0 0$ 0 R̴ V 80L0TX 3/P10 00H03/ 0T 0000 3/P#%#& 00t80x 3/0lPp 'S̍X 0 0|30t3700F00, @@x 01 SH0 V p .4tG` PP00P00X00 3/088q0X 0L03/l 0 , t T x X h H !0T`X 006/P `0d Q 10  0!s"D  V p0 B:D!2 B":1ᴡ0C100C0 R `V`s`V T00 03/P0 0D 2#4`0Z5  P0a 0` 0d0  p D00Cv:D!2 B"l:10C10 0?o2100C0= !V ꌁ, DR @ K E A-Pp`@f!0P  p0Q p7:p Q`P !@ B"!: QT0 01`0(`10q0000x d 0S/ LP0 05/0P0 8p<  @  L 0P4 P p $ Q:  BS:Aߍ L`0 (06/P(0d 8< ` @]0`4 V  V  R U  U  RC $A0  ( TL( P0 MLp ,( ( ,0P 0 pP`p0  4L 0P@-Lp`P\ p `P@0` O-0@AM8|,y, O-@`4M0P\03/0 X ĀX p ppoP(V 0 Y2 2 Z "00 .  !" 0 1 " X e/  !"0 n/ 0 " 0 ]/  C" 0CCW p2p"ppO0E0 0X20P2J00D 004P<1,pp@12(K(4Ѝ嗓)08q P ,0LP,0ZH D00w0s 0P P`%0,00幽0P8 @ 0S[00S[ ZP P00S`(0,(00V,0030/ 0X3/`d D,k ,S [ C  lW F X rC,B' @-@P0`LP/TP0S0B' O-pMCO TUtd4{ 00 rs= 8b0  * 0z P  0@0 B )R RPQ0R r Q0CFS0TR000US00Ѝ@0  ||PT00U00X@0 \%D1R4 !8R0 !R, R-RH T00U0(B@ PP 0R 0R [X T00U00} [XxT00U 000/SS< D,i?E,D D,0T8 Tpm,E, 8TH,B' O-0MS@pأЍ`  W0 @00PS8 cSG MS  0 mS  sS. gSR  0J 0S cS !MS @MSCS GS +0C?oW20S 000 00SSSR mS @ R O-OM M P#0 P0P<0@0@0M0P(0` 0H03/40080 00!6 0R 0  0(3/ 0Ps`` r S00 D&008&XoU\a`v0$0000s0,00$0%_p`0(`HpD0WX0h05R0lp0h ; `pV Svh 2`U Tnh *PUhh $VU 00 0$PTk 씟0P`040dPS800O>0=C0D0 0@I$xU 0S  T0Pk0 000D0P0 F0sPT0S xmJP 0S00Q00`Q0S 0L0 aA3/P 0Ȁ`0` 0&003/`Pdp0E0  7#`@0o?HX` X 0 [0R0 `<0@ 000< R@  0S8X( a`v0"$0$0,0- 0,0$0&$0x D傾 0H 0xdy0  0H 00l 0HȐ 0 bx0h00l010h Ht0pE+Dt;+ p;L -L0` S*pV 0 TjU 00 0\Tj0 4TjT0P0'$0, Q030#Q0S $0( A(02`Fpp 0 `&?00`P3/0A` ``Q/V*P[0H X 0A48`T(Oލ Ѝ8|,M R W y,] dp  Xwm ` @-@! 0$   0 P 0"ġ0S 0$ O-Mp @$ P(`|1/0@T 0P5P[0ZP0   0G @p0G@Tp UZ@p 0 G X00,8000P<00ͱT0,%000008@VK00 ЍQKpP#0S  >W 1 X @PP  4៿ >m,{, Ux & @-@ @0 @-@P@@-M@  7  7 <܍ 0@-MP@q  7k  7 =0TsP <ߍ0 @-@R@A-pP<`@P P  I0! 0PP %Ѝ0$D  d,p@-@P4Sp@Tp$ @Pp Dpd, G-pt`DTP EPP@ 0 0^PP$0R04d, A-TP4SAp`4㟽@ 4 0?7 ;7 Dd,A-@4S0tp4TU TU T`040  ᭾0 4᥾d, p@-@P0 p@p@-@PG@ Vop    @-o@-o@-o 0P/d,0@-PM  0xPP5 @  0PPP5@LP,FP0Ѝ0@B 2 ? i,@-G@hA-A0J?`V=p$X"0 :PPЍ p> C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a,$0pQ@-4去㈵ #"T R0//s@-(@T@ЍpH0P0 0003/@Pwa[/@-tM`P @P0 p@@"P  20@Tp@tЍT0 @T|0t dl0l p k`P L sꘂ,S B' \ k i, e  pm,  /@-o /@, ^///@-0@Q T@o?0 \ 0P000@-P4M0 kGT0@T   0V @P 0>@TPT0@P0 0 00000 0 T0$000R0#02S4Ѝ; 0 0 0S  R# S   @ 0  00PV@00V @P 0`>@TPT0@P RK RH RE (  , ZQ R Z5 TT  Z! 0 S0 0@PV00V @P 0!>@TPT0@P 0T00@PT Q Q0   .0@-4MP!! 0  P P"P@4Ѝ0@/@-@  @薸W p@-P@/FP `@ H0P P `Ra BQQ pQQ 0@S:p @-H∲0RH #@-00@-P@04MS!1PP Q*   P +U 0@S Q 0S4Ѝ0d,0p@-@ ^T00PUPU' \$ST [p 2@Q.^U@P@ @$ $ 0 00C 0p0 g }p@-,@P%B0P ;pA-@p```P匀0ST 0@P"Rp@P @i, 00S@- /@i,i,C-麋X@(p,P0`$ 0АYĐY T  T: X0WaU|U VP P 0U Ѝ /V0   ch@-@P 0  @g@d+ q  p@-P@0S|T0p 0 Tsp0"S @0<00Rp( T4p0 @i,\,`,G-lP0`Sp@;S S 2@1+1:X ip  QBp\T.@T&RQ0000(Q $=p Q 0S T vZ/ 0@1 00 0TRT0T"1d,zp@-P@q@op1O-0@Sp`P 0 PQQQS SK0UȰС0r 0 $^0 0"90(Q $<p0, 1QX#  E vQ 0.0  R [ R pR H0H H? R# Ѝ 0W1Q:P @i, p@-P@P0St!U 0E p(0"PE0U055403 0(2#p@i,\,`,40@-0@SZDP0@0ӕ@i, A-AP0`SH!U 0E p0耟@SV Ѝ 4 U(@0+`P `4p00 0@0>@Pp0P H p> `00 P0'p(0,0`@i,`,\, rA 1A-0PSp@` 0 PQQL SD0 @ 2r 0 !Rv?000  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` @i,E@- @⋐00S T 峲Ѝ2sO-X0MSM2">\0@S2"`0Sb2|"d0S2d"|h0Sl2H"hH -0S@ů80S 8( SRM80S ;, 70pHPASTPPDP, @&@N`P- @ \00`0d .0xh X hd;S XH!H@0LP@_oRݍЍ 0:S 000a 1 0 0 0 0C0 {;0CS||tPpI  a z   $&   , = o  H ` E xp@-XP@0S!R+)r00 S @ 0N Dpd,O--BM MpX\,@P 0`^ ;`( pPBލ ЍD0 aPD  Q 0 0 d!`ppt0 $0!`4X00 (00Cv$0;S P |出PW +RQ 0P \P SD0Rpʩ0S S 00S 00 0`S0S00000000 0 #P 0S  @, 0 R$ ?! 0$ S0S 0$ jedA O-$6#Sp 0 8P` ;#S08p0 d00\ `0h0x00X P$`P`l0 (04H⊭000 00 00p; @-`X0Sg0 <\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP S &0c ЍI a z O-0TM00 0$ 400 ,00(0 0800P! 0` @@{P$0SUppФ Q 0U U H0!<01PRPp28PUp<0L @P PUDp p0S H0L HLPp00D S400@00P4p S 0  S PS p0S2 ;S S 21+1:$0S L$0,  QB\X<X4RQ2ȠP,$0)$0(Q $8p(0 S ! 0S H (v*80ƀ1 0$ 0 0 0S0 0S 0$ TЍXRX0H"1d,zO-P0M@DTЍp`ȠȰ@D0S W0@  0 0 `P1/Y  S      Q R  0@0Q0 0`Pp1/P l, A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-~@P`p1S 3/P @`VTd0@@gT0P0S@000S4000S(0000A話 h,l, x!p@-@4`4P0Sp@虱10S 3/@l,h,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp `^$ 4R R0 0`40$ Rp `083/< 0 2 P   ` 000 0S0\000 00//00/00/00/10/Q@-@@ 0A0003/P@$H @ C-B`0SPEM;01W.0pS)O.0 S|! G.0Sd@.0S 9.0S0 2.0S+.0S00$ R!000V F 3 9 &>0!C> f`!(0 010@0`0dj,8|, O-PM0@0` P(" ެ `b0  \00 04p!0@0 04!00p@嶬 r@Ubxxp,@g㧬 0 L!nH垬 @p0 $!d$唬!p 0[`P0 R t' Pp'Ѝ 0p!s0i `; `\'OT 0-00@p NR S3#:@`00y,8|,  j,  Ik,d A-@0`\03/ pPW@@P@ᲭP< 0쀟DW  \-W0 U  .  ! 0 n/ 0 00$ 1 x    ]/  C\  0SJCT H0H HH70B@@ qj,P p @  y+ s@-P,`@啮01Ѝpj,p@-0(M0P,03/`J0@ S:0 00 0 0 0 ,p` 0A0s^(Ѝp0 O--PM4,@1PЍ cpP 0p @r @< u8 PZ0H03/0S@`G@`@0 0`P p" 0 Q!d2A 2]? 00000008"  0$0垥 0S("0 L0P 3/P X0P@T`@\0`0 S8墬PZ 80S ,1 0, S001{40P ∡0L0 3/00 P0 S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV i$P2Q obЍ>P00SZ 3/@@OoBS l@0&0010@!Rt!@!x@|@pPpt@t0S|0X*@JP PQ 0!@x 0T:x0S@ ,t@OoB@|0xT: @,j + <|,j, R@ 008\ l h,| @e P m, >O-UM< SD [/080<44@`᧧P ᢧpPԨ Uߍᗧ0P00 P,QŨ3, 040S 0R@ <0S6(1SL0L ,H!0L\." C 4<#H@; $I 0@P⫣P @T "2B 00P 0S 3/P,00,02, 0SU@`PD`D@t w X2R嬥 Y8N $墥 ,H!!LPH@0#`P`T@厥P J` %@ %,%,00 0040ץ @Ƣ %   , 廢 %, Ⲣ%40P1: 1 !  =1V @0 000000 0000 00㻢p` D◟D0U0 Q[T Y ߧ0ݧv `ԧh,l,0o mn + O-/0@JM M`0]PP+% P) 0S% 0l"`!`\r\/50P T  0CT *0C/Q 00P3@:m+ P: 3?0  {P+0: S `V2>00ꨰ  PJ>0@0/SF 0s+  S ԻP+  P*P 0/S`0oo`bS $p$0&000 SV+tf P*+` P*ϻP2@ͺ2@]ȺJލ Ѝ,   B' @-x/)@-M @P(0  㖺@P ዺ P Ѝ螺P:00p R O-M` "PPp X`p㴠崰'Pd Ѝ0S @ P0  wNpLoP Xp0  @墦  p G-|M `P`P PP<+⃻@P@ 0 @ >ka@PX+JQJ.0ˬI+JBJ.0T㼬T:X 㵬PP~D14 ᬬPPu$F+J"0J.ᜬPPe6+J J?`  ᅬPPN+J|tpll40 0J>P 0 .fP UT aލݺP@Y+JMJܺPPp0J.A@+9 6P h lJ>/PR        ; h G Z g x w % *  %  / /00/00/00/00/0@-0@4M#|0$P 0*P\ ᗾP0T0670 P }@P j4Ѝ08|,dy,k,O-AMAd2,00 (0B0P0, (00 000> 80s$0(0, `pX05 0*%500%`L0$0 0$0S000]d5\` @@`Ĝ@0S 80< 03/P0p80<P Ѝpv'80s Ф 0Q:8`0S0L0` 3/P  &[Z T0 SW`vp 0 D 0$`0$00  0 0 0#3P00 0`0000 0卢$0Sr Dޢ#D Ra @Z%R[eP*%0B?o 2 0; H 2/$0`SpHL I 2# V 0  0 )Y0 ; 0 P pX00 0  , (0  P   0S {(0, ;DQ0v1;0 H0$0L010,!<1H0$003 `*P Q    R P*P0 Z{[ 8 40*P40 Yp 0pY 8pB YP  P 0 0 ; ,(0\j Q r,00a8|,0< y,  $&, B' C-pQ|MW0PSSp`0 00 P  "  ("⿼ 0@T0 S>T2x@&L"@(⮼@@,0S:(٠(0"P⢼@P  00+0@080s=0 0( T nW|Ѝ#㳠!@&(z00T1 0(X!00  ! W00 40 00040(0$00(0 0$00c<#$‚0  0  0H3/P0`s 0R04$( $ R( 0  0H3/P* $ %P 0 0X 0T80,3/00T00X S \ $ ` ( d , ,0S P0 P  R0P0w 00040(0$00(0 0$00c<#$‚0  0  0H3/PP80sa 00^ Q Y 0 SV 0 SL0  3/P@D0 RP RP0{0 80X T,3/00T00X0 0\0 $0`0(0d0,00Sc 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQCPp`,0 0UB:8  0 0S pp$ $ 0 Q\pᢙ`P p0Pi"0R[p Z[ Yl:PpW00 U0#S~ p`Ѝ茀 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0P00 00 80sp8Hp0!8p 40X 00 0S 0P*p ` $80s0 L0 3/P 08400H0, 00,0+$0T00X0pPq 00 80sh p $Php@-@P(MI(0S(`,`v0 00P0F0 P P`0(PȔP,((P(Ѝp000圑, (0,`(P4- Rk,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X:@1\!S<1@100> C @ @lPp( ,L"#0B@0 '8:0' 30 W &%, ǖ0Ö80000, 0 @0嵖0屖80000  0':T0塖0H坖LH0P (P0#W0 000p8500 %  % %P,  (P 0 %<  ]? 000000 000 0f00Гpp 05P,0ᨐXpW) 0GSC0.(>P C$ 00S H @3/Wv@DpH L0] YZX03/ 0  05@0L0 3/P 00S 0SpW+ WP0pH03/ 0! P7/P%$%$)@0 Q1PYK @1003/Q  01/ 0S 2"!$Є  0;P  03 Hp0  @D@0 ᄀX80X> Pnm,0S pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000+,<|,0p408@ \ l h,| L @e B'    0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-Yp@P` 0< # 80s#   002!  0 S R( 0S%   吁( R Q0 2!T 0 < {+800 s"000S   h 1 SR0r01/@m,!0 /@m,$1p@-S@ x1SP $003/p@ x1 P$1 0SO-@0`PKMM0((0DpH0S >I @0!0 0<0o- %#{ 娻 KP@T8p]? 00 0 0U0000@00 @@@@0,⊑ppK܍Ѝ(bϑ(0S*< o #8 ;c&@@D O-`0@PMM,0d1d0p 0S (0 S> 9 H  00 0 <0.%#@~40kP`0V,p]? 0000000 0 0U000000 003p`ލЍ, x,0S*< #, 00A"X R00C0C0000S0 0,0A$P@m,D @-@- 0  !<$10(10,1P001.@-@r 0 0! 0O-,MTTpPP`0 R劾,Ѝ "P9 @@5/ДP`K A ` V`G2 7  0" ( 00 0墐`ဍؕ0,ЍO/@Z:p@-@Q-2223,3D3P 0 P40 P <0`p@PP80 P<,0 P(00 p& ' )*+p@-PBMH`@ْ   V3 484d4|440545H5p555P’ 0P幒 Bߍp`宒P00S0`壒40P`坒80PS<80  ,X0S(!Z@剒 0P偒\0 `0S D@ `pd0Ph0S 4@l0S *@xp0S@  @T`Lt0P] 9 :;Y=>' 1 ?.ABC@-PAMH`@2  Q V(d666$7L70D`qK0 @0S     8`V@ 0 P 0Aߍ(0S p ǭ#@,0S H 彭@@00S ( 峭@ ] . /.11 20@-AMP@0Q*7p889(9@9X9p99ő    q0`N 0S (0S    ,`V HzAߍ㡑    q0`N 0S (0S     { ,`VP偑 $0QPx 0 Pr0 Pl0 P\f0 PH`0 P4Z 0   5    60S O-@MV M=Pn 00x R# R0`^嬵嬅adDp80  @Q D0 P>  9PD  H    `V8p00(0S%ɬ$B 00,0S$⼬$B 0000S$⯬$B 0+ 0 p0B/Ppὠ C"U0S1 `F` Ì댣0p⇞ 0S    `,pYV o$ 8᪌0`֎ Ⓑ0`0"  "{ߍ@Î 0  0S  ℌ `pV 㮎 0  1 PS0N  L圎 0  0S @0S@华 ߍG\<0040!00L@0Fo$ 0DL03/00 Gppqr0S !02LD` 0S L  H p8` V0 a x Q0W 8 < RFO    0@ /-@* 0  e R0Wp 0    1  3   < %B P wX - @-x @+0 @0p0帐d, @律b @-D @000(0,0000壐d @婋ꐯk p@-XQ`0@sJM]/   061S:(H@HpHHHH Jߍp0 00@ @@0_(@0 (j0 0(0000 0(:>P(6>0P,@(P0@00%3.560p@-QPM,0$0`s@]/   0(֊$1 SIIIIJJ|JJJJJ 1$ 墇PЍp 0 ,♇,0S$0bP@0 00 000000 0x0=P0=LP@!^@8P@0P @00%@m,.O-P`00 2  0` 00 p80 I0G-pP@㴠崐(M0TP 0^ ^ 0S 0 @``P aV@(Ѝ@9 ,C-@4MT2P`p!PP 0 L0T3/P  Q000T0SX0`pS@, XT $0Sb S L L0S004Ѝ0CS@Df7#(`,0꼠,h30S/O-@SMP 000`#sX❥`P DD ‥<3P $ y  00 ,0 P0S* XZ'0 PP Tq 0 x0.0I1P/S X(̈́0(0 00`0SvU (G D0S `Pp 200!15:% p &P q Q 0, ($!p p $ P^ 00 8a4Q101T/T,,, 0 B' Z f  0S@0@-S@00 0S/ᠠ,0O-P̲EM 02@T PP0 2P |1S$ $P| 003/P `2P X y@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 刏pPP2@0S- $P* 0 x0D 0S,,, T,5,(,hؠ, A-$A0MT@ QP` 0p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T  @TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 ,,,(,ؠ,P,`,\0p@-T00P VDPPp0AS@  1SAGq,,,0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S"p,l0\ Q0/\P ^U Q0000@-p,0O-`GMM40X2@T]? 00 0 0V000000@@@@ 0h⨀p@c<  ! G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 t0@W 47 `4 }ፀ4 VH0 <0G, ,,Lꈁ,D @m,0@-PDM@T P08 @\ 0@  Dd  0 0DЍ00S@m,0@-@DMP/ P0, P\ 0P  0T   R X  0S0000000 0DЍ000S@m,p@-@Q`P@M<㭂@P   T0 0SP@Ѝp@0 @00 D0TU@Ѝp@m,17@-@SWvvwpwwww Ѝ0!m|P4Pc P<<0] P0<0V P0<0P P0<04PH P<0 S, 0<0= P<0 S@  0"7|080#1|0,0$+|00000vvvv@-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍpvHvv@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P h0 $< ` <UѺ z0$屼P 0|! 〬|Ѝ0,@-80@SP`4Mc00 0P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0E cg 0p@-PQ0M0@$ 0x`0 6/8 &`Px1簃x1a1S0C€10Ѝp p@-@P 0ӸP   Pp0S@}p P Pp0S 4! B! 嫸P  Pp0S h囸P R 0L ω 4ʉPpp. 5> hN 6\ q O-uM Mp, Z- H0cS_ C傫0SS}zB0S PBԒ0S~zIJB0Snz2 P     P x2@    PP2 HD     P6 0x0001 @@K @P @ PHPP< , h@ ,D@.1K 01R010|100P Pd0}p@  PʿeWz} 0S10$1S10 0Suݍ ЍfPaH_PkXPj1S |!R |)P  %@m,(,ؠ,T,,,,,P,`,,,,d,ܠ,D-A-,,_@-@ᦪ00S @PLjX, @-@PЍp$QU0 Y`P PP> C  01/P ,00 H$L Q>,80S @-0 U /3 m  G-`@Pጐ匠X0r2 S80S00 00S80S0|1 P S$1S00 0UOp@-8M`@8  * T P $Q$00S U 0 |1 08Ѝp`P P P Q ᒭ  P ϭ  ᖭP @m,A-M|P8  U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `p XEH2 08 8/PD? 0!! `b7#`00  3/P"#"#00 03/p p0` L03/U |✭` 0SWp`?`B414!44\ 0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv 0 |1 0?$ 3   @m,G-`RM@Xr PP 0P`  `QP P7  ӕp C 0S nzߍ<08 H(00,0 000040!04 04$0D0(0P YaWP  `嫕pJ @奕p  40k` 0    6R hR dR `R \R   Xp 0`?`a8S)Pb 0  0**0P0m  0* mGd@edAGzd@G<GGGGGA-PCMMPp`;8 طp@P  P0APГU 0 2 "0 CލЍ /O- p   5 R dh 0@-M 0p 0@S|( 0yPXwx0L @8͒8 P 0  ЍrSw! @-qq0SЍ@-@M qT0  CR$00S ЍvA-pP@0ST 0S` @PA J! @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0pdm,,08S^./,, p@-@ 0(  P0R0PS 00Smj ppC-@`PNMM< ЀuM0 ` P `P000 ;㩤@PD pNލЍ蠀 U6 ydG-xM` @pᜐ堠[P! |!0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   YZ( ( ᎅY `!  & i O-`p@BMMP/0;@ 0P0p@ X h;   *d P'  y BލЍ iP 0 0  d0/SX #l0H, l!14"So[ 1 SR 1S  RS1S1Sr`2pB@?↟0Q 10 STS "0SO[@jpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 000 " "io@ U01U01XOMURXA- 0MHd p1p!ppPHj@P( T00 0R`0 !?020!2002p304 pSkP0Ѝ" 0PS" $0Q00 L03/P Q P0Q    R D0QR003/H t! >,P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @P^U PP0 8^ @T :hP ` ` `b` ` p Sp` 2 q!aPaa j00`U08RP08}/ ^Q 0Sp`82S011111111108 r2aq40S0St  P P2S222I040UP 2SX;k O-bM M 00 QP $00/;0P0`bލ Ѝ$ kp y?`t00@ ,(Z 2S 1S(2("((h0@0 Ḁἰ  &      0S@p!?⪻D  0 deD U ; (aPVbV}T&PRQ 0 0 p  W p!p'q ?p? @p  W p!p'q??p0{g@P  pa?WU E ,(M pai?W U `d@3! Us@-RU0 @`d0T `Š"; P0H0`04 oЍp !   @-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0@.800 0",<< . 0,,O-P@dM0p4005Q 0 }Q Xg QP08B^  RW* 40'D0Q   R0RS 0}υ^ @^TX 0SQQY WvpdЍb004@F@  0-@TT0@ 0@4P SD 0`P P\ X 0`VBT`@00T04R21 SR8080<0 0Q<0$02ơ 028 02S01  (, ,(0 PH W2r`!R   R 2S SX 2Ƒ1 0 Y  ZW1Kt "QR 0S1!02#38P0WZ eV,0$ S 802o(0 0<pPD @0 Ă2Z02HY PY !h ኝL0S 1P0S`10T08<  01Z o 0]  RP   0SD0X X2 P H,  3!T !lO-@|M40H0X0(S S|ЍS S5 p( [\8\(\\D S0@ }(00$0,,QT@0S0(S$0000Q 00S 0[SX v?70QP"4!( $ (00) 0P00U00( 000$00 00 U00040 080408 0,000, S 0 08BX6u? v?( $R BT@2r/00q?`0sh00`0 ( R   T R,0S0u0<0epP<0=X50D\0o_P0"H``V PV fb0( 8 @0o/O @0S U SQ0-  R 000 0/ !o/ S㴲< $ 0  ,0S00@P0PT000TX2{"0S0 `  0  @D @0D`pPpD0S0 00[S@PLpHP0K0000 0d Q0 R 0$$`PU PU0PPT04`o04"H{`PU q<PU eW<@B3#H 417P,02S 02#38TR o_PPU 1oώS U 0\ ` \V U 0S^wτ0 8, R X00,[ ! r ,UA-`Mx@XPp08 P34`0 P(0  0!! 2 02U 0 0 tP" "#"#(1 0D00 P 00S&!003/00S(4`0 PX`ЍX0 0  #1/P0(@#R 0P 0"P25/0 # @1/0, s@-@P04P00 =o0S  `VRUp x0P 003/P8odUdЍp@d !k  @-@0MP M 003/00; ⁜pP pc`P  @xduxۍ ЍO-p0\M0SR `H^b@Q P0} P0`c0@>S@ P0} P0Oc0@SP0 0HL R   ?  ?/Z[d0P `@10d ἐ 09/0P@\Ѝ.,G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/,>0@-@0M 410810!a0 P0T0T a0 I0PU ! 5/፹Ѝ0, @- H y@ w@-Q@Y 0  ~{0f x &@-<@0sw(00pp]0Co(%,,-$M ?0 0 w$Ѝ0-4M 00 000P4ЍO--pKMDU}x " txx4 0`p0 `V0 R`V"R0*`ğ p$ T0S 0s 0SKߍ0S P (]30SP #)i|P#S 07){ A0 ( A{{:?dSd( 0(#eJ|3P 3R - BP   BRڛ 2図"B "( e"2+|P 0Ÿ R#3SPjS0l 10h"0(0e|0P P 0 0SZP=9 =:qk{11 AP09ڹ A { Q 5 P;!%#3\Q0  d 0 (0 eP!{$1@P0& d( SP P* 0"%+0!V5 {@0S(0d {@0 0(ppuY@.A@, ,P,(,X7,,&0,Q0!&#&0&E&R&x,,8,@~%_& 0P 0 A ᚨ A k{I{7{z\0Wٴ0P  S{`ẗ@<˴(0P<pగf0 >{@  8{@-@s@SRG-@  700pP ąP:<`X:00X 0 {P+ @-P@`pP0S -S :S S  000`  0 [0P0 ЍU0S T  ^\P$&p@-@PWup  `Ku@cuU5700@pp@-P 4`@up@  uPLu@p@-M@ vp$ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M ap 3ݍ ЍB' p@-P@@$vpPppA-@Pp p` j [0W0 |0WxX Uh0X`0 P  0h0H zЍU0 P 0 6B0#   , @-`0tM0F?oP2p @Qpu uptu@tp h2Sup L0V#4 - &tЍuh"tpp@-@0  Yt0 S " 0PUPUp@`0S   0 0S ``0S   0 0S x`v`A-p@PMU `0S@PE7  0P00,ۍX700S @ Q@BPE@C0 00 pL0S 0#S @UX !   @-M@ H sp8lۍP   !p@-\1@0S`M @@@P`Lp @ p0 p`` P09p @ 40 pЍp Z!<  p@-@PqP  r01pP`qpI r0#1pp@-pM0 p @P rpr@pЍG-QMV700ۍ 7  Y I @`V 1r@pP`@-`R400 Ѝ@PTp e]@P  Q*@ 0S0S0 S   0 0S0 S*]P ` w^u^0ST   00000`0 @@P0   @-@#@ h!L1p@-S@T1S#d1S.RU9lRUppbV:l7^lbp1C2^L10CL1L1PS*^0P11C$^T10CT1T1XS^0X11C^d10Cd1d1hS^0h12,P0C2bV^bp2,P0Cp27@-@0 VPP" H10 D1<80@8@- CB Ѝ0@ Ѝ0Q@-@    bXqP p C00`y Ѝ@ Q @ 00Z pЍ@d Ѝ !h< Q@-@  a  (qP p 00I Ѝ@ 1S70|v][P| 01@ 40 pЍ@( Ѝ !T< @-p0M0@M0$+p Ѝ  !P 081/@-@d=(L0S  P 0800H0S S@ $(| r 9@-p!@RM Qt0 p Ѝ9p1S 0@-800@@A P@-@p t10cSt14 Ѝ@% @d 0 Ѝ Q7@-@  ,, _ Bkpp  Pp Ѝ0@ P 11P,|1@ R  |'AQP |`00CS`0 Xmw@ T0Op 0< Ѝ0@Y X0 X Ѝ0 ! & &h< p@-PD"pp44p@* @pp" p@&pa p@-P@ ` 08 l, >U\X' 0e 0 008 , 81pp@  j p@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @G-`Pr.H0$:0@0   10 &000 0sD0 D"4S4$ 0>0S0&0 [Pp0P kW  g080P0403?@- @T08 00  HP $  :HP%p@-8Q-H`p$ PO 0S PuPU{ 0 P8`V(-P  E ЍA$ $<080SV $0 pOc0SK D ЍA [0S $  1 k p A ЍA' U0 0S V V L0S p`MP  6,p R P 0S <P; 0S 08$ ЍA Ѝ   r Q N !  9 0@-@xD 0PHH0S$ S@ H0p@-S@P` 08PU $00P   81 08006? $0080S  p, A p p@c !@-@@O--pP`A M8@T+ Ѝ P 0S&W! 08،$0   P 0]@X 0U0X0S @ HX   0 C-MH@  ЍPPf q`0 P  , GlpP1 P P2 P7 PP@ P8!88S@p$n! HQ0S000 0R00 0 *p x#D!\10B0H1xDl l<xK Pʌ| !2 y 7 ' 0 h,G O Y @ a h q @-@  ,kp  ~P<1 ,7,k0,1ЍP0@D<1 P$6 ! ! Q/@-@  0S@C-q`@ x @P00@ 0S  }~0 Sx   0@ Ѝ 0N pPt @P Z0@0PEW  x PP 0S  E$0$0> R>  **;X  0S 5@0 S   000x1  @  0SP P 0 =0 S   0!! 8! !A! W! 0C-MM000@"07lp(00.P؁+ jP`pQv07S 0 S W h0 0\!`1 `Px1 (ލЍ Pp P  R쀟쐟PU Wxx  x 0 S   x0  pP 0 Px1p  P  0S 0u0 P !k! z! ! $#Q@-@  \\+p`07S@YY0 S U0VS@ !A-`R@p@M PP U>70l0h @ЍAp"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *P 0S( <0 *i  <0_ | 0S 0d  r 0S>0 P 0SV>P  *@ЍA !" " ! O-p@`,$MPP   P 00A $ЍOPy P000 pp XSP     y0pG 0pG0 ZppIU3#pp pp LVp#3s 8118100x1Z* UiPx1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 EP  YY D p 000 0SZ81181$Ѝ #P  YY " p 00`` 00T0 :0G [W 000x1 Z R& ` @P `[` @H0` 0 00  WB W W 0S 0`0 D7 0S [ xx0P 0S [{ 0 xr;" E" L" \" l" u" & !" jp@-@>Pp0?R02P?00N,003?00> *g> 0Cp耼p@-p1PSM"`! %@P T 0p1!V T F0S X\z[RP Ds@tAtЍpp>0S \0x1@T l1S R  @>0S@ E`l1S   0 @ gP 0  @  B.(0W%p ,)l1S * ,* @ !F* i* * * 0 R/ 1/l,/A-@P 1 !  tXSpR0 qP 0`0S000S \ \QP0 S   00S000@00P10 paU0* I !G* + 0P@-p0p pp&q {00P Rp0 U  * Y !* p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@P}h p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@P@P0S 0S0 @@* l !* ++ ʚ;<+ @-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p, 0B0 0p"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ * !* P)@-0 0PT0/* !* P@-0 0T0/* !* //P@-$0$ $$#08D0* !* @-,MP` 1U0@0$00 0p@000 0<0S ep,Ѝ8010C>S00@( ( 03(00@000 0<0S80 p @l8* !Y* @-XQ@P gp0R@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0RPU `0 P  S   p0 e00C0HQ0HPLPU0 P(P0P0V00 S   0Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM pbĂT0SY 00C01@0S D3/2"(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S* .P% HLH R 0|S0       @@U 0 H$I0SPp0S} `Ѝ\r P RUk Yh T0e0S 0S   PE  \P 03/l,* !* @-8 0(@ -p@ t@Ѝx &A-`M4PspM e0 ip@ Md@ۍЍ4F P ڣ# "P  RP@@#C 0 ,$@4   ER0%x &-@-   Ѝ Ѝ/@-MMP`@$p0  iR 0pۍЍ-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/0% 0p/Q0%p@-MM p cp P@;00 dSV 00@ۍЍp P0 4Od0%0/0%0@Q0%p@-@PPvd; @`J oQT cV00pp0%x &dQ@-@P;@@O@-q@ nc01p hc01@`"d@-@M    0 dp1$0Ѝip@-PM@`   0 Tdp 1@ R! 0 p`Ѝpii$0 /H0s P/0 #:60#//A->PXMUV0P0XЍU700p@ `Ri0 PU B0>000 <0  ,> !PP> *U+ @-@T!?@Q/@-@T?@0P/ R R /0G-`P M|0(0S @ VP P OP:%`P 0!00 0   '08S0 R00 Ѝ080 +00S # `pP `P0P 0iS.S  `P04S 040:S$&O-YM `F/@H9X0%LP>Yߍ0p1iN 0S 0S iPP@ Y P @T0SL0P 0@S0@S@p@T1S X1 ⍍PAT1S@p\1S`1 P5\1 S S R@L1SP1 nP&L1PC_oSRPU@N!P08S W0s0P 0*81 T48#88 S R p ,S 0 S T W @@ 0?D0 p 0L0D0}>D0 @V 000H0PPP !|{+ + i+ + 0@-@PDM QP@T 00+p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S Q 0  p<@P @-o000Q/Px1P/$0/0@-@PM   3UP 0 0pЍ00 ai~iA-p X`0P M0 @R  RT T 1 # "0@ @ QPUx!@T00 Ѝ S @ca@-@p !p !p``Ȁ@$0R% -@ r @$ A @ @   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`P၁@P─@Ѝ ΚP\LLP0 q@&P _pP  !A-PRp@ M 0S0T00 Ѝ/$P P&`0 00 0  0S TT G8PP/00T U8 , !, O-P@0"S0Z"SJP Y ppP w70p0 ЍT WYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8 ]]]](]]]]]]]T0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: yE U*`XJ:0\S 0}   0P0N[ SP0Sl  XEPTPp@]p$&P /0 S S /S/P0/S 0 S S/0/O-P@P ЍOJ=`P hhM ЍOxJ U qWkJ@P  )P 1 A Ѝ=0@S- P'[ `P AJ ``VIP 0 0  0 0 !2, p@-@P J` 0SPJ$` PP(0S $ J0(0$0p,e P,e PO-4M10C`@XPS_ yxx yx8yxxxxxxxxxx@mXmlmmnnPodoxoooopdpdpxtqdddwdxxxxxxxxxxddeeddeTffffTgdghdi0iiPjj@ldlmxdtzzp{{{dy{xxx{| |Xyyz |d|d|t|(T<hDylȳ{{\hxT|ȅi܅x@Tzh|І$pHU- `Pp $xP@T X$P7 T6X T&$ !P`0@T\0S @U0 @0 0H050U& H0?0P 0I0 @PA t01d4ЍFP 0 sp 0S P I01H0 00U  CjUH070 0 LpP! .Rx 0R77@0U P 01pP4 H RU H0@1S-~@H000zU TP0H0p ,0 00 0 bG,0St _ ozU ,0!00 0 ,0 S$ J Ur <1D8hvl0b儒000 0 PPP00 0 P  p@0  @vP l UD <18hvl0b儒0p00 0 P]P00 0 RP  0@H0:0H @P0<0UH& 0S# /hPp؀  (P00<0/V`P 00 /0P0 000H060U ,0 00 0 F,0HS  >h?p 0 a1pT  P ?3p@H0@?U , P 0S UA 0 Ap H0@50h h050,0@$ 00 0 ,00,PYL i$@tPpgW700@4$ 0A;C @4p@AK0BAP@/@ 0A  Cp P# H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 E,0HS AU H0P SPH0;00H090U ` dq`,XpP~ D`P 0$'` CiFH0Q7;0UlQ P0l1 P0l1 |P0l1 P pE0Pp1tH000U10H 2}YP0H 2u QP 0H 2m IP DPH _ H000YH020T0hU3 | 00pP`a 0 S;70?H020:H0605H0;00H080+UT <1&8bhvl儒00 0 nP000 0 dP0P0P@U0 <18∂hlfr000 0 JP00 0 @PP00 0 5Pp@0  @U =[P lxp 9{PWH0p000 S P0<00  {P WH p P  {PWHp   {P  zP  pzP  \zP=WH  BoP  ($p 00y ,p 00pPm $4 (1 H,8-   PA B< TzPWH]  B+ $zpB pP> (( ( H$8  N P  B H, ,% !az, , , <, , , - A- '- A- u- n1 - H2 - [- - - - - - - - . /. (. . . 7. Q. Z. d. i. x. . . . . / '/ 7/ ]/ z/ / / / / =9 / / g0 u~0 8 8 5&9 q=0 @Z0 u0 0 9 8 8 8 8 8 8 9 9  9 9 8 W/ +9 49 ,0 j0 !0 0 1 0 " 1 1 B1  zP  0zPW ,0-00 0/ C,0HS~  y`PH8W  n/PP `+P`,0 00 0   RC,0S<0M +P01E lS  Z/o"B7 ($PN/P0HL P(0+P> L6$ P! (0L&0 ($hP0/P0HD H(0 P D6$ H! (0D&0U$ H0X UXH020H0 000H000H000H0 00H0 00(07600R 2 E *@450S00T01=5 =50H0U <10@0P@(l6h&P g0Sw5U H\C9yP\|U 81 800l ,0 00 0 pB,0S0H080i0 PP0 0 P 0 0H010QH010LH000GH050BH050=H0008H,';,2U0ZH090*AK⚿O0\ U0` 0K ZAK'OAK➿OAK⣿)N +U8 \0@T$<(@" `PT  ,00A,0 S PP  xpP0:0iP  ,00 A,X $oDPdPUpP`T=CPtYDP`MP>pPh KDP@P1pPj =DP2P#pPf /DP$PpP, l <!DP` PDPi dDPl |DPb DP`Y  Q   9 Glw X @W CPc CP (CP` <CP` PCP` dCP ` xCP@` CPh CPd CPe CPe l CPe CPl CPg CPg 0CPl DCPl| TCPd ft qW ZP0$, ʐPP" A\PMP00[CpPb YwpP  RT  RQ 0,PS0P , S%00 0$0(00XH` p ?@ S dZ`0P} ʎJZy\0PvZ Z qU `P00,0 00 0 \@,pXkPP 0 p`j 0S| %g*3?Pc  0 PH C0P ?w`&6vaP,U ESH606#H0"800H080H07 00H070 U6 k6P0h2h2SH000H070U `P 00`HpP؀G P (PVG LP \P1Ȁ0H040H030H, 4,H020U 0 DpHAH000H000H0@00U ,0 00 0 ?,0HS U ,0 00 0 n?,0HSpj U ,0 00 0 Y?,0HS U pn#1 <1 V1 O-pУ@`P8 P P `kV<1P ЍOBR$ RZ0 ,08 ЍOb Ѝ !, O-S$M04 @ 0Q`P  8Ȁpz⨠娰<1H0  00@p0   h    0P U (   $Ѝ&" " !\!-A-PQH 1`Sp51Sp:x1pS> X@H@\?hfl6S?h?pft6S@p?xf|6SAx?f6SB?f6SC?`?A?? 1pP??1pP?X  P T0 STl6,`0Cl6t6,`0Ct6|6,`0C|6?6`0C6{6,`0C6O-MP\P`X@ D3&7 D0 + 0+0 0606} G000 0:00 30000% p S +8 0 D 0l0 D+,൷0 P#Z 1H0E,>P0hl6 (8❷P,:؍<Ѝ80Д$080,CP(/p,h6p2l6h2lt6囗 SJp,p?x|6囗 SDx?0&p6l"&t6x6|6p"66808 p,20! (.(P A((pW 400000(0 00DC@(0S 0 S S0P\S @pp8000SS (38 P,,00  CP 0?o20804P0P$0p((P ((0S&0' 6 *PN(PI Z4 !pPpP80,CP(0)S Yp S000ܻ0@(0S 0 S S0P\S 00@ :0P  d hPP` (hQdqsPpdq P @P0S (P  P 0S (P pPP} 0)R00S P W400000(0 0  0t0S D:$ D000!!,@ !!1 A, /1 0Q//Q *///G-p0@0P `<P Y 0 0 `R:S@C@3@D"X HGU( HG9A-TpW0 T`@V0 H0HS @sP X X| |00 S DD0P 0RS .4 !B4 p4 p@-P @Pp[=@-0006 !6 6 p@-@PQpQ !6 C-`TM@ P `Xap) 0 a ````a1pWp0`V& {a @ 0 'L@ ;aT  @TЍ00C>S00`"P!@03@000C>Su00p"P!@03@0< ! !4 !8 !-3@- P ep@Ѝ0@ Ѝ/@pA-@RP0p`@0S p6 A-0Pp`@S:0SS 0  RS* R0 `V1S* LP a 0@DpR: Q 6 P!6 6 O-A 0MTP`0 zy <@PAP$@D081 0S  up 0 0PĀ P ܽP ׽P ҽP ͽP ȽP ýpPp0S p Ap `61@ R L7p 081#?P 08а00&&&p H0S& S% p D p L  p $ p~   pu L0S p0$0M0p T pc t0S@08!50x1Z9Pp K P= ip> l;PG0 ddd$k|P$ p) Kl p,!p]Ht p 0S P zQ  ᲽZ T  Pp  #PpPO  PJ PE ߼P@ ڼP ռP9 X00S 2"Q`` Kp  Ep N%P e%P0 x1`$0  0p X00S!XppW" b a!<p"%P `V%R  p0S0S" 0h 1SPq2Ip@0i   pa 0!hpYp  D pO 08! pFpP@ 1 R0S  P2 Ѝ0Sp pjx!;7 67 | 9r  E7 8!  M7 !Z7 f7 8 3t rww7 7 7 7 7 7 l!7 Ŵ 7 '7 /7 7  7 7 8 7 7 C B p@-P@pp p@RRA-P`@@pH0s  S  U@ p@@@dW0S R H R U pr E7 9Q/p@-P0U@ST` 00p ?jP@{@T:p8 @-P`1pSMAT  p@lЍ TjPЍ@!R 0$ 0 0 bp@ @aV 0 !p@~`P ?p90S ltm00#40  LLlD SP 6 0 (!!8 &8 !]8 !;8 R8 p@-PP 0S @0`0S @@p00p SU   \@ .S0.S0_S-S.00  @Rп"0T0 0D0p$& @- @0P PT00Q  ῺDP `00CS`0p S00 P0S X0X /XN &p@-h1@SPiPPE @p U0.SSPP X{P HvP 4iP 0  .PP8 p@-@P'Ua 0 |4M0 l/M0 \*M0  L%M0@/8,0)(&  #@       L0  L0  L0 L0 |Lp@ M KP8 V/ gt~8 8 8 8 8 8 8 8 9  9 9 9 9 4%9 *9 39 <9 0(ƒ -\ lp Q^ ,\ ,@-QMM@pPVp000 ,LQލЍA. !. d0h Lp`0SPE@Ep 0S:0@0DE" ( G9 M9 O--,Md`pP. Ih|`  ! @P2 0S  gP@ geP@,P$ X]P$0X22@00,Ѝ P,P, R BP,PE0S h R* 02 0 H1$ R, R P 51$ R R ,Ph!@P !!!\9 c9 P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-P@`MpUP:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  Pi70 f.0 I@0 0IU:D XW0 0 `TT  DSPO-`@P0p 00900W*0S T [.700 Ѝ!0 *00@KP  00T [ 00 P     @ \Jo"p  & Z/Z#T [\*00 0000K@P˼\ZT [T [ KP|$&!G-QMMP<p`8p; @7pE dCKp V= p D74 $2KpTG    0 Ep P; EgP E/    QލЍ   Vx20]V00\2 0@E p , @pP0P@T*x p0S4 n p`@ᴑ崡T*T 0  Jp @ U p    /r Jps @ /r   2/Jpa @@ 2/ "E   .0E/PI \E/JpC 0S @00S@%<qJp3ǻ00/  U .A- PpU@M 啨ЍR` R 00L0S 0 -0 0p0#0M0 NV 0 00 0IL0S 0 9 g9 O-4MX@p 0S\`d` (0S:0 `p20"4ЍO 0  ,   pp0,0 ,0SPC< ,4}|p 0!00~,/4ЍP V0 000!0  3 0,pcp000H!\I `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S!0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  0<,P!9 9 6 9 9 : p@-P@`P 0S P$`(0Sp,e P,e P U 0fvC0@-MMP+ Cp P0@ۍЍ0;0 C@P ,P @- PΠ Rh00\L  ^@-QQ00P`PV0 V=`V xЍp@@T   :0x@ `DsPЍp`Vx1@P '0>0S *P PU@P PP `/0P@-,0, ,奷Q 0  @: 8!!: P: @-` ,M00>0@SP  '0x Bgp ኸ0pt0 0 0S00 0 0S0S|0@0|0 0  X00Qx0 x5PT ,Ѝ0 8 0?0S 0xPTEA-`@VPPFP|P2Xpx`E -P x倂|"x20 kV0  |20|2@-`@MpP!  ( (,X( 8pBPU@ T;700@Ѝ 3i///0@-$!M@ 0  :+PPЍ0 3"Q p 000)00IBp=0000@ 0;Bplp/ 00 " 0/Bp<$ p : B!\: j: }: p@-QUp@p @@-0x1p@;-p@->`FMV 0P0Fߍp@PF/ l9  0哥t01 0 `娷0 HF?,BP 0> *0 F?B ii@-@MP4@ $┳P P@ЍT!Q@-<0< <<0SSL`///: t!!: $0 /Hp/@-M @ p000p0@0M00@-P@,M(     PAp 0 00S p,Ѝ08i(p@-@MP Ҷ ` Ͷ   (PAPЍp:iC-PQSM M3#夵T0S2"`V2"@p@"ᠶ0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0 L00$L0T@S120@ 2ᕶT@@D@@0@L0 X9   @L0  zXH@L0   @L0  XP bUPPEPP@ D$r F?p`Sލ Ѝ C GXH@[5 !!: G5 5  C-0@"M 0 @@ 0@$@բp P 7)PP @@  0Ƣp `@`$~+Ѝ00V :0 ( P|pPh. ( :W 0@T*x0V*00Q+T!@-`@DM pP@  ᆵ  ᯣ!> U 134  R2$ $@0 DЍUi@i(@-|@QM  ]00p |2 0"x2?Ѝp@-]MP#>p PP -R 000S0S S SS wR0S HwpeVP}S CQRS@ 0`  x@P -$0 Bp 0S$ H 80Sq S} S00,0S  R000@0S  R00@ H @ 0Ӵ H!>50H \0?pX 0S 01S TT=0St0 0 000 0 0`{eRj>S S^  R]ލpRZxg@PN ` ,GPD 0A H=[?To90S6 HM P N0j+00S%i@!: @-40 000 0TЍ!2S/2S00/@-@@匵V002@-S0@0 @@~V0002S G|/!G-PM`p (PP(@P. PP`p=p<00 B c=pPH0S p >p PU0S zp \=)@! ( ( >p | P>p 7/PP >p +'P Ѝ@: : qB@: lBpBfB@O-@p`0M00P U =0S9P 0 0 P  R P崡 R V 1!P P    ijP0 PPP0PU:000y Ѝ@-  6> ЍgBp@-0M2S`P@x (△VP@0 \(>00ލp@ !B-$M^ * ! ?<$Ѝ@-@u< (@(@-@pp =p`~B p@-A^ T%00p``0@D^"000œ\p@Tp0,p/0/R0@-0 \  0s# R0p0QRO-M@@0ܳ0`1Q ԳV00ЍP0p Q :8Q@SH ῲ딂\= \ plP p,lP U  Z4\[Wpp\X @ Q*S0C "'P 0 B0 僲 0 S2Xt00cSc@-@ 000P 0S00Ѝ@-@ 000oP 0S00Ѝ@-@ 000\P 0S:Ѝ@-@\0S \0\0@-@`q0`H;0`0@-@08\@0p@-800@P >0S0&0T0T0x1 RpR 0S TT0Q  0800 >0S  p@'&; p@-`PK@&Pp00,000S00 /0KpcScO-ᴀĐGM` P`p 0000KC%P@ d0S  ERU ( Q  R \*Qh 0 00> 0200BS *↱0 350 RS00~ Tt0K$Z 0pC$0pS  D\U Ud\ h   S  P9?$000GSH00ɟP$\ D\U R < R 0GS460000<00 0UE GR 8   (R 0 (!R ` G R=  (  (!  00SO p ?0G 5S<; FP%*pq` Er 6b`Uc@$R`  GR+  @$A @Ӱ@$U 0? VaU I@$R5U` ` 2 RP  GR3   0GS 700 0 02 ,0 "R3h& ,  l QqK`    GR2   V 0(!R^U`  CKP\* V(!RN(, "r  P U: ARSJ  ,   ,R\ Q: (, q  P U:@QS"    ,    C B  r W   GR 9    0BpC?#R Y  GRM  ?# ?# 0(!RV_UpW ( "R 0[( Q0 PG [:Q0  "     0UK U`V@ A%R  GR^  A% યA% 0&R* _PP' GR|   f`&Rj0W ( "R&U 8!   Z  GQsP 0V    ^  GRbt  0 C C GRW<   " U "U 0 VgUd[CQ    0~  P !)x 00 GP+    ) 0e GQ `  R \$Gߍ  00    Pp, >; cSc25Z; L; ?Au; ; 7@-P\ R&@}P\0S x0x'08  Ѝ0PP @ 40p <%; t!4< @-PR1!_`0@ 0p\ 0? R1 0R00  0M 30 0 0MP0 0:0 00CP00;0 009P0060 00P00 ЍP 0000t 0 00p0 00p0 000; !r; ; 0@-p0i0 MSP`$M ?1!ppE7p@10S i dp ۍ$Ѝi@ #0 zPp X81Q50 00pP !P(8 ; &$< !'< @- 0080PP `V@Ѝp0S  @P  ܭ00O-IM PpPHLL `PR  @P0IߍO'#0,0g!#600 0H400` 0 -p00,0 PS2 V30a2@0 0 ,0AT7`0 HP 7VX@PIߍO@70 Px 0VT` 0X`0T70 4`7P?< !@D< T< g< O-@pP`QP,b尠,`2S$P㘀U`,@ ,<P<, Q 0S ,9 < P,`0!t< |< RO-00!`p@PT:5p T  X ⢱00U *"0 p Ѝ0R0  ٬ @ 70 u<p 7  l<p 5  @-RM M00@P0BP Pp` 00 pۍ Ѝ` 2p p @6 0<p 0FS@- 81SsQ S0 00 0PЍ 0SЍ[O-04MS@ h@@ `_0P o0 00 0^0P # 00 y0S0P#  R @ ^.00T0 @P0g 00 08`P^ 0 $ ( XXVpP 0$,0&(#,8  P@ R  !Q*"0 0pP 0[ $0*(00 0, $0(,8 TP@0 Rh0` 0h0  0304Ѝ $ 師 0 0 b (!p,  t  00 !0pPt @ p[o0p$00S,0 P@,0$S  S S0t0y0P !R "R hhp( $}(z,8w  P@< 0< O-P0M040@p0` `2''pp'ppW9 pW6l0S~,0Sp,0儂0噇 2Sp,08h0噇 8l6Sp,0l0噇 p"R000, 2hvSl~l6S 75 0T pߍ00 `2(p (  0 p 00 `2,~p( 5 0 kp (5 0 _p,4 0` Sp'0}0,804l0d 40Apo'0n@0!04,0R 40/p`p`pgpn,0 !P ,; 0,00lS  R0 `"pP 004100,0H0 p 0 Y00, }R0SUP 0I p p  00,0 !P !0 `"PP 00 0H0p0  0,p< < < < < = @= @p@-PUp@0L0pp@- P# Mp 0` 0 ` 0@@4p&3@ Ѝp ` 024p )X` 0*4p  00; U1004pO-`@p 0崀SPM$H` :000 0 0 `00`0! 8Р 00 `  $3  00004H081v pHЍOG<0 $3 4000(4@0S4H000s$80403 S 00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!3 00DN*S:kG{{'{*zm8 S zkg{{'{* z_$e3 00AH0S0SY h V 0R<0S 0Sl2h2H000s8040 PH24 mP428 gP 20 a# 0@ 0R0i 0.0 0Dp 0h`HH  P0dh0Ѝ0SP1P1 P0 00( 00000S  0R`V wdp`ЍOP 0ptxЍO??/= N= 67 U= r= y= = = <> = = D Y> \&m> > > `> g>  !6< A-@PT R0A 0p800  l R 0i0OP 0S <0S $u2  R% 3`0  ` ``0Hp00` 00`8 0 % 00 0$00A80%d0h0u> O-0R\M@`pP 0$P X0 #3P 0 RT000 p` hPP. cL0S0 0@S@0#/L0}I|?H00P X0 "2P 0 Rzgjzzz{T0d0S  $ P $[ <X x& L" D"p  $P(P Q,  0  <  @ , D  0H  <48`LPPPTPs0p[ upT  PPK  a0v` 0p10 pQ PE008{@0`0v@ @P10 0\ 0`v h-04S"1S0810  \ЍOp N  0S @x\Ѝ7S zD> !> ? CDC2? Z? g? C?  @-`@pP`0 mh0X \6S R @`0?0  `, 1 0 Ѝ@4   l? > AB ? p@-P@ $ '0 00L0p@?  Lp@-PUp00CSp@0@ $0  (00|0L0p@\?  p@-P `@p800  B\x000D 0<0L00p@8 % ? @ L YA-P`@ 0h 0R0~P3 \081HAp` jP081( An\P R   < OP)`0` `幤 0d 0 )P $AA(@ Z@ c@ ; !; h00h0 C-p@ PR0  R $ RP508Ȁ `0  i@@0S PP  P0 F lH.81``v`P( `"(1* (> >Q  0*ķ    ЍOl  ЍO80   0S 0 0y0 #QA  $  S 0 0 00 R* $`0g0@00S( UP `7P#  00h0d0h0 2 R y0 00 0S:ЍOS 008+000s  iN`Pqp 00 P R   G0 00$0C40 040800 080ꠑ0 S0&PUS 0SP 0p0x0Ѐ60L  P8 ЍO`0l0 $-  =0S 0S 0 S&$-  r0 <`0  @ R |0@ ЍO? H0@Ѝ !6< | @ A ,!A cSc)A X FA bA &0p@-800@P  Dvh00h00L0p@J i|A A Q \/0S/08. / d R  0R/Q O-0M0000PS@ T0`Sp 0 ЍOw> R*jP 0S 0L6SDƛ PƛY  S-  hH!  Q  0 S:500 0[p00 0  ЍO Y 0 0Cs0n0S0 S0L00 0!p 0 # z00 0 P0 4ZYA060@ 600 0p0 0  t`P  0 S 081pi@X6P P0S0 0<S<0P0Ѝ0!0 0 # z00 0P 6ZY7Z00Y[0S0 0  Br~  Brz0 ll00 0P0 RS0KSK?305% 000 Y0S0  PP   ЍOOni@0 U P4@0Y Y0 $P0 0 0 Y  0 ' 3@ $ 0P 0  S 0S0@00Y$00D0<0<081(?00; P0 P4 000а 00 0 0P00 S*xP *   pT @ 0ЍO600 0<P0 _0S * MP d p%`81 000H 0 000 `0`0\0S   0L!YP 0 8 R @ 1VЍOY Y) Rr   0 P0Pd0 &Yk 0 ?+ t ЍO:C A A A B (B :B FB ?< QB MB (B rB aB Q B B C B 6!67  B B C A-h0PR@* 0 DA0BS`pbp G0 Ao$bC O-` Pp 0䐠x1@T ЍT 0S R T0S> R *:hP  b0 ?@C G-(M@P`P Q0 (ЍGPE WUNp0@SJ ZG1UC:p1S? U<: !P3U0:! R-  $   P` 0QU q `q`  U +*  D4(Ѝ001 @0 B8F!C C @-` MQP\@M  0p000 p 0S TH  ۍЍ 0[`V \@T R!$A- p`h@PpAPU) 0 HA0S 0A\0S 0A_!C A-0 ;M0M`pp@P @ p0)0<000C$00(00$0C,00@pV004p8  XXU0`$0 0[(p ݍ0Ѝl!   p@-@PT  (@x1S0pSq L(02p F(02022p R Rp07@-PX0E @P 0S0>0P 7P7;020C0s0S027000000 3  Ѝ0@}Ts zgjzzP+S, @ 0. Ѝ0zDD \p@-@P0( 7Uph0Spp@0\O-@`PU Q Pd0S  0 ,v0d0$dP00Q 0S 0P (  z0800 | 봀8 R0 , 00C0 0800<0  \P`00 0 0_0S $0 pWp1s00 2   0P C @R" 00pwpWL0H0H0p7D Q XD N= 0/@-0P s0 @Rp@-00p0`PQPE@ `㜝 @d@$,b p0P @-P01S 0 P04/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ oSQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScO-` x1@TMT. 0S pW$ P  ęPP@0Sh0S d0Sx4x$xx嗛ޘd0 0S PPTЍ|0d 0|0 00d0 00090O ≙P `p8PP ᴜ |, fPP$0 00 PP 00d8dX ?PPn ]|0d 0|0XxẘU 0S KP 8 F P  PU` P < 0$Q S "  Q  Pp h % < l  hZ0pPA t0<0t0<0 070 802dxQY X( ˘P   U~ ⺘pP ؘĠZ 0$8 0  h % <   $0<0|l!D y!*D 0E E p@-P p`01S 0S 0S 0S  0 @T 0Q0 PSP 0 U d0S0h0d0p@TE ! 0dP/ (0 /00 0S/p@-@T PP@0p!G-Pp`P@Ѝ0E @P00 4a@P 0P000000 000l%,0  )$00 pPP[%0  @p0S pK0 9P  0@R 0 0000@@! 5 RnoE E s@-@0T  PR8 00*:SR h0S Q^HG`ЍpT$`  P (0Q,0Q  ⼿ `P 800000( ,0CP0S  0h dd0S  $0R  0h0d`0SHE E 0S/0S/   O-MD08PRH 0`xPf00ЍpP P[0 X@ XP R R R0 00Cs @ЍOP 0S4Y00 0000000Cs ЍOt47 @PЍON p    @@0 0<$0 ( S! 5 0S/G-P@M T 0p `xu$00 0@0 0 @^@ЍP/@-@TP@90S   02p@-@PPP (000p藌 P 00p0000 S0 @00:S 0S @\S000@:S @,$&0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/@% 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4!Sp  SO4E`VK `0P0E@ 1 PP 00pCލ Ѝ@@ ;04pW p40(0= zP  0 `R0 :R`00Fd4@0  0(880P4 PF0 {0S "G p PP ;000P6p 0S#0 0 0㈑p8`@[ +  !0P R 0!0SJ @뛙@ !0P 0S00 `0 SWG p@DW :Sp:SY @\Sp S Spp p00T:C P@D 0SJ !G0P0@ 0 Y@S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 P0@DJ`F  0S 2!y  00,  @ ` P D,0   ,0@PE_ P0S !$ D0A00T*q PPJ 0P,@%@-0  0 Ѝ@-(@ P S0 0,0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ x0Pv Ps @ S Q0@'P ލЍ x0P P 0@PS0 PP U L'P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  ,$&p@-@PDp@NA-`= @P@ d PPd f 00@^S0S:S_ p0 R0S@Ad{ PJU \Sp0S:SH 0C^ 0@0LT1 0L\s0TSpASBC\ LYYHXYpYHXHXHXHXHXHXHXhYHXHXHXxYHXY0bC|^ 0 0 00:0 0Pd @0:SS0AR0@A  P A-p= `P@ d PPd0`Fs 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P z%P,E G-Q0S `pʯ PV00Ѝ  ᶈP00CS0\R Pp0  W00S(@ P   , P [P00SW  X  R00S 047σ,P R   S@T PR   R ,,,@0@-0S yP `P,,@-@WP08G,p@-P@PPpQPp,@-@AP M 0@87ST ,,p@-@ PS P@p p@-@P & 0@87ST ,,O-pWP`@P @ ЍZ K P  PT  RT@ Z //////O-Dr@00S `P$  4PV00 Ѝ  ᖇP00CS00p0D0& SQ=5 0@/0PA/A/O-@PDpDpG``b0Y:0z  Z# 0@@D 0DA\0:Z: [=0 S: p `$ Ѝ `p,,A-@`Pp   A  00@-A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @Pqp TT0 Dpԓ@ /<0@嬓404 4/,00S #0TЍD%xE ,,A-`@ 0s P00p0pGWp0PP @P @pT 0@@PP @,,p@-@P?@0 ?@0R:@@pP p,,p@-QM$0Sp A1` 6/`1!6/&%!Q10P! \`6/*)x!(Qp'l10Pdd! \\\^`P 6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/Ѝp,,D%0$F xEF k?lRF QF )m!F SF FF jF qF F F F 2F F O-Q<08@0(00IpPR @p⾍h`,@480T:(t(@#0T(:(t(#0@ (0T: 坍030H,@`(4 反8 00 D3#00 `@4 #00c4 0300 `@80@\000 4/0SD0p ,,!!D%0F p@-@0`,0DPSp1S@,,0D0P/,,O-EAMHP MU=M`0, 00PP}p0,0w0@00`o`L+=pp A>0t@lTllH0SpW W DxP |P 00PpXA C9R񟗈pqqqqqqpqpqqqqq8qXqqqqqqqqqqqqqqqqpqqqqqqpqppqqqq,q@qqtqqqqqqqq0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0Z 0  ;/Qu$0`S 0 R 0 >40<LT@C^3A00@C32 0\  2` 3 d ! XC 2hhh 00C0'08S 0 0 00k"D`| j,`PPDAލ Ѝ, !͏4P 0H0,,F D%G G j !,,0H0S/,,0Pi /,,A-HAP|0`S@M*0S'0S S f0P 0P@ @Ѝ pW*P 0 0000p(p@ `0p吐X0 T7/0S 0SP 0 P0@ЍA,,,D%xE G-\qPL @0P12C001b5R 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R;00埋0S0PS ,&0S,P N,@GH,,-!\  0L0#0,,@-p0M  L0@31 ^AP 0C! 0Ѝl,, @-L 0 0@11D ^Q       ,,A-@b@0Mu L0 @2# p PW%cP_  Bc p\  Z|$0 HD@,X#10000 2R01   0 0S0" V00 S ⃋ ЍA X 1(4/00~X0威0 SV Q`ЍQ0S ŠЍA輊`\c  Z lX@lA%0S Z b0@0,,!C-Q`0MS 00S` R@P: 0s%@Ѝ pᄐW   @ 0p0|0S0S +@Pp'p00FV@@P 00T p@ p\`W 0S:S* ᱊ Њ0p0pp,,,O-`HqL1P0SU#,@T,P@P5 &0B1 `P 1 h L0C R P!050%Pd @T: ፊ 0 p[L0CY1T*Q@@,,G-QT0Si:\0`S& 2 c@Oop @d(0d$00@X1 0S. S0 P B H %Q * RA  0<408@S1:X 0p@D7C 0p03 c0?o< @@D@  P  OP ` @!0 a`2!! !00p30P,,D%A-p0@@ `P PP0`0P P@lH%Q *0S  ᧌,,$00S:@-@@X,,@-PP` U(0SP@P )@T \0@嫍T0T 4/&ƍ 00'0S 0 (( @Ѝp,,D%0LG O-$M@PpD00T0SdS )@TPY P3@yH3H 4/Y(0S p0dpY`WT0W$@p pp0Yk0 # 30f*[`C`fQl: L@P7W KL ) D2 10Z 0F30 %0S6*0S  0@P1'0S 0 0@n$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@0 f`[x [`K``fpP @P0p0 KF K0`F@  L @ %Q *0S  @,,D%0yG G ,@-M@pP,aD(0SWTP )@T: 0@剌0 4/0#880 ,P0U: @P  G'0S 0 |( @Ѝm@P %Q|0S0S Pq 00,,D%0G O-@QpL$M(0S@ P x`(W .0PT\\0T**P* 0`0  `?oo 0c `S, `P T 1q*5M'0S l p@`^$Ѝ4 T$P030#P0S X 200301S%T#2QZ E*0T00S  Dൊ`P 00P`P0 0#  0|0S0S @ @pԆ,彇`0<0 0 p`  `P% 0    %T#2QZ J*0T00S  DaVvꦋ 00FP )0S 00@y,0, 4/`P,, D%,0H @-L0@'0S 0 00 0T Ѝ@Ѝ,, J////T%/T%0p00/$&0p00/$&0p00 /$&0p00/$&0p00/$&0p00/$&0p00/$&0p00 /$&0p00 /$&0p00@/$&0p00/$&0p00 /$&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/&p0 0CSp0 S P0 /p@-P@,`縅Pp@ Tpd!!0A S010//d!!0P/!R/P/P/Qa/P/0p000 /$&P/ 0S S//@-@!d0p00/ &0p00/&7@-@PD@P 40R0PPG80  Ѝ00 gH x &PQ 0S///% 03P/A00 ACP 0ABs0P r CoSPS//00S00/!&H 00S00/!,&H ///@-@H,@ZP (  @f}x &H-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A 00ЍQ@P q@p@-0P `| @P  \*. Q  Rp R  (  p 0 B $&,qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00w Ѝ0S/1>3 !/0S 000/,0S*p@- @PL P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!~o0`0sA-0p0@P`M̂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ00 |R 0S |0 3/000Q R R0SQ|P.00 R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ,A-PRp `@P 0!ᕆ000A-@Pp`0 SW' WV00S񟗋꼚ĚĚĚDDDDDTPDDDDDD<V VjpGPX`ч1 X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0PS Hp  B0s  B`NpGP`Fe`AA-`@0PS0<R"1 21<0S 0R0PP0S! !x000S!!!,p (I0PA , (0 ,P& &&A-Pp0 R*S\ ]\ t`@BX T '0PexP`% R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00, 8 0 s000/`Q'Q!//$&p@-P@,`5P@tp Tpx.!Q 010//x.!,1p@-0@S0<QP 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`& &&O-P 0R@M Y/ P&  R/ P 000Ѝ 0@  HPP ЍO 0 PS@ A 0 00<00S*^Q000800R ]R00-R f0S* ]R Q-R\T0]Sh-Rj0 Sv:0S0046000S8\ 0000050S0pQ_S ,0Sd40Sa$0S^<0S[(0xW b 0(`c0@`F p@ ŃUh 00C0c-R [RQ :R =R 0pS:  0Q00`S0`000-S]S0`S0`0h4 R*000pBW R:0`S0`00 S=*R: :R7 ]R400A  ⩃0p pBwPℳ 0w S0<R$ GP    qP  p$0  0$ 峠0S00``0Q00`S0`000-S]S0`S0`0= n R:0`S0`00 S*R =R ]R 0S0 -RC Q@]Q= -Z00  W2 0S- W0`S 0`00S ,Z00W0S Z4 0EGP  pwp400!0pᲠ40 P0S 00000 P  P{  [l 0]S!`R& \0s0 0 0 EB#ЍOH H &,$&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@$& &&C-@PPp\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  tHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB Pt p G 0D OX &(  RPSxPA4#X z 0   000`020+U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP   B   B0  B0V0\S0{SPP0PS<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S `^0<0S 00$000*Xe .X< 0e,)>{^ ]$&@-0@``P?Q $0As R Sꬱԯԯԯpررԯԯ^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )w V 1L   0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   000p030` 0V:0S003000 <Q >Q q`xP  &  R  #+S  *Sg 0S8* *B?RP {R1 Q. 2000' C#,Pt 0S 00h2Q 0   0R  0 `S|* ,Ry  2000< V0 R  !   f0 S*}Q00 0RX}QR  Q +S ( 0  BL  B   B0@  B~?S {Sz   B0.  B 0  B#  B  B " A 0000S 00000,$&^ ]0S C- `M pQpG \rpL@P 6W: ЍPPP P $PPxP @P0 uPP 6   00 0  $ ( , 0P4 8 < @ D te000G R:0S005000 S3:  N 0A0KCP  #00Q p0 P>3S! 1St Sq S <0RpQ00< 0o (  ySW S<0RuQp< 000p000Q S S SS8 S S4 +Sm >SQP>3S S' "S 0SU\ S: ? <0Sg 2H 0@0 @010 0  N0S lDPR, 0E10S*`P 08 BB0SE0 1AS*, ^ R0C*@ Q U B!U \1LX0R#3S#^S!7Rl80SD 0>Q Q QS 00 0R 10C/TUU8ةH,Ee,1p@-0@S0<QP 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0ZP`& &&0p@-0PSQ@ʡ@80P p<0S P pL0@0t@@P(00Ppp@& &&O--P@pMLPئH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T +P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0l30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  CP?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 CP0 0 N$&\# (\ \W \E \O `P \V \[ P <\[ \ \G \02\ \ \6 "\Y \F \ 0H \ &\{.\$ *\ \0s0S \ {~ ^0s 0@0s0s0S{0[00>@4N5>5. P`F`FV00@>N>0> \0C>!0>#0 R@x @O-4M0\0( 0(0 000p 002   0 X @ Q  0 R)  R # `Z X!,    R  $  S  R  V  PP$ X$@1`v X PP@(@ xPPP @(q P  @@ $ X0  QvW PYst va  r _V R  !    _X RG v@(@X 0x  v% YPt P vI_Vxtt xLt v _`V `R`V t@@ v(  P Px Ptv x N_XN 7@Y (@X fY0txPt, xt v  t v  r   _X_V Q ( X 10 _X @jth v xx ,    R (ZS $X $ 0` (ZS  P 00004Ѝ0S0 0x~ @P $&O-P`M80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R >sp0 c800@ 0 ZZR  D>sp 0 L800@ 0 CZH  D>3 1> Q p0p0800@ 0 p'ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPئH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0l30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  >P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 CP0 0 N$& ^* +^` ^g ^N ^_ pP ^k ^Y  :P ?^t ^ ^\ ^05^ ^0) ^D "^{ ^h ^ R i ^0 &^y".^00 *^ ^ r R0 ^ y | \0 00 r0     0s0s0Sy0 r RY 0>00 E 0000S0R0SpG pGPx0 00> 0 0 0m 000>301> \00 0>000 1>3 SPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R >sp0 I800@ 0 @ZR  D>sp 0 2800@ 0 )ZH  D>3 1> Q p0p800@ 0 p ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0VP 0P  `pO`p 0 PE >#P  0T 0  0Q>SP!>#"RPEPO--P@pMLPئH0W: TЍ!>3S # S~ S S Sp  p0Ga >#RH0 00 P>cpSd Sp So & S *Sb &S0Sc 0000_Q0SX 0S0 0SO*0T _0S 0R0S=.Sd S 0R  _ R Q RT P o_QP R00 00_Q _P0 T 0r R  T @ T >P0S0 ^0S00S0 0S*0S0T S0s0S 00S00S* T00000_R0l30   _S R  R F R * T_ R P R9 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  7P?0a !0R@p0A0!RHH A>3   0GrP 0 @ iPw01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 CP0 0 N$&Â!!!0C@T0 P5#B0$!/#1ep@P `p0X P 0@$Ѝ`d@P$$ꙙ8 Q(\)\d \(\@-PQM@(p,` U00 V Sp0`aЍpw`S0p`ES-00Ѝ00 r0`0EF00 r0p`0>0G-M@0p`W PV P%Y P.X PmZ PNx P4 P VXWf  OX JXV+  CX >XY  7Xt 2XX5Z! L 'X< "XIЍYXZ-  X  X  X W'Ѝ W WZVY  PЍG  ` X 0 0  ` ( 0 G-PQ00R0p`ᤔ00M 0 ƹ@P @0S nS a0CSsNU2  0oSm ePN ЍePZ V000U000eP[Z V070U070PePZ V000U000ePZV000U000ePZU000V000zePZO V080U080i0@q@ePZ: xeP reP leP`ZL V080U080?[ePo UeP OePJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000leP TdP  | \  T   0 L L 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  p, 0 ip@ ip@  p@@@di0 P~iiPi0 PiP`Ѝi00@O-1MM @PDL 8 "( p C. `pX@D;@8 ( 0Sl pp  ` ᰑ 00㨱$ %0!`\p@ t0!0 PP ^0S R,i001ݍЍ%i0S 0K0S Ra P)p 078D<4! @ P0 00Z  0*0h,R <~1ݍЍp FtH gt0@-P@M 0  POp #Np@ P m Ѝ00 0Ѝ0@Ѝ0A-@@0s/ FPP0P  0$#p` ` `0`0h0ppX`p h``0`0h 00p@-@PCM1 /5ZP3 ,pPB ` z@hh000t2 06{C.@ F {P4D@ @F!_0S VS00 SCލp@@0S h@h0h 0P@0  P@1:3h?00@-h00 @<  p@-QMP4@SMY TE /YPB QP0s+ cP QaP 0`u"pG @ 0@_qp> D jp7 ۍЍp)0si/1p0 +Tg@0 P@0 U P@1:g?00 p 04g0#S @g@g@+p@ g00P %@D|8 @ @-qP`O-$p(W,P0-S`@/U'Y1 ? 4aZ0 0.aP :[#J P?5#I x@t4 2px 2BzPYh@rUZ0J[% 0@-DM@ P, Pnm~^gkH,T lT0XYP` 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#$0S`@PH" R"  " R,"2!x"~$0S"x`@s0`@0m `@20 P $:($^0<P0 0=R( ( @%0h00D0c 0G\ 0$p!#:6 00 0.$0Ϡ.>H!! 0!!!^0C 1(02 >0. 0,S$/2"́ ?0 0 #1?B!   0 $0S(, 0Q 004 0`@08 4 q\  `d'8'l""""'.%Q(\)\²(0`@S  R $ R `\ :6$4&60 Ϡ!$0! !>0!!!0C 0P ,"΃0/($0?,0S00#0S<,000, ,00Ϭ<(800$ 0 #1?B #: 6 4$&60|!$,$0!,>Â!!!0C 0R!,"΃0, #1 (, ͌ , ( 00SP0$ 0 0T 0D"0X[R0`@00N `@l2t0 P :P0 0<R$0h000 $`@  0 P0*^*{ r0s{P T80<`@ 0dR0  \u Q $ Qf$ &PT8<`@  \0X000 Q00SLPT8< 0`@D0`@0  0C0;000 @ 0S2 0 h00$%`@0 @0D 0 0h$% 0S 000000$0`@2p rp t t `@  P00  0# D%`@D000 P 0S %z`@D000 P 0S!D% &j`@000 P 0S D%\`@D !V 0`@ D!O 0`@ !H0S(0S `@60P : c 0 $4Z $&,:6 00 0.$0Ϡ.>'! 0!!!0C  0  " R Ό " !( X'\$?h#" ?00 #1?B!  ,,  0\$(  R0# 0 RO#PKOI RF  \Q:%8< &0dP(003( :60 0!$Ϡ0! !>(0!!!0C P/8!#? /" R  " R $ $0  0#1A0H h0 0%L 0C00000S P0 0   0@0\$   C00 00S ^ 0 0  0dL  X* R" O-Mp`$_0LL0{_0W@0 V. 0 2c1 00 80PP/ 0v> 0`0?d000P0?T0 0#?<0 00$$%"`˟$` 0000  000V ;0d0PX 0TPK dPI$`P0Sʼ Rʨ R ʰ R  0 0` 0S0`@d?O$@Tȏ(ET0}N0`@d00^ v^D@pD 0G080HXP0 00 PESQpSp pPQI| 40 dhlptxPV@pS[R  R00d@x0Ut0Yp0 Rl0Wh0 Rd0Zxt [$[8P0>C 0C 0p00@t0` VP x0S ^0ppt0 00@ d0 0Pd x4( "ό R t0"! R RWv 1p?'/!! #./ B pW ?,?.P P00#1 ?<v.C BL\Sx  Ptp Pp"^ 0 qpp 0qp^0S@T` VP|0 ?oR20S]00ߍ!]d@!qp@P   Q+10!R@'NS$ \TPd0 P0,Pd000 0  ZR 0S 00@ ]0d@ `]0S  0X0ZS0 dd`` `0dP0? T00d80? <00d@0? D00dH0? L0X$\GZP @@[]0S? E/ßs"bW2(:##c2S" P$m8PP 0 \ß0dT0>@30@92] 00P `p@ d0@jP ? /' Rß&0Q| 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. W#0,jpW10' #ΌQà3\!=30S 0>! B^ ? 00 0qp8 @(pC\#00\0S>@㴰0d0@괰[0"c01 2c1@TÏ!\!Q  s!P \T00\0S10'` #ΌQv\00@tp\T00[l\T00p&|l0)\P(\ ףvɻ %I$@-@ LpEB?Tmat X00 R 0 R 0Q/  /   x  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/x ܛ H  Q j.0 0#  Q/ij00Ɠ\ 0@-pPo> 0@" \ 0 /lA-@P `p@P@0% P PPA-\@`@P pjNP@0& mP PPlA-\@`@DP pH@P@0& RP PPO-P M FpP9 谟P n`P P @@ % (P P0S  Ѝz T W M  FB0p0Sp A-pPQ `@Q P 0@DDB(000S  pd@@- M`pPPp) Z 0 0@0S Z0"S" 0p000S0 7/ ЍZ0"S1Ds\0pT000S @ Ѝ1Ds$ *xĪ dT @-@& $@!O-P`U M PP2SpPK xP@N P K <10`0@P6 0nS# ==LPP00Q Q MP R  \0  KB" 0 0Q@00oS@d000S p Ѝ4 P LO-BMM@p4Z@0  0PP:KPP  PPn00L6P PC @@`K=#0 PPEp !0P0 0 PPEp \n@P! H 0dSPkPU0 P p` kp}  0TP L@PP0 PpS 1Q P- +Y 00BލЍP/U ` P p@Y0SQ  }FPBލЍ sF0H0PP0 :Ep=  3F}Y00 P 0XFd! 0 0 0iY0<0  0EF]Y!0 }༤\00'DY00 P 0F}8Y00  P 0Fq,Y0\0 P 0FfH D \ H zd@ ؜ h Ȝ ` H < \ -{M 0 { DPЍ -{M 0 { DPЍ >-{M 0 { DPЍ ?0-,M 0 HPЍ0 --Y0$ S   0/ 00꠮p@-PEU@pX?( ( 0P 5/p< p@-PAEU@pX?( ( 0P 5/pحd @-T@P 0003/ꈭP @-@P 0003/H p@-Pq?oU20S@ 0 0 03/pИ p@-P`{UV00P00S@p$ P05/p般x p@-P?oU20S@ 0 0 03/p,H p@-P`@PpX(@0 p@/ܫ p@-P@P p 0 0 03/p舫 -@- M  sp@(0(003/ Ѝ@ Ѝ/0 @-sp@0003/\ O-`$M ؤP @~N0Sp$ЍW0,P@@  4/$ЍDЖ O-`$M ؤP @0Sp$ЍzW0,P@@  4/$Ѝ蘩t !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// ///////////////// d l H 8 $ Е  l X D 0  ؔ Ĕ < 0 $0(- C^ 0CQ$ :$0S3 57 $05, 0$0(00 # 0 $0 0@-@$ MP#055050%A0!0%P$00$0Ѝ0 $0R  S,3 5,07$050$0/S<3 57 $050 0$0/0S/, p@-R@pP$(ASp0$ R>3057$ 5 $ !PpO-`@VPpDM@P؆, Tp0@ U p 0@P UK UK *V,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R#00C R00CT,@DЍF, 0R3057, 5 05 R, S# 0C 0S 0C 0S 0C5$0P$p 0@V@B 0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S>3 57,050,0@q`V  FV")VX*0FSTRQPONMLKJIHGFEDBA?>=<;:98bV1 ?R20S/ 032 b0 B12 00@s 0 00Q,  P0Ç0,  0, 0Q @YfV ?R0@SQ  b9@S B88 C c3<21FV 0, 00 R Q05 705,5 0,0 5RQ= 305 7,5 0,Sf @ 2$01$0@@@0TS`VI2=0F?ofR20S00:FoFRQP Q P=V, Q05`7,505,Q,0 P,00,0Q  1@ Rf 0Sc @[ @ 0PW  @ ?RM0@SJ b9 B88R00F @00R%#jo%#jx%ju-M{0{0 Ѝp@-P`M0@ 0 4/ЍpG-PRM[  `TpPC/a@EP @1000< pp. Ѝ80S&  1 000< ppT0S0000< @ ppS0Sx S0S X 0 < @S00S00x H  (  @-$$@M ЍO-EM M`X@P+p `E@ V0P@'T 0 V0P@T| 0 .0EAP L@ H@UEލ ЍS00S00w @-@` pMPP& /+V 0RP$  rR$   P @0C rR  Ph 0 @Ѝ0 Ѝ@}0rS DS 0  A-`@ Bp 0P/S /UP @0 Sp 0 S 3: Rp@-IMM@`PP op 0: S X0 0up IލЍpRO00@IލЍpR00 p@-IMM@`PP Dp 0: S X0 0Jp IލЍpRO00@IލЍpR00 -{M 0 { a>PЍ 80Q 0 080/p@-@PP`  #PP u FP  p@*PPp--00 M (0  ЍЍ/`$--M  Ѝ Ѝ/ -- MN<P 00  0 ЍЍ/$0-@- M@NP  Ѝ@Ѝ/O-,M `PRpp00:Q!0P00Ppp0 0CS PY P@ 0 @YP ENf",Ѝ$0p@-(M `@P& (Ѝp0 00 $p@-`@PNpp p@p@-(M @P,0, 0 `& (Ѝp$p@-@@ @  `  @PMpp p@mX$p@-(M@PMp `_&8 \(Ѝp@-@PT T  ,M` @Mp pD& A,Ѝ$C-,M pP`PEUP0R@@t0 0:2 0U @P0 @!T M!,Ѝ0p@-(M `@P% (Ѝp0 00 8$p@-`@PjMpp p@p@-(M @P,0, 0 `% (Ѝp$p@-@@ @  `  @PAMpp p@{$p@-(M@P3Mp `%8 j(Ѝp@-@PT T  ,M` @Mp p% O,Ѝ$ Q 80 @-880@M08 Ѝ880/DD0000 0<RQ 80880Ѝl/0@-@0@0 M0S 0000 X0 x0PP X d00bB/P00 Ѝ0@HP, ${ { O-d3M0@ 0P S^0 `0D!p@[ P P00U tpp0 0Cu Y 2ATT00  RH LD@D T^:[ 2 0000`K aL0 V0 W9 @2ATT 0`Fs 0RC HL 0 j 0 Bd0SH 4L@00Ѝ V0& 0 M !L 0 C0pHXG0S? 06  Lu 0 B, 0 B%@ 0 B  BK`FtZ  0 B  BK 0 u 0 l K 0 | 00 d$p@-@PKppp@ 0RS00 /p@-@<0<00P  @Kppp@ $808 00 Q0R00 /$p@-@`PxKpT T   p@pp@-@P\ \  ` @[KpTT  p@p$O-1!000, S1H0? MPD`d 000PV1!p !q1 W0C@(t  ,0@@KDA Œ Č Ȍ A`| Ap4  W R ? \ QQ Wt ,0 000IC1100Q00, Ũ Ѝ0|0 00{$@-000 000 @@P80@080d@-@@P80@0800-M  nЍ0-M  ЍO-ϟiM QP@̑Ёqa P? `K͌U PH? K͌T P? F͌(1S P> F͌(Y qPp> C͌ X _P(> JB͌8W MP= ̌V ;P.= ^B͌`h=@ 0S078L H0P$ `P P  P P Px PX P4 PP( QP PP (P PD PxP'( tQ780H0x100C40S000C,0h0LP 0P( (0Q0Pd  , P `P X hU1q @a0T0 @eT, 0X  p @dQYh`@0`@ P`'  V U `0P1A1S  ,000@!1S 0D 0| 0?piߍ00*P,,0`L0!!\\, @  B  $8 P<`@ Y& 00A00@S= 00 1 `V P`V ,PY 000 `,0匰 0[p$0p1`㐀0@@p`oPp  W 0@0@S  P8<`@P(04 0R(0LPP1@00S@@X!(@L 0S00!$0P [T0S0 0 , 8P 0BX00P0 P< BY 00 O0 T ,q` 0q @PV f`Xp0@  P  U  PQU,0V00@ Pܰ封[ P@0PP  U `X0pP @Y 0@X RY0,0P0  0, H V 少[0D|Al>`Fp1P^ @ 0PU 0`0 0 0[0:ꈰ  0PU;P  0@TP=Q @ 0PU? @ 0YAJ @ 0XC @ 0pWE,  `4,  B 08P< T$,  p , 0 H T0封1D|a=p@&8P 0<04 ! , B BP   $@ 0[X T[0,p`p0q0 0q08@<X\PV f`Xp1@  P  U  PU,0 V00@ P封Y P@0㚼PP  U `X0p8@ 0<X\P@U.[P,0 CT', 40p! 0,0 H0T 0q1D|a=p@P 00 0R1 (0SE ,00p W 0g1(0pS3 1@ a! @0T0P0 @zT,00 ` @!(0R1@pPB 0P@< T  0Pp 0,0 SR,0, 0B ` p0 W" 0 0B00`S9 0P 0Q!1 @TQ @&T,000 @,0,0Q@@ఱ>P`p㵻 PP U  p ` $0S; ,04 1Y 0i1$0 S- L 1Q!qD0 @00T00 @ڽT,0 0P @Ta$0V1@V T  0 i0P@,0 SX,0 00C @,p0 [# 0 0 B0!0@SC 0T 0a!H 1 P U a P命U,000 P,0|!0RP 0P1` @!0P`P T  0 @  h50 0R80000S 6O-pYM|Cq0cS@` Q 00L3?K͌ 0 0v0S?H`3K͌ 0H0w0S?pp2F͌( 0p0u0S|?Pl2F͌( 00x0Sp? 2C͌  00z0Sd萍 1?B͌8 00{0SX 1?̌ 011s0SLN 1?41@BM@0810 PYߍ 00v0Sk H`w0Sv ppu0S Px0S z0S 萍 {0S  1s0S N 00@-P@L0MH( 00 ,0 40Ѝ0h$0@-P@L0MH( 00 ,0 40Ѝ0$T0T 0  D@Q 0Q(00?H/$x$ D0D @ 0 R ,  R$ 00?H/,x$A- 0D  0 R  R' P?UH@0aaS,p10 0D C  (  \@T@T 00x$0 00$\ \0 0H0S?30 -88  D\$00D/x$O-0HS 4M4ЍpᢼPH D0 0 0L|!09|@叼P` `0D0ZP`@0PZ0 TP V@``@|:L ?3Q 4Q<  H0 00DpL |"(099`P0S R@,PR @0P 9 R0`S4ЍT `@004  0㺸`Ps @|`4x$0 00^$p@-T0T 00P0S @PKpp$0S p@-P@P5pp/-H 0? 00S pp0 0 S0| DR0  0R0 Sx$0 00D$ 00 /WO-tRt2P0M`@V0u T":L"@"4"("2 2 $ 2 T 0 01X 0 01\ 1 ` 0 01l  1pmp0p0npp@z20吲0唢園 $TX\0` 0lm0n Z1Q0'0 0 0 0 tЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000 hT$C-餂pP@M 塸PP @@{ d"j =@-ÆBBB {`@C{@@@@\PV CH pQ /pL 0p R] @B0 @@@(P: 0 @@@{(P/ p+ #p' p0 @@pg(P  &h, &000S :3S RЍP SZB2T @TIGPЍh0S,&=pP_ 84TXM A-Z`pPp &ZB2S @TNX000 R A A h@-lQ+ P@E0`XM_  S- <1^p0!!!!v : !' !_ !| !o !* <#>4{!*prQ>{ R 81 R 0SЍQ L0 0 0Dl0T0Ѝ!ftQpp<^v8#:0'#z #H#p-߷-ܷ`_ٷ|ַoӷpзrͷyʷzǷ{ķ@|h}㾷6A-``'^` p @ 0^ 0(`V(PKO-`ܶ6 6M000ƟJҭp6 0000SVF ' p ;p PP[ L p?P4S S S|V0S%pPn 0@l   $ `00 4S 0 0 40 s 00bR$ 4S4 0P%00Ѝp PP 0 04P40 s 00bR4 440P ?21 R R0 ;0 $Q B q 0 ;0 pP.4 S S040S$ 004 0r0  cR$`S 404 ` pse0  ;0 p PP4P0u0PPcRT T4S{0z$0P s 00bRS40 00V0SipP 0@  ^ $@ `00 4S  20 zS 202 `0 pZ p 0$ $P0 s 00bR40 ; 0\p@ P< pg 40 s 00bR4 4$R2P00$0C?o$ r  aR$2&100#?c p p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100#?c0`00$P r  aR$ $ Q 0000 4 00 40 s 00bR 440`00\0\0! 02~PԲp_L_H_^Qp[ZA,Y= 0(  0 + 004 00/\XO- T 4P8 `0$Q@DMh v :Q{#R3Z 300S 8 0&1P0@P@P@X@-@l:P @f:P 81P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o"7 7 O-08vSp@`M$f`ZP gT0 ʍr `r 0I"R 3S(0$00 0:7PK T07P  0XSd%$ X% 0"L5`0T <504S0300SL p0SI 4SC 4S 0t24W】匡Tp2 >PN 4p2[  LAT `P P @oX4Ztx2 PX 04x204Y|2 Pl 4|2hЍH5S4S~ 4S0?o20 D p$h l $ <%$(lY Z9P Z S9P [ L9Pp2?;~0p220P_0 rr 0H"R8YD  ,9P[2[x2Y  #9Px2?;~0x2W  9Px278x2Z  9PL2|2[  9P|2?;~0|2W  8P|278|2w1S06 4S2{L%R/q[W]  8PXx2!78x2|"[Z[(`1M80<4 |2O[W,  8P'x278x21|29p2[p  B/oq`R"n000#?c Ѝ 0X0X0 05,8  꼔PAHADA@Q@># >G-0S03P`@PZ 80$ RG V ʌ3S23pSmW " Rp .8 _,Ѝ0 0-M 0 Ѝ-@0@ 00M  ,0P 0 Ѝ$@-Ph0h00 @M P4p p`, p @0  Ѝ蜉$@-M@Pn4p p`, p @0  vЍ@-0M@ ,  00 dЍ000 00:3S e/ᄈO-0 J3\p4Pp M2.haP` 0pp .PC6od3τ  "   dm l  pb F?⸲_ 0ͭ2Yn?~ 0`~ 2bvP` Ѝ0 0 0 Ѝ Tp@-D@D0@Ppp (0l0m 00 p茆Tp@-@0@P:#Rt t# R- # 0pp,P`p{:p,hp@-@0@P :Qld^p- pp#P`pO :|hp@-@0@P:#Rt Ó \ "R-- , pp#P`p%:pԄp@-0@DPSP @p (0008 <@%8 pp$$@-H0H 0@0:#R#R"#0:̃@-`0` 0@ :Q Q- :p@-0 0@ :QQ σ #ppcP :@-0 0@ :QQ σ #pp;P :\p@-0 0P@ :QQ tà Ãpp# Pp\ :hp輁@-0 0@ :QQ σ #ppP`4 :Qp@-@0@P:#R  #Rp @8 “%\8 --  pp#P`p:pp8 :`$@-<@<0@00:3S 00 x @-8@80@00:3S00$ @-0 0@ :Q&Q)   0,0̌,͂ $  $ "p"p#GP` :Q~p@-@0@P0ʃ#R(#R+ P-0 , 0  -0,$0 0$0X0 R0pp# P`pY0ʃ#Rp}hp@-@0@P :QQp!""p!"l#!l#, p p@#, :|hp@-@0@P :QQp!""p!"l#!l#, p p@# :L|hp@-@0@`P :PQ! “Uƒl\ l pp#P`p :Qp{h@-@ MZ(qQp* c0 y0 `00004 0000408003 Ѝ 0< 403 ЍL L0 0`0` Vj#coP`z@ 0 000:P/y@-0 000!lyT0T 00:3S 0@-pp R*P`/@yX0X 00 :3S 0-pp@- P`/x$0$ 000:#Rs/tx$0$ 000:#Ru/@x000 000:#R s30/ x(0( 000:#Ru30/w0 000:/wp@-P0P`M0@0 0ss5p 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝp`wht@$$A-RBP0@SMw RP 0S `a 1 P00pppO 10Q41 1`p0V0S  z|100V0S  n034ppo) 03, pp.W%ЍP  QÁP 0: 0 `x   000 0020 0@200#tvp#ht@$D@-,@@0Ss200@!@-$@@0Sd200!@-X@M@ 0S Ѝ< 000 0020 0Ѝ $@-h@M@ 0SЍ 2 0R  (00 Ѝ 2 \  @-@B@2@P$MQ :cVT0r3ppp(0Saqp 0SO1p0S@ k0  B0)1`00|PM 1@ 300 R 8 C 30 0X20%0 4 :3,pp4 P`$Ѝ0`00|P @ 2 0R` 00 `100T @8 200 1rlpC- M0 P `  U L@ܹ<0@00:3S U ̹ Ѝp p 0 000:3S/BoT0T 00:3S 03@-pp'P`/o@-<0< 00 03, ppxP`o@-808 00034pp'P`n0@-P0P0@Q0 M0 |P 00 02t000*$ Ѝ0xP <00 0 2,000*C$ Ѝ0|nl0@-00 P *C MT  |P 0 010* Ѝ0@$xP @ 0 010*C Ѝ0@$ Ѝ0ml0@- 0 @P0:R M P% P P Ѝ0P 000 10z$ Ѝ0PtP 4000 Pll0 000:k0S,01/Q&p@-`Q00?`FV`V` ,P1AQ (@0 ^0C0 S0Vpp/Q&p@-`Q00?`FV`V` ,P1AQ (@0 ^0C0 S0Vpp/\ 0,  B0/\//0@-PU,NQ (@0 \0C 0S0U000@-PU,NQ (@0 \0C 0S0U00Q=@-@TӢϜ4@DT@T,p@*P U``U`( P ^``^T!S(`P``` VPE P UPT/0 p@-`V,@@Da QP(0 ^0C0 S0Vp(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@s!800@-^0\#, 0 B\ 0 PU0,NQ (@0 \0C 0S0U0^0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0,婤Pp4S-`@PP3@ 0 00p) ,4, [ 0   0   lЍB0  b9lЍOn/O-:$M$pdZ0  r$ @T] P 0p p D VH&:0PSE  0 ᫣@Pp$Ѝ @ P0S S6 SpUV&0004S$ЍODp @0S F0V  B2Rp  `Fp=-U `F -Vp  p--@p FPPQO-PM 4 3`S,[*Y= @00! 0@ @00@ 3 TP/ { @p ` PPE @0S  0 )`PЍ` D  P 4A " 2:Ѝ @0 0b|(A P0  0 /404 000S :P /`<0<0 0 0S :P /P`404 000S :P /`<0<0 0 0S :P /_404 000S :P /t_-DD 0\ ʌP 0 z,_@-|0| 00@T 0J#4R B0pQ 7@.P @b^808 000S :P W/H^D0D 000SP:P4@//^000 000S :P /]L0L 000S :P @-p @/l]A-0 00pW* Z3$SP! #R`@4Sp`3@Tv AB0tQ k7Ax- ]-0    p$\000 000S :P s/[O-00 0 MX% p `P 0 p @ОP  0 Pסp@ 0 5@  Ѝ@[P  P \/p@-JP }3S P`4`30PV  0s3 S 0嬟P 2 $R 0X0S 0D3 20X #$04p03ppp@-jP 93S @P4P粠30@Sp@諠A-`PY JSU#X p8 @R 3S$ S(XڒL0AQ0, X0p ,01B0010χL10|10\ b0 0XP 3PSSpP4Spp3PUpp@-@P PX0:"C0T0XppG- ؀\/P@p  `AP LTL VW PT WV  P000S<080 ,0 0 WxO-($Z Ap`PP@8P ( (*T2P* T P 0 * @00  *0WXT P  RX8 @(  !B*@0Vx @-?S Pp0   0P @T1`a p@^`  0000TU0A- Q@PP% +pW# 0 0S0o,m000 R   R   R  P XV4R`T `TX *P Q Sp  QW027Tp@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S OP00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0pCpTQH0H 000S P@ ?# Q@ 080//O$(0( 00Q0/O$(0( 00Q0t/TO$p@-P0P0 0@R`  0<000DH00 RI $@5<000h0S80@0805 H0$00 S8$>( P0@$0, 0!0 s0PT) H00#8 @ t@T,0Q0@t@T40$00S-H00S` $  R$ ,0  HDS400,01  00Q 0 0P$0qQ0,S$00,0,1 0000 S 40p08L|@0H00D00Yp 0SL01H@400 0,00005,00 0Y0Y= 00S 08` S0F 0R4000,00 1 1 01IY0Cڸ/o<"L\ R Y@L0l00PP 0 0 SP P+0 0S0R0S 00PQ ɟ`V0 0CS;  S<[p 0 AS 0 V P0P ` P R  0R^  `t9(00S)< Q0C0!  0Y00S3 80 u8( 0`V 00P0 0CS 80 @@ NN Œ Č Ȍ N LL\80ɟ`V8 L0T T<00D R 0 R PP(! [R  [ $R  0E0 p0  0E  <000$R ( h7  <0@00!R ttX 4000Vn0 0C B!,0$ 0S$000,0 0S(00 R, 000:3s D  RD  M46( 00S70X *1h"0R( 060 0 @ `40 , 0U Pp$t000 @0p 1`11qW 00S<00 00S 0X *1h"040V @ 50S 4( 0pQ0A%0 0C03ꈄ 1D0L 0 S P 1 11RY@Z,P RRQ 0    #( R R% !#`FPA p0p`P@ !?3 pGWaFP `/0 < p  L  P 0P0P00 PP03P0D0TS H00S $080  400  H(<20 p`\Ѝ $0 0zH000S1( 0<000h0S$09 H00 R d1Sq\Ѝ4080 @0 80%P00C\!H00^ʢ00@ 0C9 08 0$ x0S7 p0( 0, QA@` `4! ,\)@XP pxd0@(|{ { elpX@P  P0@, QJ   4p@,@ APWp@PT ```TPp P @0`, AV4TDP q@DH P! X @   \`Q  ABQ`P P4 BQO p @ p  ,@0 8 R pP p , [!, !`k @@[`c zP p0 WPb   Q   P p,@08 P LPA\H0$00@d0`, Iy8 @A[0,  \ `$@00400  `40[0 pWP p p P  , BQ 0` W G 4 DP @P | 40@ PL0Y0I D|  p0UpP:W W@ P \@DT GpGGlE@N0 0: 40Rpp0,@0C 0B0W,0P 0pp000E,0 PU U R0a R  W R RR.0 S0@Z 0 RAA 8 LD@ ,　H@X LD 0B0 B 8 B!! 00C0U40P0P,0a0 0R0d400,@\@ `*`vQI RF dPC  %@P d1S ( 7 ) 0E0p0 0E  <000P |8(  <0@ 8(0 0,0 0000S 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  {9( @` 0 `R( <`@0 0PL5S 0 0RU d>( <@0 0Lu0 00 <0005( >@ _0 `C0`  <000tW  I0 U<`? 0 0L9P6Pj <00 p*U `ʕiH5Sp@TL 0 `P@@U= 8P8P ` =`l\p@-P0P`@0M R    80x t00 0 000P80  D000! B/ 0C?0 0 Ѝp0 00$C-M048&lp\h@`Pp\P  Ѝe80 8000 0 B0C 0/? 0Ѝ@-@P @TG-1!00`0DSHp0?sppS-, P !Q@QT:!80|0Zp@U0 S00? P R!R0 S~  0 00$ 0R 0R0 0#0  RQ\ R RQ 0P // /p@-PP0 @ @T $U0` VP `倁Vp`"0P 0@PUpT` @hT @pp  ! !@-@P@RT R/A-p0,SP` @T @<T0`SP R0Q/ C0A "" Q/p@-`Q(P@0N "" S0 "" S \ 0L "" Q\PV@pp@-@@@0S DP$00C$0>@O-x:xz0t*Mp$P( ,pP @*00\` S@@s  aRXAkHQ00) 4 @Y @B@0@T ROoB@TP `NNQS0)\ 0  |  bR\ L)` R&<) R! CP'I@, 4R S[80S 0P0$  B$ X@0C, 4R CPf S ^\ \( 00Q <80, 004(0RJ0H 0@0( k $P)0S700S00l0S# 0 S , 40R#0l P, 0S `P$0CP$D70 RЍ (70( M$(00 SBFf@`" & (00 S4$&P0C (00xP0S  %P$00C$0@d& X&0 ,@(@ R 50 60, 40Rp F f@` 0 0, $P, 40BR0S(0g 0KQcڤ%%  p p d% 0(@`Vq@nR @D%@ T ,00P0S 0P0$  B$ X``Q 0[^[ $ | 0|$0C ,00(@0 K[V p<$ , 4,! ! x D @  ^$ $@$#0 P(0i0 Rv ,,Xqa00P* x# 0 l# (0$0@ ?3S0V{( , 3\0$7 (000P )(0$0S p 0P0  G@$(0lP " 20,  , n40 S ^ ) D20$ ,B@0S 0P0$  B$ $ 00P0 ! 00(@T7ڬa` ! (@00T0!0@Dx P(@0S  0P0$  B$ 0, )a`0S 0P0$  B$ 0,  TܐThhTtPH܎tT (h0\(d$܊<L0tXDO-hsh3pdC@00 S M ~400040(c`(,P Zm34@ 3`0T&"0C S402PK䢟  50@DS(00S00lP 0S 20 0 204@,P0T0hP XRP0 @P 0( 0CS P 20 0 P1040 ,( Ѝ00S00h0S00~0T100 @P,P  <1(`0 R*T$!P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( l0  04@SSCPE@D4@P,L 00SL004PH hlT4@- ,(4 00Ђ@-  ,(4 00蜂O-p1p!0 h *⨒YP!P H!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU,@0@DaQaS@00 0 Q  ST 0U0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/O- MtuPp) h5` 80s,  S̠DD Pr 0R!1S5@50  50 `\Pᴖ 40 0s0P 40 0h40 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SK\Q*g^SrA Q _S~VZ]9 Q gSf2 Q 4SSVi^* Q j^S! Q k^S Q gSf Q[-S 0Y[=20  0S0*Spt !-=000 0R$"R 2U8Ÿ= @0A004 1aA`PU+ 0S 100S H0 0YH0,N  Z000 0 0 00RYPU Ѝ0  00!R 0ʀl2 00 !R 0ʀl2 %R t5S 0ʀl2Sw Su Ss Sq So Sm S\jHl| ht|d1P0TX POP# @ QH\F( 00ʃlœ\ 1:t“ @-'@T! tƒ'> 'tƒ /A\  B\  ^tƒ    /1P0A 00` P;ʀ :l“3\0 /@P%0000CS 00000000000000000/@-@P@M&\\ Y #3t P P 00 8000 0bЍl`P -P\P Y͌# /@-00  |00S d d0 8=0!D00 R 0蠾a`v *w1 0@ᴬ0 @D BT `p`$Ѝ_ TP P  D0|0up H0@D002 T `V `vV `:`  P]꬚0 00h$p@-@Pppp@p@-@80800P  @ppp@ $O-46dM0$00Q 0| @pw`PyU P[t0P0O W 040P0[000P0@SWL9.SR`0XP0P00PEPUO000 00PS0408 00 0`P0p @R@+40T R80 ) 4 jw$ 400Pp ٫pG`0000C?00TwP`FOwPH` 0p`0 PP Y 00 00 E 0 4,QpQpP Qձ,pp( X4 R!p! Bp G" RU     HU pG4 S0 0 P` 4,8p 04,0@,@ 0<8PU 0 4Q00C 00 Sb 0( 0C0, Q0 00SPl 0002000C?00vP pGR0H`Fe v$ 10 P 00  0 0 K00000p0KvP 0I pA! Ww 0H 00 0ᰡpG W!D0|0p_udЍ004 p` 040T pR0`40 00 0P} 0GPAu9dЍ`-5u0 00 dt$p@-`@Ppp p@V T00 L$p@-@Pppp@ ?p@-@@ @  `  @Ppp p@)괪$p@-@<0<00P  @ppp@ T$p@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP``|O-葟MS D@HP 0X 0p`@ 0 0[  E4/ 0 R < $R0<SP10000#10#.Q00S0> P 0 0@0 0x00 P00 Hr R0S0 0?P4/[WЍZ00 Hr R0S@0刀0pP4/pW|Q" @-@ RM !R "R pPĜ\  00@]Ѝ/0Q " @-  MS S PpP$R (@4Ѝ/`-4M0 Ѝ]@-@000M, @ ЍX]Lp@- 0B\\@S ^\1  @ % e ,\'\ { d"LA!!A0 4"!! L}0 p%   @ '  pPU< 0 ER3\!@`P    ^0 B! { c\  "0  {  \ @ o% d  + {o\\:\ { c|QO-M  {pPP 0  %  0  S  h `\ @u,S 0   @0S *  QS%S +0B GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 SKr 00PЍ%0iR@ 0 `fv`  00#1.R0*R0 S l@0 S[0@@00dR% d 00 @0@00 S0[  00 @@"0 C0 0 S[ 00000 K0`"@ @ 0 @00 S020 0r 0  0@ 00 Ssؑ00s00 00 00 000@ 0TX 0@d0 0 r 00 C C00 0 <0  0 @D@0 @0T0 S\R Z I00 S0   kt  000S0\S 0 S0 00 |%p%c%+%cx$</>p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0SS`S`$SA-@0MS0D0@!0@p0S? `l 01!1P!1"b2cP@AL0L  00210BqP0 pW$P@WP 0fS^PЍЍP 0ЍNgA-@0MS0D0@!0@p0S> ` 01 ‚P P@0!0A1 0120BP0 pW$P@TP 0nSPЍЍP"0ЍHkLT~>C-@0MS00! 0p0S2 P 0T`1H $@0 Ax 0X1@ $A0!b4!b @1c1c0A 0 00ࣀȈ(!h!bC >P㈁ 0tS0cS0S㤠 0 @0Pb00< X 00u vn{z, NgXxkLw>Pw-?L*S A-@`p0\ %\0PpS sS lS@ 0\TTW 000P1CP0@CV` 1D!00O-霮pQ qM PP- 00S0406 `$ _ 0l@H 0T0S1  RS GA@T l P p 4 @@T %T@%T400 R,:PmP 400P,%0p,00=0,P0 - ͟00:T T) `DV%?#"< / XT c`Dv`Vfz t``` 0`D@lQ 0>T-0p0  Tg@W -@@@C?T@^ >Tp A0Ds =R=S2t 0BXaevV.`^`0^@ C @00! Dr 2\* R:0Z'TOP ͍R'R ͍T0   R'R'Rp@@pI@[jP 00040jP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 34 00`Q,\*P 0 up 40P040`OU; 01 1`0@1O1S  0C-11@ST #Q,%*P  4 @@9AT @D=AA0@a DrQA DR3@D1@ؕ& R ?R ;RL  pR 0%R 0@a0Ds RA0DS 13 DOS ͍!!010@Sl00l0 0St00t0QU PE@=1QP JOU5 =1 =10@1@10Ds R-1!TORP=1=1 @T!p1S 0C110 S@Rb  ?R ;R QeR  pRT 0%R 0 00000 0 B10 OQj }RR0  R}R}R@@ps!R =1X@ BT! 4 Q`!`10` Q,0*S 0 bp 40040@M, 40,qߍ! 1J00@QU PE=1@Q@1OU =0@01P@ Q$-1 1OS00P,jP 400P,V 2!jP 4 `V w``&``VP``P``Ì`@oobP``V h`{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2i0PQ 4 0,0S@p(00@# 0 n00 @00t| ' V8B` 000&@DQ0VT&$#"y p ]K5#0@0C!@DOo0B000@00-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/!A-pQ@PM 0S! XB hP $`V! 0v0* V Uz ``ЍpP0U0b ``U 4 0 0 R Ut U\0P0S U( x ~p 0S R s0r (0 000SU00JP c0 p0(0>P c0 p00T?U@9454   x  ht@T ,    0R @-MI0@S  ЍA-pPP U) @`TV 0PS |O@P0DtV  XP PoA-PR pQ k00@ `P % P P # 0 ES  gP  G0 000Q  0 R0 R   ^ Np0 PQVP PU`̇P 0S  0 S o W  _0Cs0S0S  0 S Q V0Cs0S PUE 0$XPGPG " X= $0 Ž20nP< sPJ fPZ PR00V0S 0 0qQ :%fP NC!fPJ<fPL5$ PP h$P h fP$$ W   PP?V00S    0S V P(C-P|a@x!`pM0  P _00\0S< PЍ`P 7 P 0 vp R 0S 0PP  PP004PЍ 0 )P @``+ P *`PP.< `- -O-M M:S&0:SSP 0`S:Spp@F T R!*  @ 0  tDmP 0P:S ۍ ЍPۍ ЍC-pP,Ÿ,M M@`tP) 0/SI P5P 0 ۍЍC0P p! +P20 ۍЍCl0P 0S/S fpP $fX 0fX P 0 ۍЍC0 PۍЍ p 0fYW L0L 0 $ۍЍ404 0 $+   p `  ) ) G-p`@P  X0@fT  NP @\PP#P P @T  @0G0VU-@-@ M00 Ѝ@ Ѝ/ C Ѝ@ Ѝ/ 0p@-S@ 0  p0000  P 0 p@-@7f5f3f@1f/f -f0+f@(f 0p@-PS@:pS $0P00?//p@-M@0  0L@N $@L0B!b!bN?AA4 1c1cL0P0@$C!d!b8A@C1PЍ-?LL*Sop@-0P0M`2"@P 0ЍpYY, 0 0S Q20Ѝp܅G-1!0  aP P@4 04 S0p0p2,0PP0  |Qp`  WPeȄpEQ  W| 0 ȇ0H00S`@-@P ^^^ ^$^,^^,00!R  ! 001/\001P//DH2 @--@ X@X0@0@0s H .PJI HH @QDp@--(M G7@` @@PR~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " k{UF{{F!00 (ЍpP P # 0U 0f {kUka.!00 P ~P T# 0U 0 0"{P  0cP0J30{kUk 0 iP  0cP0G20U 05{kF{{TPn  0cP0t20U 0x 0"BP;  0cP0x0 0U"  0P;  0cP0|10mU ! 0a"1"UJP.  p0cP0%ʘ 0U"  R b0cP0$d10U 0"P1"P  P0cP0$10U 0"1"P  >0cP0@00U 01"0"P>  ,0cP0@ʜ00U 0 0"P  G??hQD  X h G | ( 0cP000{kF{U{ 0# P  0cP0uʠ30{kUk 0 Pb  0cP0\30{kUk 03 mP  0cP0n30U 0_"3"[PF  0cP0L20U 0="2"IPO  0cP0ʔ20U 0"t2"7P  0cP0EP20U 06"\2"%P5  |0cP0 20x{U{ 0 P  k0cP010g{U{ 0 PD  Z0cP0ʌ10U 0"\1"P  H0cP0H10uU 0 P<  70cP0k10U 0\"1"P_  %0cP0&00U 0"0"P  0cP0ʀ00U 0"p0"P   `  @  X p l H G< 0cP0(,00U 0"@0"~P  0cP0l00 00U"- lP  0cP0ʰ00 00U" ZP  0cP000*{kRF{U{ 0 EPn  0cP0`30U 0q"3"3Pd  0cP030U 0"83"!P  x0cP020U 0"2"P  f0cP0Wʔ20U 0H"2"P0  T0cP0HT20 00U" P  B0cP020 00U" P  00cP010fk{U{ 0y P  0cP0ʈ10U 0"`1"PN  0cP 0<10@U 0% Pc  0cP0Z00U 0K"0"P  0cP0ʸ 0U" 5 ~P  0cP0qt00 00U" lP  8 G@  \ DŽ 0cP0_(00U 0P"<0"DP  0cP0h00 00U" 2P  ,P  00{kF{U{"00 t3030vx30 3U""00 aH30@30 3U""00 Q30 X3U""00 D20{kUk!00 72020 2U"$o"00 'x20p20c 2U"_!00 @20} p2U"R"00 2020 H2U"B!00 1010$ 2U"p2!00 10b1010 1U"G!00 `109X10k d1U"!00 (10 01U""00 0000 1U"B!00 00400g 0U""00 00 @ L  0 8  X  ,  H t < H x 00U"T!00 bP00FX00`00.htp00N |0U"!00 I00{kUk!00 930 3U"t"00 ,30{kUkg!00 X30vP T3"ZI aI  3"UN"00 20{kUkA!00 20{kUk4!00 20S,"00 '"00 l" d" A { PI : S@ "00 "00 !00 !00 kk!00 "00 "00 !00 "00 "00 "00 !00 kk!00 "00 0Si !00 }0S2 !00 u0S !00 m0S !00 eP  _0S !00 W0S !00 O -DT! @8  x ( 0S "00 70S w!00 /0SO o"00 '0S/ g!00 0S _"00 0S W!00 0S O!00 0S G!00 0S ?!00 0S 7!00 0S) /!00 0S  '!00 0S !00 0S !00 0S !00 0S !00 0S !00 0S~ "00 0S "00 0S !00 0S !00 0S !00 0S "00 0S !00  3H "zP !H H  3"0SI!00 e0S !00 ]x# cp# v"00 R"00 M"00 H"00 C"00 >"00 9|"00 4w"00 /r"00 *m"00 %h"00 I mI "x2"2l0 0R2L0 0I 2,0 0@@2 0 07\20 0.820 0%20 010 01l0 0 "1L0 0K1,0 0!00 P10 0S,10 0j10 090 @@D0 L0l0 0? t H L t l $ d T D L l 4 X  <  L 0P0 040p0 02X00 0|00 0x`0 @@0 ks0 @@0 ^100 0Uu,1P0 0L,P1 @@0 ?o?!00 10 01!10 0(10 0G2 @@(0 82 @@}X0 l2t0 020 0+0Op\>0U) 0PEt@T7p0pp@$>00Ss o=0000CS 0S =007s@ Q=0 C0 0,0`S P?N?P?"5? M? Q?H?A?L? J? \ C? p MB 9?:?;?0@\,( @Dʈ+7~N82q@D0 D0B$0Sp0  0p2@0W'8<#0#w[ 202HL0  200@S2D0u po 0S3q0P0;T02@D0 C<3q@D07s0D@C s P5l0{1r0ರ^l[PEt@[UxR!B"0$ 8 S0l00X0S>0p0P0?0X00 p0tP \40t (CQ @m 40e@ 0p040I 00p`40T4l 0Z[pPEt@[jU" 0C00Sp 0 000(1 T*U $((U^ PEt1岐@^ Ԃ 7sQ0D7{D @C7s0D@CqD<6L0$ R'400  0q@x6p0@ 0sxp0@+MP7s@DZ 0ಷ@D'q@p6l000` 0 0P00p0P0 Xtp0(0$P$(0/ 70( 'r0R0S(07@D0ςSR: @3 0@|008@0I80y 0s  \ p T d \ h tP |80G pC=0S804p@-@ZPP80S ($03/$0(3/00pPA-@`BPP@p0 QR 408 B4 08@V000PA-@`#PpP 0R| S  +P00S  : 70S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000P@P`P-@ R2Q <001 0 0S!B<@0 RD R  0cPࠓ^ S R5 0 1 Ra @ <00 R1@ 0 <l0P\p\ G R R0c BP  R S R 00S  0S  pl0Sp0p0Cpp0+x0 00 0RP,040p0 x0 0 0 30 Ѝ0l0S  pl0@@@ [\ S???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPx@ 0!(`3/PPu 8pWG  ( 0(3/pP00@c  Q 0  \!iP S>0R:oRS B P T  B T p W0Bp3  (08#K8pPp  BS>00p000@ Q 0  \ )P S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @Pᬰ=X 0C0 0$SQ $Cp0`0 sRpW-0 p  p0 Ѝ0` R`V40sCJB 0|<J^S20 b6 0s0^0X 0 C∀0S 0SCXP! P( 0 ! 1T2 0! T 0SЍ0W0T0S Ѝ0D?o 240%R00S020,0@0000,004@0D?o280(000 0 0 0C$0PU?PU@PUAP0UAPR@oPP 0C R R0 PR \:0S@\!v!w|U!1^  RX  `\h$X  `\h, Rl R O- M`0P 0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPH/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S>00000 S *S0SWq00Q 0SD0@S>P0 W0Ss S00W0 00#400 03 0  0#400  0 `0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000. R0f9S ?0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E000S ! P B R  PE[ 0 X0 * PH 0 ,0 SR0 B00 0 0 0 0 0 S0 S00ӈ R01q 00 D R}0ES IS= [S8 gS8 40S0CkWi D8 RC0SS@ S   00#  #800#"0   % ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S,  Rg00 0 B000,0g  S  0Q0u0S 000#40}0q00]0SZt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SWc :W㴖K 6SV \0l S 8 B0 l0\000SDI\ R8 C0 l0\000S7 xZt0(l 8`R B  ^C 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l S/t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [ KoP᫲[@ `P``0P0@&ƅ&s0(!ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0<00S=p#  #800#"0 00](B 0.0c*W6F &R< \ R80l0 C;0,0|K 0 00 0000 B 0L0DC0C t0S*l0\06\0l S 8 B0y l0\000SD10,\ R80l0 C97531/-A-`pPTq@PG Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0 `\p# 0S%t l00\ R6S S L D0 BC >060@! Rpp,p@-@.PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ 2)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOzv `fp00$0`(0 } Ѝ8 80  000&-M 0 BЍA-P?PUPr0 `0@ 0S  00 0t!(3/@PU \!@] 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P. @ R+ D SR% , 8 /, @@ *L DD %&! 0 0C006& 0&;> 0$0;/ O-Q$M R0  x 0S!q"$!@P`p,ß 0+0* @$)z0(!y0qx0a{0t0@A P1:SuPQ "9SuPQp'8SuPQP`&P5S>3s0uP1+@$ "@QP0 Ÿ " rP"$!!! q !P!"  " " rP"$! ++{ !Q+" @$ $ rQ"$ S4T@QPQ@$t@a@Q"$&P%uPQL"T% $r A Q%D$ "r Q Q$T% "r A Q%D$ "r a Q$d& "r Q@Q&T%@$t@!\%$"C0S 0!q^"$!$ЍP!AQ1C1@`pu 0  P x C-PRp ` P  0!\0 0#@B .P@18R0  C @$' C-PRp ` P  0!\0 0#@B .P@18R0  C @$' @-@Plp`hPp@` 0!đQ0 0#B   @-@Plp`hPp@` 0!đQ0 0#B   p@-P04`^00# @L P%!p G-pR'wph Q RO SRCW-o`VA0A0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcV V-2Q0 pGN0 Q"R 0pP1W1|G.7&c2pG0N 1pW|GpG1^NNQV=F10C>@AP  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0A0C 00 pP80'7b"c2pGNq%R&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /qR&-7c20Bp c!qÂ'b "0C0,Q  HA P A@8R,C(0 BR,B B /q/DP U/0S0`0//ᤚ 5i76@-S k>@@0 #400k.06S0k. ς 1O- p:PTU0!`Q`+ṐY* V@ : U @0ς!\KU V*  p0Q=0^QQ [ 0O-DM PX%@QX 0F  u pGjP0P4 \AB\S 1vσ p P Q-0[P4尐&G B&Sp  @  ipWPQ=00ද0 K`{P0: `;VT`+0I AX{T4T+ pQ}Qp0W20|q~6x `00[0` IT$P0>0 0@00 0p0 S[0 ⵟ0  !  W X SA ׾ᨦ [㑢* & "& R\+ ೞLY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0 P 00U0 0S@\ R @02^02N00 R0@\DЍW@  yP 01LX 1R 6 G2#6pP^p N j p=A-`@PT1R`QPE0+~PT S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O-` MVPPR@ʀk` W !.⾐ἠ i5Rs0( P000P#406IP0cZ3s0V⾐5s0iS0P⸠P0%TPVIPeQq BYr 漖P9s0000P#406cR!0C 6Vj VPT@Q p` 0F?oR20S RV0XW R+}~ʲᰐpj5WPs0pPJs000p0#40vPpgYww0 UVA5Pps0k.00P0p#406VPcQ 0C6PT@ Ѝ Br 9 kV0& PPQ^`徠἖0`j9Ys0`J 0 00#4 0编0iQq0  R0἖`g)0 6b궐pi5Zs0P000P#406I0cW3s0 Y㼖P Ap9s0k.00P0p#406VPcQ 0C6PP) P V# Br 5 yO-ʀ6knS㼖0M #P  #  # #  #  ! A@b9 Ts0@p000@p#406 B0c^~00἖&R @ P$ pḀn9 Zs0 0N 00#4 060cXx0qX tq@DphWt@>s0挥pH000p#4060cTCt0 BR@@@CAԕBԅqಐApi>Xs0000#406I0cWsw0 0@弖^ `D Br @n9 Ts0=@p000@p#406N0cR#r0&0R἖f b9 ^s0 @Pk`0`00@#4PP0 B0`Qq0 k0&Ѝ0἖=0἖9 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LSZ=I( , &&褈A-@ k΀`P s0! Qr p p "$  aS2s Ak> ,u 0  u0#Ġ  <##4U0 0 000*60@-S S00k@@6 0C60k>@PP@@!PPƂ0*0@-k6 Sq00@PP0#4@@06c\| 0Ck΂ S600@PP0@@@#406 0CS6 S00k@@6 0C60k>@PP@@!PPƂ0O-0 QR@ M, R 0p&]P+&(+#0N  q/ ! R7@P j   Q&Q3 "[q6k S ;p3 s0000 #406 cPp 0Ck N.V6 0G. 0R0 0xS0   0LSZ=00IX  &&0 Ѝ  \ R+R +R ,RE R  Q ,_ R3 "&][Pj 0w ЍO R \3 "[k. Z0q:s00 00 "$ 缦0jQ3s0 J+ ZB(弦|qk>0#40缦0j\3s0 J Z㼦syzk>0#40缦0j\3s0 J Z㼦T@|qk>0#40缦0j\3s JpM⼦k> / ! Zq ! 缦jR!r JPἦ L I  Q3 "[F@q:sy:s0:s0 r :s0]q#r 0 \ :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  X p@-@P`h0P `0P @T @剭000@pVp:&@ pyaratcid@-M @PoЍ腻@oЍ@-M @PЍv@t@Ѝ@-M @PoЍe@oЍ@-M @PЍV@T@Ѝ@-Mp@P `P E`Ѝ Dp@ /Ѝ40@/T `0p@-S P@0 C`%0@DT @p 0 p0A-S Pp@0PC`%0@kDT @000p@-S P@0 C`#0@ODT @pܺ 0 p0A-S Pp@0PC`0@3DT @00彺@- MP CDp 0S @p0@C%`DV ` Ѝ蠺0 0 Ѝ虺 Ѝ@- MP Dp 0S @p0@C`CV ` Ѝ{0 0 Ѝt ЍA-Mp@P `P Cp@ . 0S P0 C@ CT@ ЍI`ЍD0`0Ѝ=0@.T` Ѝp@-@PS0PPptcidp@-@PG$0P p 00ploobp@-P`@P  0@<p@-@@@-@@@-@@@-@@@-@@@-@@@-@@;@-@@R@-@@i@-@y@@-@s@@-@m@@-@g@@-@a@@-@[@@-@U@@-@O@@-@I@ @-@C@@-@=@0p@-P`x@P  0@pp@-P`f@P  }0@pp@-P`T@P  k0@pp@-P`B@P  Y0@|pp@-P0`P.@P  E0@hpp@-P`@P  30@Vpp@-P` @P  !0@Dpp@-P`@P  0@2pp@-P`@P  0@ pp@-P0`P@P  0@ pp@-P`@P  0@ pp@-P`@P  0@ pp@-P`@P  0@ pp@-P`@P  0@ pp@-P0`P@P  0@ pp@-P`|@P  {0@ pp@-P`j@P  i0@ pp@-P`X@P  W0@z pp@-P`F@P  E0@h pp@-P0`P2@P  10@T pp@-P@=(0P p0P 0pgntsp@-P`@P  0@1 pp@-P`@P  0@ pp@-`P@<P pQP U @patadp@-P`@P  0@ pp@-P`@P  0@ pA-PW@ X0P p)`P  P `,gntsp@-P9@ (0P p0P 0pgntsp@-P`%@P  0@ pp@-P`@P  o0@ p@-@R e0@ p@-@!Pq $0P p600ploobp@-P`@P  !0@f pp@-P@P L!0@W p@-@ @@-@ @@-@ @@-@ @@-@ @+@-@ @:@-@ @V@-@ @m@-@ @@-@ @@-@ @@-@ @@-@ @@-@ @@-@{ @@-@u @@-@o @@-@i @(@-@c @6@-@] @Kp@-P`@P  x 0@ pp@-P@P  0@ pp@-P`q@P  V 0@ pp@-P`@P  0@ pp@-P`O@P  4 0@ pp@-P>@P n 0@y pp@-P`-@P   0@g pp@-P@P L 0@W pp@-P0`P @P  0@C pp@-P0P @P & 0@1 pp@-P` @P  0@ pp@-P @P  0@ pp@-P` @P  0@ pp@-P @P 0@ pp@-P` @P  0@ pp@-P @P 0@ pp@-P` @P  d0@ pp@-Pn @P 0@ pp@-P0`P[ @P  @0@ pp@-P0PH @P x0@ pp@-P`O @P  0@q p p@-P= @P U0@` pp@-P`, @P  0@N p p@-P @P 20@= pp@-P` @P  0@+ p p@-P @P 0@ pp@-P` @P  0@ p p@-P @P 0@ pp@-P0`P @P  0@ pp@-P0P @P 0@ pp@-P` @P  j0@ p p@-P @P 0@ pp@-P`z @P  G0@ p p@-Ph @P 0@ pp@-P`W @P  $0@y p p@-PE @P ]0@h pp@-P`4 @P  0@V p p@-P" @P :0@E pp@-P0`P @P  0@1 pp@-P0P @P 0@ pp@-P@ (0P p0P 0pgntsp@-P`~@P  0@pp@-Pn@P 0@pp@-P`c@P  0@pp@-PS@P 0@pp@-`PD@ <P pP U patadp@-P`@P  N0@pp@-P`@P  <0@pp@-Pm@P v0@pp@-P~@P f0@qpA-P@Z X0P .pH%`P  EP `'gntsp@-P@< (0P p0P 0pgntsp@-P`@P  0@0pp@-P@P 0@!pp@-P`@P  0@pp@-P@P 0@p@-@Q 0@@-@R 0@p@-@0 P ''p@PP 0S p}0D0@-$@@{/4YP 0R @-P Q o//R xR 0S p@-P`@`PPpoP p@8 P [0 o@-0  | @-P Q @F@ @0@ a0 ѯ( (0( b0 ȯ4 |  X 0  @-0< ⸯ  mA-P`pa $@P `P `ppn;P` e X&] `M&J&W|-@- #@P $0 0 0 0VA-pP #@P" z0 0 0 ᗣP#`P  ᧰` P0 000 ,0X ?@U 4 @-@P t@ xi-A-M pW $P0 P>@P#`P  0P> ZЍAЍ/ЍAЍ/ 0 0t  , E @-@P 2@ 6'p@-@P x0 00R0 PQ#0P Q <  p@JppSLM p@-@P `0 00R P/#0P Q   p@phSL P/0 00R /RP/<0 00R0/P///RXL 0P @-od  QP  QQ /dRK P/ 0 00R/Q@-@P \0 00R  "0P Q 00QK P/00 00RP///QP&PQ PphPPQ PpJp@-@<PEPp/>P Q 7P Q>/P p@ ) 0p@-SP` @ 0S P@p<P QQ P/P >P p@ p@-\@<@P(@Q Pp$pP p@ ̼ $@-@P@t@- @P   P 0,0 0g"@d"A-PQ`@  џ 0 S S C\P 0 S S C^\<S>0S: !S#0-S50F?o2-P0S-0S'S% -S0 -S0>S  0/S^ p(p 0 S S0` ` S S /S >S S 0 S S0FU0 ROtP0/SZ 0$00>S] S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p 0 0 ڪ S =S`B`0"S0S  0"R "R RW0$00>S` 0   0C  >Rr0 pP\ @-Q R$P <PG &P@aT lT gT, qTuPoP tP;P"tP @mT pToPsP;P';P<tP;P>@pT@;TS0S/Q /@- gsoO-\1MM0(@P00 p$0` 0$ 0 0[ Q` $ 0`;/0 `P Mߍ /sP 03/P 00  $ 0:/P 000 PMߍdYG-@,LPPM DaDqD`p@0 S S   CQ R@<S7  UP#   UP   UP)0 SS -S0  -S0>S  00 >SS @S @@S P@J A-`RMaPPp2 0S/ @0U  UT 0/P B 0CU/PU  U0 0 B/Q `!0C@T@!  ᢪ;@04D.0 0  R0* 0 0zp@  s3V ~P34xPۍs?00o00S03p 4`4D3p 33pRPC-`M㱍Pb@PO ,U3p`F 4pF 0pE eS>#0 `&00M3p)  z0 0p# 000Ѝ0 `00)3p  VЍg@3aW4\@-@ ?L4@P@-eP 0 0 up O-IMP  @Tl p ` Y 9/0 pPS @T[ 0 R 2/0eF P003/Y@ 9/T eT T @T@A 0SM 03/P Y 9/e0S, @0 R 2/0e( P Y 9/Z3 0 03/Iߍ 0 0  0 0  0 0C/ 0 0C/ 0 |0C/קl l0l B0C/Χ눭 Ed ;@    tdԬ \@p@-P@PP  P $0SP  R Plp`pP P YPP ( PT8& P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0P 0 $ \00 Mߍ R00 0 0K/ܩ lH 0/0/@-@@P 00#0 0 P 0S S R/P/ R0/@-@  | p@-!@ (M  P l  6```iP(Ѝp<  6P (ЍplT<$@-@٤g @-$@@Wף 2p@-M`Pݨ@0 @`0Ps*0 00 Ѝpƨ0"Sp@-M@`ἨP0 PVqp 0 00 Ѝp觨0"S 00 S 0 P :\03#/S 0 P \0///A-P``e@P (pP "L@P uᖣW@(0( (0 0 `  00 S 0 P :\03#/S 0 P \0///0@- @PM @ Ѝ00@- @PM @ zЍ00@- @PM  @ lЍ00@- @PM  @ ^Ѝ0@-@P ,0 00R. /P/0 00R / 00 !S R!* R0:/-  ^0 : 0P0*  R*/@@/ / <.P $0 00R //T-P $0 00R //-P $0 00R //,P $0 00R //,P/`0 00R / 0  \*s00/S:t,P/`0 00R / 0 ɓ\*s00/ S:,P/t0 00R / 00  \ */- ^ :+P/t0 00R / 00  \ */- ^ :+P/@0 00R / 0 0 S /|*P/t0 00R / 00  \ */- ^ :(*P/`0 00R / 0  \*s00/S:)P/`0 00R / 0 ɓ\*s00/ S:,)P/t0 00R / 00  \ */- ^ :(P/@0 00R / 0 0 S /0(P/<0 00R /  R*r  /'P/<0 00R / R*r  /'P/X0 00R / 00  P :/R /<'P/X0 00R / 00  P :/R /&P/D0 00R / 00 R /d&P/X0 00R / 00  P :/R / &P/<0 00R /  R*r  /%P/<0 00R / R*r  /P%P/X0 00R / 00  P :/R /%P/D0 00R / 00 R /$ P -/o<0"00^ R  R/0$P/L\ /  JQ\/#P/L\ /  JQ\/#P/P\ / Q/S/Q\/ #P/P\ / Q/S/Q\/"p@-M0 P000 00S Ѝp$0@S `0-S 0S0xS P T P %ЍpPPAo/A-PP P`p @@P@@@P p4:_0,p0P4080<0@!@-@  x@-(@@ >X YV@-@<@9O-4@T `,@@D¤@`T PpQㅑ 7PZ PPZ P0 0 ෡̕ z @-R 0P< P 4Q ,  D D0D @0 ␡0 000 0 ⇡x< Lc xp@-@M4 00R;SP,0 S R' 1`V8 P` 0 0P 40, 0C40P0 `ЍpS 0 0D KЍpЍpR t t0t 0D 3\ \0\ X0D *H H0H a0D !( aȓ H q \A-@`,pPP W 0 !_,P0`,P0`G-@P M`UP  u00pЍ!0 P (0S0 젟0 P (0S$pW00  0P 0S  p P  P X p0 P q( (0( $0\ ⚠ d @K 0  @-0 ≠$ 0p@-@P l0`0VPP H H0 0 0@S0<  pp|0 0  @-0 X` 80p@-S `  Q P@0@p 0  0 7؏ {p@-0S h`@`PPpP p@ 0  0 D  4 @-R 0, B4 P @@ @0@ <0B/, ,0, (0B/܎ | p@-@PP70S ,  Q <0 0 p@(=8O-`p@ 40SK rP@ P /P 00S 0Q 匑 # 00R&P P [G GP P eP 0  03/P PP 0 S uOlk 00CS 0 0PS Ph5@T T0T P0J/S@ @0@ <0R/JlxT 0H $$ D@-@s0,S<SSPPG-Z p`0VWV@P/ 404 S"S` R000,0 100,0$ 100, ,0P ?o! 0 2\0S! ` F DP : < :404 SS` 0 .4 40S0SP``D D0D }0.⿞, ,0, (0.⶞ ԉ  tsG-PP' 0 0R" 4fP 40S @,0aᄑ1p  ,0`p40@T:8 408  `0P 4  Q@-P80080/p@-@P 80080p@ p@-@P 80 0R@ pP 4@ p,p@-@P \0 0R@ pP` 00S@#: p@p@-@P~ @y pA-PP 0 0R4 p`i 40S @40S ,0 P@X `R 8A-@P 0`0VpPC 0S P @T @ @0@ <0R/؝@+ @\ (8A-PP /o0`0"Q@@T 00R p  @P @T  @ 0  0R/❝p <LO-@PM h3P 0R @Ѝ4 00R80`  pP @P@ ЍВ  : ⱚpP0 2 004QY 4 R] ,剱1Q  ᴚ P 0YId  B B!ᩆ,0 p 04 P<0 04 <0  lp,WC<WEW+Y& 堡 06 |p  ]pP 0,S<SS5 P@ ,0pP<04 0<0x ᏚYp ,W<S !G,0p 0 0^/˜gd d0d U0c/L L0L H0^/⸜  88 (  ,܁ G-@S ` VP p P c" 000 GQ 0 0i/z 0P -?o@2 ^0S 00 S/ @-PP M @1 0R Ѝ`@ 80  Ѝ@  `0P 4 Rp@ Q(*, S1 B!400C40<00<0h h0h d0s/T T0T P0s/@ @0@ <0s/( d @H@ J lI P/?o0 2 R0S/00 S/0P -?o82 ^0S 0 S/PP/0 000R/P/0 000R/ P -/o<0"000^ R  R/p@-P@P P 0 03/P P @pY@pA-`P @PEpP $0Sp0P  pAtp@-P@P  PP %p讝0@멝@Pp@-U@P 0@p@-@0P P 0R R@-P0S /Ido/808 80 $0$ $0  } Կ| O- 0S7 @`P. X0tqPp P 0 P  P X0UUUB!#1<00@.B,? P@HPOX% XP0@#r 140S ,0AT 5p@p@ 0  0O/ϓ` HtRA-@P 0P 0R@ p`8040S !,0X )<0, 0Q<04@@|@D D0D @0S/⑓0 000 0S/∓h_ Ȥ|_ Xp@-@P H0 0R@ pP`N@pDA-@P1 0RP`4P%80,0!qW&  P  1P ,0P < 0@ 40< AAD D0D @0W/*0 000 ,0W/!@^ ^ 0P -?o82 ^0S 0 S/p@-PQ@P &P 0 03/P 7P @Sp M@pp@-`P pP@P $0S p@p@-P@P  BPP  p0@ @Pp@-@P 0@\011/A-\@`pP \"1S 0 €  P 1P1 `p P 0808 8B0 p$0$ $A0 h뤠\ p8\ P@-@^ P ^%QRS  T00 NQRS"  TŒ 00 0 Z0 ([ TG-@R00QP(M P 0 ` p Pl `0T?o20S00(Ѝp`0 L0     Q /0     P /0 2/ / /    Q /0 2/ / /    P /p@-@PP`(M/ 0S, R00ۅ$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0W P0V00(Ѝp@ R 0S V00L0Q000 00/@-@p00T0.0/00Q@-@T @-@T000 000S/@-_p000 000S/@-Op000 000S/@-?Lp000 000S/@-/ p000 000S/@-p000 000S/@-p000 000S/@-Lp000 000S/@- p000 000S/@-ߒp000 000S/@-ϒp @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#t 0 01/(001/0 01/0S@-@1/00/p@-P0P0 0@0PS` PppYp/@-P-@-000 000S/@-?LpAo//0@-p@P M 4 P Ѝ0 0 ;0 vt\R `@-p@M L P pЍ(0( (;0 wt@pR 0@-pP@ M T T T  0 Ѝ04 @ Ѝ0 0 :0 ׏tDQ p@-@ @ $ 0 80 ^t Q dp@-@PP $P(Pp0 70 ଏ DQ 4p@-@PP (Pp0 70 Q p@-@PP $Pp0 70 tP @-@P  Y.<+ < 00 ;0 h`P @-@P ( 0 70 W(踞(P @-@P $ 0 70 E$pO `R/-ptx` P RjJP5W   RGJP_ P?e0 3??o+0⃑ iP5I@ 038P?e0 3??oP 0CP)H RJ@> 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@᳏ P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pᄂ80 0 @  0""048# /UUUU3333  n`p@-PQ@y : S P Sd0 V Sb0?0 r-w - 0!= S [ 7SJ @Sx00 r-w-0  R< R7 Rx 0 r-w-@!@ T. T( T0 T x  00pRs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- H0H H09 э: S}A0a0-0~0J O-8AP@:  pPA 'PA  XpP% 00` 0@T' m9P0=S AP` AT BX ! i߈D0D D>0 z ꟏000HH C-@``"`2`M 0P$DT@Pg p`XP \@`@d@h@l@X_pk p Xp` o{{o{$P  {ap[ p0 0S08@R0<@@@@40040,4/-1-0-냉L1L0 00D000ᑉ,X  #60S 2qp@     ЍuoЍ @0 0    HHH0O-PMp 0GW"S00`0v@OP-TPg +T@`0@ ?  0刈0 え P p  ! @00Ds \a0DSW0DA0DS"70DURX : QP   S  R  "000T@ W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`l00 R0  Ѝ p p᠀堐0 ?0 (d XR A B0A PR W @ 0`W p pmꙙxC 00 0M0Ѝ2</O-PMp 0GW"S00`0v@P-TPg +T@`0@ ?  0帇0 㱇 P p  ! @00Ds \a0DSW0DA0DS"70DURX : QP   S  R ʍ "000T@ W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`꜍00 R0  Ѝ p p᠀堐0 ?0 Xd XR A B0A PR W @ 0`W p pmꙙ8p@ @00 0M0Ѝ2/O-M8@ d8> <-M{,0,0 0{ {000{0lЍgO-S$MpPP@HL T P0S X0S 30 000@ 000@0 P`ᐌ0"SA Q, 0b CR!o)pp s4$;R`P  `0*S# xS! S: h"0 @P`$Ѝ5%%;R`J"00G8"0 X0 00T0 0P000sP00S6#0P`P` U0H[0O0P 0$ЍT!0 ?/%1R`:*%6R` 4R`1!%?R`0 0 ‰T;0 0 ฉP0S30 0 ୉* 0`PT  \t\ 0`PT  Rjh|,Pt<: |: Td9 (x@- M|d"{@{ @0S D <0 0 |0 30Ѝ A'5Hk-M{(,{ Ѝ 0 0 9/XzmNA00/,zG-@SP* pE`JY5Q, T5Q JcRXP0 S0C0 PY 0$0$ $0 X~`7 `~O-I4MQ@p0 R Sb 0) 09 P0S009`0S ) )儩儙  @l [PS0+0CO LI @p  q 0 0  0C 0B0 0 S00Qt0 0X0-SQ'P0-S`0!00 0 4Ѝ`8``H0@q 0p 080  `4ЍH@q 0( / 0 B0C0gؗW` P 0 ]W 0S 0 S]Wg7PP`0 G0S `'`7`  0;E@@ :Q` 0+ B R|P0 WV :R 0S0006@0| | -Q0606 0,  ( Rh& `={ P 0B0 0Z  p @$P @` Pp @T  3P{P2 x   Q Q 0@RTZ pBx 0 bZR 500S 0:S  j0S4 00+ CI :SJ {$4  04 0၇0STd4P`h0 tl4 0nW' v;RF0S00YX0$400300S 0:S 30HW 30 0+ C0:S1:` 0S0  :R 0X0!  t#t 000S000300S 0:S (020?`0JSR8 0 0 `S``X0S4Ѝ pBH { H200S 0:S l l 20 100S 0:S $Z(0 10S,000100S 0:S 00C(00\!S0 0 (00+ Cap1p!0 100S 0:S DHf000+ CF101 0B 0 ₆<( (xxxд}Lx}\wLw ww4 {{_t4 p{{<4 t{0{vuXuHud|1 4p1 xdxax$1 $x@xw0 q,/ . . 8. o- tO-pQ ` V 20 R" P@T60帢 R01-[@P-T@PA T"lRPP zP? -@y0P  :R7 $20 0S" 000PP@:T0S! 000100S 0:S  0?@0S|1 0 0@`P 0:S  X 7 0100:R@ 0S ć 0P00P0 0 0 R0 VW0 S0 NQ0 0 P nmm(@mmltrԨtlHlxqkkp* q(qt* pdk@-@P @ 0 /0 Zp) p@-@P @(0( (/0 G@|pX) p@-@-Q Q Q  Q010! 0 0 0 0 S$r0! S L^ 0r0!# ^,00&T00$0$ $0 „Lp( pXo ( \oG-P @p0#03w0q0W`@DT@!   0R ! 0 P   Gࡅ0@ pQP@-pp M P@P `P# +{0 @p{0 PP  Ѝ躆00P굆0`%#P孆`ꪆ0P`夆P|t0 0 X&)-0   X2)p@-@PP` /o"0p@ jJ0 40 Dlh% l@-@P 0@ UJ 0  A0 .% llp@-@PP /o"p@;  IP C@P80X D,0( qp `h6P000pp M@P!  Pd[00S! W0=S0`S"`V`X`V `ሀgPD0#S oPU (2000C00p-@p P@5P@( KPp P4P 4  $l $l 0S000C00  0PP40! 0pd$h`0 p q  q0X0H@45PP0H Pڶ5 ,0pC 0PU 0Pq0S S Pq  Pq  Pq   P4 R1("2 0 t4 30Gލ Ѝ0@yj0  (f@t V 0400O40 S  fP 0pW 0xv (B!1 H 0}!1 0H }0S!1 H 0|!1 0H |$0Sl!l1l H 0| 0   4`Po Pk PO~0S #$00p t(ZXZ@ZZYY{W\ UHU U U hUT VT\ TTdVUUP9UUC-Ÿ TMPPLЇ@`pB VK WT X] !t,@Ͽ |0 % x0 00!0 0$0(00 00 ⟎PLQ PA,@K@]k@0 @Ս !0 0 L0 306TЍ 0 P 0/|V 0 P 0$|W 0 P 0|X 0 P 0|@名 X@'Phq\c<| RQP QQ$ Q`Q Q4QI-M]ЍO-ttŸ \M@PTpP`က儠刐L UU V^ Xg $"4  w0?s0 000 $(,00 0 Pc0Q ,  jOP 0S@ 0 @%H!01 0 T0 30C\Ѝ!1 i\ 0{U 0 j\ 0t{V 0 k\ 0i{X 0 l\ 0^{u0 @@ӌ d@ 'n`QQ| PON 4ONd ON8 NtNPF-MAЍO-M唔 sX  [  0S 0 0Go-0P nPd 1 S S   #@ # S\  000 S SP S0 R R R R @ B RQS 0S1 @+S7 -S[QUp @Us0S 0S 0 0_o0p`R0+S4 -SF wPPUpw[ WPW67 Pp S 0QUp @U40Sa QT 0 0_o00p+SR0S @S#0 PP _opR0S @S&0 PP` _opR _op`RU7 ! 1 0 2 30:ߍiwPPpPp py S!@A7 3 _ 0 d 0 zx x0x td 0z[\ \0\ 1d 0y%븝p| K,I tKI XKHO- ß MM`PȍP@yr T{ W 2U0&N 0AM.0; PY 0SV P +hl+hq 0  0  0$ PP @P:P3H0: ST 10P! 6 6 u v!1 0 8 30_ލЍ\ P 0 @HPP * 6T100SP<104!414 t 0XyT!1 t 0MyWz 0 t 0Byp6 /P \0S  S 0000H0000  @P$븘@YK4SILXLRI:8I PF\F H0F HFHHhHA-@P`p0M- V6 W? 0 y0 0 0/P @T@T 0 pPP j0Ѝ @dP0Ѝ| |0|  0xV\ \0\ X 0xW@ @0@ < 0xI \GD xFC] T !6*$F>>ȉ\ pX<4 ,=<O-!1 0pIM010iWW PPN @`p g0 `@P; 0+S+0S( P  0  P  C0S>2 0 0 1 30Iߍ P rP2w00< <0< 0P uu8!뼈C<<8 LV:0/N0@- 0 0MPP000@' T ؑ0P ""  0S0 0p d0 0 0 30Ѝ0!|@P000 040 *u  8X:` \:@-!1 0FM M@P0d40p/ `* MPPd@"=+< P (w0@O#w @Rh \0 0 d4 30Fލ Ѝ4 404 N0 t 묅0 H9 9@-0 0dM@P0\00p` Pې TX P0 0 \0 30 dЍ0 000 h0( tj p` 8P8 9 9@-<@<M@ c0 ЍJ<80P1Spp//0@- 0 0M@P000P( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)PP000 0F0 Bt $ 6 7G- M砐 p@ U$edP'0G W09pPUo0 ;u0+ J@P   U0 U ,v0PS'vTP !v0@Hv@  nx p0 0 4 30܍ 0mQ.p xP|` 0- M Ѝ@-0 0dM@P0\00p` P .X P0 0 \0 30 dЍ0 000 0 s]<` T4l4O-/? 0M@Q000 L 0ST T@@P 0\@ ?P `@ %   " H l%T!;d Xp\<@lA @87lA$` @b 9 @nM aDP,dPlb!5_L`h`:b.͌6o+(d! P% PPbQ pP5_l & d!, p' )``d!" t` 6o* dx@n,4O-p'`pp%nQ (pPp pnQ%P|p !7( b n ]>a,$bA!,@bA$͌e!@M l8+,`&'pbq p)7 +0.).4o&e)`` `e.d)` !6o) *", $*" *(((e8P*+/+ ( ,"* " 4 0/"*p'*''`(pdq p dq' p0 o& o&o&( `n da(@} (a (,nA!@o͌`nA$g!@ oMnal ga,`ga&$`_?`/%/",`!g1)p`_%!`_%_%0`/"!! d, !:`PodQ `P%P`) n o],daa@n!o`,o po&po&   (M `$oe!na `4.+`+,͌.. `dA.( pea$ `& `l$me.`_l P!_O%f _%)_%(O$_%0P_lQ_%$,,_%O$_%%Pnf._P*ᝉaQ.魊i P%쟃4f Poa ` )` o.o&.o&,`$`4p..0pp]j oaa.o&p!!(o&o&,坉o&eQ`ja%p `&`i%j篃m _n/%i./"! " p _%_%p/% _ f!.iQ " _p%(4p0_%_%(`%fQ 쏃P%-a P]$pb./f!`(a!( "?a1/,"''p!+p/"+0p/"p!/"  m!!8e( &f1e1fq p?0nfpn10}eP`1n1`?f1?O#O$$,@`?#?#]?#$04g1`1ga`?n1`0. 0,?,.,..eg (eςm` ae a捈ςg 0pfa fςe Ϡ8pO,O$O$p @,,(@ ,Phf hA@ςa @!$P,,!!!`h`M fnQ`Qn_͌hQ`dQpnQdq p_`Q,` *`8*$  `plQ dQl_nQ.`)o)`(`.P}..aQlQaa `_dQgAaA`gQPOmlA P`AgA` OaAO!O$O$,!]!!f` f͌菂gp''((e '',peqfq`qlqeqlፈ$fqaalaaqpoea`(p_/l!'%0))0+ 0'+0,_%_%_%(Ÿ''韌$< h1 a10h 0m`0韌h! a " =f 韌h! -c1f#韌( 蟠 )(((돌 )))p菌pfqob1#0#0&a''ppꯌo&bqb!! "= `!-!c1``#O @ b1# 韌0#abb!!,p뿌0 "= `!-!o&c1`q `#$ b1# 0#abA_0b!! pyZnܼbDn" "# "=P "`!p !-c1(@``# όo&b1#@ 0#a0pbb!! "0= `!-!oc1`a`# @ ͌DP nHbb!# "`L m0!01 `0 0 30ЍH1H!H0 1o 0Sh1h!h0 &o@-@P 0LL LHH  004 404 0 o#EgܺvT2T "l"A-PPp`8 W, 100.!0% "0 ?0%0?S@@h pR0hV@Hp` H0V@@p`F AoH H0H 0 n, ,0, 0 n< !P! x!(!p@-!1 0MPP0 00@A TJ R00 113R0 0~? S ``4` 0~? S |U PE0"0 1<3R0 |0 0 0 30Ѝpd d0d `0( ^nTH H0H D0( Snk D j  p 0@- 0 0M@P000P( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)YPP000 0F0 n8j il G- MM砐 p@(U,e(P'0H W0:APUo0 ;u0+ @P   U0 U o0PoTP o0@ o@  m x0 0 5 30܍Ѝ 0gQPLp pP|`Wig 0- M Ѝ@-0 0lM@P0d00p` P" +X P0 0 d0 30 lЍ0 000 0 \mDgf \ 0{,!0 { / #EgܺvT2O-tM0@ @P 0\@ 0 H @&0 40 h& 0,80lɉf+ 0 " (<0h+`,h;!@DPafl;"f0#R0XD=\`;@` Pb! P@$.@n dH@la[#l˄h{P% PL\b[b+c.,P ˠaˌan+% "T cf c;e+, "0X 9n;nl+! " \b)e+e[a#.P`kKXl[lˎc". dnaahpŒȌ̌ p' pb%,h̠cˌc;L{    (he . 00@28<0h; @$g@Jf;l@ b b+@ j $!n;,0#0@/`cpmvmzNS3hˌe;# 0͠T0+>C3C7Cg; )0隠c{n 0  k{Pct0fˌa" a(f `hHekb,b(e P]@a[l&al( h4bf%bf! L+I pᕓI嫗Ik <ll`` +LLd e+(Ldˌ p'e+" p g|nˇ\pb)f+ *h! ph,f{`8+LLLnˌ ꩠkˊ i p`Kfileka" a,eP @0e]h[ $bK&@hˌbK$ @dIDaKf%aˌf. n`be$be(p苠8fd.  f+d,dlʠeˌgn{( pe+n{'XPp"` k+`fjkkf{d{g,Th+, dh+" hP+AAAkP%P4]+AAA`[`Lb*n+lK')@n lK$ik@*XMhKg"hg.h 0ll;Xd.dˌ@e nb$ b,l̠gˌ,04p (llphbb+Dpl0h{,p+>Cn{,p'3Cp7Ca;}d{0lK(0@$@dJL0nKd;0h;'0# 0;l;ࠤ< ak g$.ꩠk n8hnˌP+LLLkˌ ` f "( P`+(  ,`+ j+gd#, ͠gˌ\p +~GsGwGf{`k芠c{.e p' phhgyd{g H "+@@@e b,a+P``&dnK,`@$mjk @Hj )dMcKl 'c; ` <0n P`g;$0#09ll˃T00l[d; 0#a\0gda{`;,0# 0=d;$@ cKhK@(@clK!@$ @H`K d b a+# " )l+c;$0#0:a;dK"b+  @$@0䊈i= 0tЍG-`p 1?P10@@e00T0U?W@@0@W@0W*TP(@T(pG  Gg  g >0eW*0@-P@  M  1?0 @ cR c B T 0 E,̠P,ĠD 80 0 0 30` Ѝ0@"gK lJQ. 00 R. xB@-d R@4  R  *4 8/t+ x0 S\ R `0S Р@- d.@ 4 *8/Z1넘xB /*(0"8 /:$& /--M  |Ѝ Ѝ/0  0c  8q8pPa a` 0` (`za0PPP#Pnaja` 0`(`aa0P P%P 0dTaQalЍlЍ'#I(0( (H0 d@B<  $@- M`@]tqt1pP@P`@@T 0Q P Ѝ$ %]P @ Ѝ@ ]P"0S- -S?@0 0000 P z U RP +R@@D!0DSX \P0S +S!@?@!@ C4|pMX ?P L0P00 1 R/@P/!R/xA(0 @>R0 00// A@-M Pp @e`P`W0D>S 0!3100 0eЍ>SD 0!3100e00e00@/-p@-MeP@U@0 ` ` YPx0x 08 R;0Ѝp@Ѝ/0 a01( ( ;?$  t A-@PP`pU =UB 8X ERR14/.-,+*)('&%$#" Vp&2!0` 0`00+XPp -X% =X00+0E0VpPpp-0V0\0+00+0`0p@00,0, ,]0 c00 , p@-PP@`  0RuSpWSRX0CSG5 +p à 0R ^ PSPQP^  0    T0 0+S -Sp0$ $0$ b0 bI@` O-0xSpLM 08@ (`(0,00040PN 0 0d @ , d@T8 P0p000003  0a0GS] SJ$00+W@ 0-S[=W000 0` @X B R j b\S  "=W  R"   P:0$P-d @  %d R$ "@P0 偡   n Y# @ T:$P dp@  d0S$0 @"@DP@ @T X 00X  0  0pW ,Wsp`TS `! Z0$Pc ` $` c R$ `"`FP`0 `偡   ` =W +0G?oY20S# Z$Pc` $6 c0S$0 `""`FP` `傡V X 00 00X00` `Z$Pc`  c0St$0 `""`FP` `傡 0T0 00  HR;I?I00 HR`  X pP 0 @-a/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`SP+SU PU  0  P Pa0@ a@PPrdP ,000p 00ľp@-0P@`T @T0rS Ppp@P0+Spp@<p@-@PrQ` 0  P<0P0 `@p0  PT@-1 M000P0[ 0SK b0P 0B |1 00S[sp@& P [ 0 01 00SB 0 Ѝ |0 0 @6Ea@[0 00S db6a@ Ѝ|0| |0 _dX0X X0 ^@.pLD<@ LTؒ l@- M 00P0  O 0S> 0P01 P1 00S.p P 081 00S:0 Ѝm`0 @00S=`@ Ѝ:t t0t  0^X,L L0L  0{^0,p< p p8@-`APP@ MG P1p0S'@1@T0 `0`S$ @0SV+ 000S"Pp`0S/  lBp  Ѝ0@T0S T`00h\0 0 L L0L H0 ^*p0dh (G-`PPHM6 p 0 p@ p@ HЍ NP 0 p p@ rHЍ_0S @XH0H H>0 ]PB0P R@$ O-P4M@P\py W=X0S0 `00 S 5/000 00!S5+0 0 00!WeW0a Y_ X00Ut5Sp50 0 0 0 0@0` P(0`0s5`0$0XtQ 0S70`kW ,A0` !!!0C0"0T(P%"1 #1O"QX00 0 " 0$0 0?S%D P@ F`1T10&1! T$?01>! R01"_0`A(0|10X00`d(0X!X1X 9@ 0`\0@t`dP(0 fP  R(0@$Q5 0A`X0 0A$0PE `0P 0  `)`) 0 8@ 0&\{`ꔍ l GzGQ(\)\d$  4xSQ4  ԇ dO-PP@`MN TV VA 0 <<T:R P* Ÿ PL P R# 0Qy SQЍR P P PP[@Q @| P @0 @0 T1T!TT0 [@1@!@0 [T$1$!$$0 [^ # ^ p0^p 0^ @0T^Pp# W @ 0|T@^*?[hT 40  !]-p@-@PP U p@.LX X0X 0 E[U8 808 40 :[p@Lꠄ tt PEG-P@U T^ Pp ppq W00"5gP: Pc 0Sb 0 R 0C ` NPP0 XA V  0s0S0 0 Q 0  ! 0pW3*_oRe`V$P( U  ![ 0 0 ZTt t0t p0 Z\ \0\ G 0Z\00P긂 X `d 8A-TT1 0MM@P040`P! R<  0s0S0 0@ $03/ 0 0 4 30/ۍЍQp夀0p$p 0hZU0 x0`Zp p0p G0 WZT T0T 40$ MZ@4 XC(E  O-Ɵ MMMčƟP p`TD$01 W: 0SC UL X 㰰D\U04U@@ R R00C?o2 00⃰0S U0 S0E0 0S0000ShX- 0+0H 0@ 03/0Sp 0@@5$ 0000,00F$0(@03/P   0S00 *  0.S @ T0S0V:0S 0S  ,P8 * R P $0DQ/ 310 D1 0 (0"P00 0S  0P(80: S$X 0S 0   00s0S0 P@T  0s0S0[04/P9 0608 # $2 MލЍKf00m0  0B y 0.Sv0Sa 0.Sp] Rv  @p 03/0  000.SI X P 0 DP8 @p  2/0!1 , 0X!1 , 0XW!1 0, X0S!1 , 0XUp!p1p l, 0XX PZ0SP PP9,!,1, (4 0X:H 0@ 03/Z0SQ 0HQ<Z0/ 0 0@  03/0qHH0l O*Ц |`{ 48{ t  { `z <z \z |0/O-ß KMMPčP`pؔܤ9 UB WK YT \[ /\@ @ 0\/\0   V"2 0 4 30KލЍR_/\8T*P/00p/\Vd"d2d @ 0XUD"D2D @@ 0 XW("(2( $@ 0XY " 2  @ 0W@Pp PJP 0   R  R 0T/S 0: S+ S 0 0 0 0 pX +0s0S0 0@ (03/0S0: SVl/00 R90P娰0P 0H W0G  0WUY/0 0J$w (w mw hnhw <ou  S|O-XşX5M$M 0PQ000` . @~\< 0  pH 0/SS;R/ 0B0 4ZS 0H*0; nP4S 0 0CPR IR*0S0;R X @H p0\  0  *\2 |@\ ?\" [\!PI 0^N \@000XS 0H 0< S @ 0< 0@Ⲑ 0R  R QR Რ@  P+]@PU "2 0 0 30ۍ$Ѝ0@S D0\P ]\!PLm @Ÿ]P 0 p-P]^ ~0]P @ 0< 010t  0BW 0R S0BW 0R S@c 0Q 0{  00P1A0 VFY0 [0!P0@ E0 0 p3P0P0H*0 ;P 0ꐀ@p@p0P x(V0lX #VS@S@Q?**L [-](Ȟ!`0p O-@PM`pM R T    D  W^ @P}\ @\ [\ {\PU PE0\]\ \8(\PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S00 8(G 0}^S0CV  F B   V  @ ]RR ]RR pPpp0PdP  \0gUWjL0 D0_Uc8 808 $d 0UUU0m $l A-`QPM+ 0  0 S -0{S @ p0Q @{Q0 !P Ѝ0}S0S ЍA8 808 0p U8W 0 k A-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ \R@ @R@ )\ L 0 RLލЍ$ $0$ | 0T\@Xj ,p@-`P Pp@0T1@D 0CP@DP 9t5000p 0  0 Ti غ0 S. *S8 ?0Cs\#S 0 P/0S /Q 0S 0 0/p@-@PPV 0S] "S "$ R6  CQ   0S- @ 00 CR S 00p\S 000#  00p0"S0@000 00 S\0ppg  p@-((1$a0QM`M0500 S L 0 0 5 30/QލЍp, P00 @ 0 Ap x PE_0 U\~PDw04 P 0N8f 5C-0$eP`M 500S E@ p#S"U0 7P$ 0S %P @ 0SvU0SЍt `p  0@S 00 40  0Sx t刄刔p 0fS0fS 000#3R0 <$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 P 000#3R0 x# 000 P 000#3R0 (# 000 P( 000#3R05 " 000 0#S 20@ R@@FP00Ѝ0 S Sd hP 000#3R0 (" 0@00q RP  KP4 000#3R0+ ! 0 00T 000#3R0 ! 000EtP ` 0@S0 @  P =Q F 0P0 0 P=Q 0 @00 F 0P0 0lP|p,\,`LPPa dh$ ` p@-PP x$OP c@PLPPP '00p( (0( I0 QܰX_ DH@-,@@P00O-ȟ MȟP P`@ pUpVpWT 4 Ip00: [Y mRU 8(,8 0 0 30Ѝ `s?0l0` Ⱘup X vE {U_ 000 2c110 0 0p0S( A0  $0p PphS<000S[ ^S000@WS@Z 0@ PS00p XPZpJ 0BqQ #S P BqQ #S Q BqQ #S V BqQ #S S BqQ #Sy R BqQ #S I BqQ #S H BqQ #S G BqQ #S1 L BqQ #SL M BqQ #SB N BqQ #S8 O BqQ #S1 D BqQ #S E BqQ #S F BqQ #S 0S:U 00S! R B  UP `0000  00 F  RS0,Z *p0S R00 0wRW 0 c[ R000@R@p, 04Q @v  D# 00 ( [#   20000"   2000000s2"_0 PnPp00,(@ ((@(@00,0fD  APk0Sk{[p+P_R00[ Qa  [ R0`00{0`0 0SpCt X  pGw0080 Q0SpY005[ r0S0 R  p`00C0C   pp p G[S IkFP| X  @`4d$0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF3pP P Ѝp4A-P`? A@0S( A@Q0+pPpPP @gP  Sp0 @BAQA3M@ >p0 6p0 ,0, ,<0 NplT p@-p`pP`P@T T0T0 R@@{pP00p`DԐA-P@P`@pb0S |@@B R"@`TO@P00P0@AtԿ,@-u 00 C-`4MPI@P 0S|0V ! -UpЍ ⨿0P;  =R6 0Q*G B&R&>$#"M = -Rp㴀Y WꘀqvK　SБpנ0X{FHˠ  0Hd`Ⱦ آ$ԥ4l0O-,,% BMM $ %u  %p 000 0000+ 0加P 40 4d=P P@\ PP 0S l400#S \ AP 0S 444d0``\ 2P 0S 4d0``\ #P 0S 30   \ 0P 0S r30\ 0P 0S r`30X3PE0 +p<@3@0 0P`\ @P 0S dAPP[[ JP200xS0xS0Se "P2 0 4 30BލЍlR@P\ Pq 0S @200#SF \ P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ r0P 0S mqH10\ e0P 0S `q10 ! 10P 0 $0000 0000jIP|O tܻN `N $ @e L x8pL ԸXuK `,̷ܷup@-d@@0S P Hp@P@P 4KP ๼pDHdrp@-@P$ 0PP 4P ԟPPIP TPph`h`PLp4 404 0 &LP4qH dp@-@P$ 0PP 4P PPIIP Pph`h`PLSp4 404 0 KhLp H |0p@-\PP 4P bp<`<`P@%p舴p@-@@P 00O-v,M@Pp0J 0SR 0SM T60` 0P U 0D   6000s0?SN Sl *S00 *Q @R50*QLU 00  *QA[SU \S0  0 @ <Q8 ,Ѝ?[ [2 *[ @[[- \[0S @@0S /Sw .Swu 0X p 0X/Sm.Z\ Q /Q ?P ~ /P P,ЍQ /QS 300 000  ^[![00 $0 00 @   /S \S> S -RE S0 U@ ∀Ḱ0]S^$0 S x ti - 0Xn  0X/Shf @`U/200 0 /ZU0@  0U ∀Ḱ^]^ \^  @S ^U@  ᲀ^& @@  $0\ @ !  [Q  @L1L!L0{ ]J0S,1,!,|0 RJ P0 @0`pC p 0U0   Z  0 sP/ZY  />Q /QY 000 0 |hA plA D@0NP@-@ P +L 0 Q 4Q?o2cp@-@lP GP XGP T00pT 00pK 0 p踒O-0p M @p` P MK10230Y ߍPT 0 pI  ۽P: [ ; 0` 0P CP) @@ 0  p@ 0 zP0P S P J ">0 "C 0 up@~K -R@O-0p M @Bp` P ȿƿ10230Y ߍbPT 0 #pI  VP: [ ; 0` 0P ιP) @@ 0  p@ 0 P0P S P  J ">0 "C 0 p@J -R,O-0p M @p` P CA10230Y ߍݼPT 0 pI  ѼP: [ ; 0` 0P 9P) @@ 0  p@ 0 jP0P S P I ">0 "C 0 ep@tJ -Rp@-T@0`P@ e0P0S SP p@9 p@-T@0`P@ 0P0S SP p8 p@-T@0`P@ =0P0S SP px8 0 00 7-H- M 0 S 0  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/s-H- M 0 S 0  00\100M 0 R0    R  y8 00 0 0 30KH Ѝ/7, -- M0 0k+--M  --M  A-pPPp` Q @Q PD@L0 0000Ak$0$ $0 2G|$~P5 0P R   0// 0S0 !90@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!T0h0p\@@PT F08@@0/S(@@ @@dLR(|RhRCA-M`P8TA0P@D H!0C p0 00   ! 0b0C S1</.-,1*)(1&-pF0 B0@S` 0S 0SF0"S D6!@Ѝ T1r0:F00Ѝ| @-@P1 0S* k8@T. 0T)  /Q0C T !@# *0P@/S x0 B@T@!h0 0aE  T <@0@0@/SOOHA0{-DM  {000p 800S DЍp@-`Pz+p' P@ p V U phUX $p` V*@x@|Q?o?o 0C-@c^?c%^& ^ `pCc&Pc2680E270G2&1H01./ "0;:(0C0 /0 @- / ,00-+C@ P@ 7KE0 0/0E0E0C 400-+C@{$PG{6KE0{7 Q/ 0E0E0C /0P!Qoo G-@`^?`'^( ^ @p@`&``4 3V4X4G1Y010? 1?1>4!50;:(@000 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C JB@ @-?p A J7@ @-4p J@ @-p J@ @-pPP `@-D00?0/R//R/?0S/R/P/R/p@-PMP`V @T 00CЍp{ : { "p@`($ I \" 00 R  ̜,@-D00 0S@00 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PBPX `6@ :PPY  @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍPP @@ @0(@$0l|@O-\ϟC 0C,0  !/"b!!A0,0 W0 0000 0YWP 0  R0( SP 0 00HWz 0AP(0PW%S(Pk6 ,0 6,0,0 v>C 0CWP0(Z 000"0W0QD6 0 0P( 0, ,04#/A!b!b0C P0( 4 0 Br0 S8P(P1W*p 50 ,P(W0 00W =0 P( WTWp ;0 P 0 0p S0 (0W(Ph 0 P(]c0 , 0PS( 0$0?2c1, 11,0 020 0000 0 ,, ,0 0CP0(J 00000 3 ,, p,0 0CWP0(000c c0 ,_P([(P000yW0T 00. 0 GP(1 u  RO 0s! `p0@@v0 @`   ` @aKal B  0 B0 V PKUS ZSP  @ 0,"P ( 0$0 R0Y R0P ,P\ !/#b!!0"A `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0,40 00N(0~0 S!0 @pA_Q"pG@D  W@ 0 40N~ Q @(0>P 0(P00ꬷ|)\P(\ ף0  L Ql'$I jiingN Q|(PP @ ACLC|q \^JS S 00#3P0z z H/o"(PzXn|TQ(P7 pp@*CP(!B0pu10 B0,Pp> ( ' Pp#/"b!C;R, a2ba126MP P(P @ @0C2c2c2P$00( (0 00 @ 0 @Q ,0@0S} 00@y0S 0@r r,p0 0P P(00, 0C$0(^3000c^\0M0cP$`jP$`   0P  P(00 , 0Cq$00(06  p  0P( ,  #P ( (0 b$ 00 0M0ЍأA-!1 0xM@P0t00PT 0SA@0 S?xa`\`al!p0  ڸ0P3D! `p,`0 H $|00 0UP@@ =@ 0 0 t0 30#xЍ0圀 S``  m>T00i>0d0 00@ 1묣h L _ ^^@ ^}p@-0M@ l0P s00Ѝ@-0M@{0P f00Ѝ-4Mo0P Y04Ѝp@-PP1 00Mp0,00`@P4 U<    P00Q Q Q = 0 0 0 ,0 30#0Ѝp u xp hk`0` `:0 ;UD0D D;0 ;d`t,t,t,Eh \O@ t\p@-@PP U 0DPp P @pD0D D70 {;U(0( (80 q; \ \\ [G-pP`' X/ Y q/V @P0PES  R  D$0PEV R  SS0@0D@ D0D DH0 5;X(0( (I0 +;0[ 8[<[| [R@- 0BAs @Q 0CR ;@O-阡PP p MU WC F6@PI l7PI  6p`M /4101S Yb7 Ѝ0g60P@N6P- 0 0P )60 0 ;=00 ;l0l lD0 :5<00808 8C0 :"7XY xYOt 0YRQ@-M G@PЍTT <@FЍ< 00O--ഁ M Mpō@P`pH 1PS pK @\D LX0 ^00pt0 O)00 T>.9 q@0,  (@P / P 0 0 5 30ݍ Ѝh0h hD0 :D<00@?<00 $ X?T 3pe'3p`" `d"__"!D_=G-@P P&`P $rp ^t  0F0\c<!#b!b0CaqV; Y /PpY` $00100S p !`1003/P00H  0 $0,100S100S& 3/!p 000``0S 000S( 3/000(㮦P`0003/P 0 p 000$0S㵧P0 $0~00^]4 ]`]H]\\SR: G-P0`00Sp 3/0Y @IOP T 00 00 Y @IOP T P00 D0D 0 p`P/ \[[[x[SR; G-P0`00Sp 3/00 Y @IP u T 00 00  Y @IP b T P00 D0D 0 p` P$/|ZZZlZXZO-PPM M Q@ \ /\C ӼPy%P8p/\ @ @. D\k `P /RR.\' B Rk/0  F02 P 0E P pE 0: S 9S0/\0Sw@/\` FQ .PQX 0t/S0W0MʨP !sP uM H% \@  W2+/\p@` @ὧލ Ѝ.00X0/ލ Ѝ @33 X 0/ ?   DP@Z!300 @3>00 @3?00 @300 @ 300 300p@-@P Q Pp`\Pዦ0@P P`V 20"S Zp200p@p@-La P`M=  $00QP0P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P  800  2 0 @s4V|LU4Up@-@P`P3 V( 0Pp:P @P0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 0(0( (0 06 6,) 600/4p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 /U8 808 0 /p <(5 $5O-ȟ M MDčpĝP 0f 0So 0SV t4!S S$XPP `P  pP 00S `D R!' D0 00 Pg 0徹0P0s` @ `PV 0 S( [T :SZ \S S S 0U:HPPE VpP+ 冹P @0` S[1ZP#QQ ,P`600`SP0@VE0AX0 0p&6 0 D4 30bݍ Ѝ:SZ PPEV  00 0S mᝥ00@ @pP: .d5@00PS0 0085p0040$0(`,= Pv :SL 0@S t40@0 0$<PK0C 04 8 0S:S XE H R0 0  Q!000M P@04@@0p* Ᏻ0:S e+ 00UOPK0 E0 *)10 S:S008$ 0S:S00< 4Y 9WxX` d 0 00 DU-H-M0 S0 00 0 0 0@  00^100M 0 @R0    R L00 @ 00 0 0 30KH Ѝ/ UThT4@-K0 @ @0 |6O-@`$MllPX20PY 00 0@`QKP p W  ~P G R pGpPH0 S#: )% U10 r 1$4S1$ !t@00H H0S "<100S (!0 0 0 306 $Ѝ U r ZpP Р zP 5SX0(, VT00#    PH H0SS|l6L54@Rl=l ˠ@-(@M@@0BPЍt3  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A A{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T )P0 0# 00Ѝ )0Ѝ0-$M  00 0共P$Ѝ0-$M  00 0uP$Ѝ0 -M 00 0 dЍ ㉲ 㐲0㈲/C-LL sMPP`0 V8 @X0^00pAtA巕0O0PP P1{0p0>TA{# 0 $@9 0 0 1 30sߍd0d dG0 &VH0H HH0 & ND=<;:987654321f/.-,+*)(! F Y @ 00CS0r000@T@0TS XRm    0 ( 0     6 4  00 0@0( 0CP000&     ( S@ @& YʱY  P6P&P0 U$Y464&40 K$Pp _P @0c P P  0 S0 0C0 S P @00CS0K 0 S0  @$ 00S NP40SZu 40AQ0Q 0Yk $ @00ESZ P 0@0CS0W 0Y0 O @0ES$ PSZ R0 0@0CS0  0 S000S @+ D  @AQ X2 @ P 0@0CS0Z000 0XW $+D @@P 0 R0 @NTA 0Ti@@P[ 0 R0 $ @XQ[@@P  R @0 00K? 0r?(00Y D   00S0P0SY 00 00C@0@00<000WS0,` `01D00(0H@V< ယ P 0  B0=>J(  r8$0  1p P p /p *=>3PSx $0S0000PS`FP Z,`X@ $0S0 00 0000V0PLKЯ x ,0  l   \ 0 PP 0 0C P0 SzP 0^Z``,40y#Z`Iy @0&0,(0( =>0#C0,`-Ql ]QP @0c Q: ,`0;00<0000000900000 000:0090 00|0:0000s09000l 0  H  0 PB P>  +P6  P1000;000;0A00=jIT  , BR@ 0Z0 @$P 0 R0l @X<0#  R @#  R2XX  P BR@ $P$M 0 SJ 0iT nT  , BR@ 0Z0K @ R񏐷D" AR>  @ BR  0X0@ NR-  @ BR  0X0] $@(T  @ BR  0 R0 @)T  @ BR  0 R0 $J$0 S$@5*Y,Y0$ 0(0@T 0<050 (@* n00 500S @0SI 00 0!Z] P 0@0CS0| 0 S0  @]0SHP 0Z 0aP 0Z 0 p00 00= 0#P 0X 0@^@ =. #RRc @R  B   @ 00. @0=>03SS' 0@T0C0000@000 0SP @X A 00 000P@ 0 S= 0@@Q#P2 0 S/ 0@ PG 0 SD 0 0 ( _0T0P0S 00CS@0 0 S000@00CS0400 0S0  @0 ڗ PW 0 40H0 B=>  @J!r0 列p= P p ϗP 0Y0C P 00S"0,p `0#  , BR@ t 0 R0l00 (@m00 P Z 0@003,  ]R$ ZzPp80$0 0P80,  4`, rO<`T xP$0 0P(0080<$VPR 0 SO 0MP 0X 0$@3P= 0X: 0@PD 0 S@$P P; 9P 0 S1$1I/wP 0Y 0$ @0iP. 0S+ 0 @0$P P UP 0Y 0@/X,` @ t,T=P 0 ST @tZ( S C@ S  &P 0 S 0 @0002P $P @-  , BR@  0 R0"  ,$P&, WP 0 S 0$@ P 0 S |Q 0S@!0@3ZS 04P P 00 0Z  ` `d0$0H00 ? PK A=>0 $ C 0rp5 P&ZP@DD 0S#T `Z 0 @+ @D00yP0T0SJ0000rp0SdP Y ` 0@00X_<0< <08 00CZP@D`ؗ A-@P`py0 0@y@-@`P MDpe@0p0 000@a Ѝ*A-,R@QP`Y v 200S5 B0P1S010n L000Pv`! pW@0PJ ؓPPZ 0 =00  C `C0000  Q  Q*RQ0 <00@8 B`00 `0 WP00P0s0 P B/0 B0 `8*H lp@-@P ᆀ0@p@-0P$L`T M 0S pW  07/@P  Ѝ808 808 0p@ Ѝ0 X0 00M 0Ѝ'A-0P$L`TpM 0S $X 0 8/@P Ѝ< <0< 0p G0$m@ Ѝȓ p00 0M0Ѝ&A-0P$L`TpM 0S (X 0 8/@P Ѝ< <0< 0y, 0(4@ Ѝ 00 0M0Ѝ8%A-0P$L`TpM 0S 4X 0 8/@P Ѝ< <0< 0D 04@ Ѝ L00 0M0ЍT$O-MD@`Zp@P] UK 0TS$Z0 0S- [* 0 ;/0S5 $\U 0S H[ 0 ;/@PЍ 0 0 {0H 0 0Jh o0@Ѝ0$\d d0d 0[ Y0D D0D }\ 0Nꘐ @h   `h@-$$@M vЍ("@-0P$L`T M 0S 8pW  07/@P Ѝ< <0< 0 08p8@ Ѝ 40 00M 0ЍH!@-@`pPtt0l尀 ἬT  @0 $ ⩬ᢩ!'0O-şM `@0  0P0 pP0ʿ00! B b09<Bp  UQPE @ 04BL3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b %P  00Ds0S0S0 S  \00t0!#300@ 00@00 @0`PUb*Ѝ@\ M00 P-  R^^? @ 0 `0  P 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `\00 00 00Cs0S ``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`ih q|A- Q@Pp`! ᄑP=0D?o! D2]R0S =h0$"0@ !1 0 V V 0$ P0 A D A-P@` Pp .T Tp!0D1(0D,TS0 pAd_T %(0$"0@ !1 I6 O-ǟ WMT|ǟ@P ,pခ儡<  ?oY20S_Zg Yo y Ph0P 0 b``0P(0 [080{ 9@00 P0 $0U6 `$p@00PU`" T U 1 #00P?0So PzP P6&0 PU` 0倁`FFa VP1 P! L `pP Р  00S  V L0 G0CPa  * T50 0  R  ' 050 0  R 00 00 00 "00@\0000 Ĕ U( `(PU$ 0p 9/P00( 8X$44 0 T1 30 Wߍ<0S@<@N(00(ΐ 0PS 0S0 $ U `(0Dp0C 0P@ 0T 0- p004 L l6<pOP@@@P@T_@ @@ T*0P3<:@59p0 ? 0, 2P0 E0R$ "@ [PpY`* @ 00S0Dp<00 SR00<0@d(b `t Pp]0 S2"0 4p@1!0 Z1!0 YPꨑ ) 0 L͏p a 0S 0S& 'P Dp00ٍP+ 8{1!0 dR~p200/ 0>0 0 !y 000 z0 0p80lH  d T\Px$  ā   hp 4@-@ M(0|0x000000@  @ 80P @0 0 30 Ѝx4@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝp@-@QM`P0  0 `Ѝp0@-@RMP0  0( PvЍ0@-@M 0 00 eЍ-M $VЍ-M $(HЍ@-@ M00000h0 @ .D 80P @0 0 30 Ѝ x@-@ M(0  0 0   @D <0P @0 0 30 ЍL  0@-@QMP0  0 Ѝ0|0@-@RMP0  0$ PЍ0$0p@-@Q0P`0M  0  `Ѝp-M00  Ѝt-M( Ѝ@-M $$wЍ 0-$M  0Ԡ$Ѝ @0S@! 00(p 0S$ 0 0? $0S%*(p 0S @ @0@ <0  $Hw xXv @-PP@`Mh Tq ,0PXPI00=Pn0: S Sr  SЍP P :P 0p#`PV0 `\0`.S0@D`H08< 0L R:0L R68< \P@D V^0 0U 4:0Ѝ]0S \040. S 0 :0 ;Th h0h d0 0ЍUp $p Ѝ t t 0A-pP`P% V. ,0 `T@P0\X0.  1 0 (0P$00R =@P \0 00X0T T0T P0$ V8 808 40$ @ps txDs ȸL@-`Q@M {pp.  8<0RP@D0RP 0P0V Ѝpp ZpP0@@ЍPPЍO-`P0(@彚@ 0%$0 0%$0@d DLU Ha ܼPp@-@P T UUpk 0 pH H0H "0p 3, ,0, (0p )` <` A-PP`D L'pC@,0 $5 SC S@T @娆T V,0`<,0L0`S00/S , @ c00 )pp@ P00/P/4 404 00|  ~_  1p@-P@PP 0P0S 0`0~0SOp@(S~(P~(N~(C$0$ $B0 <p^ A- 1 0 0PS`@(M @Ppp 00 @0Y P& 00CS'  p0 0 0 4 5;1:(Ѝ 0<080}"0 0(Ѝ0t^ ^ 0 00M 0Ѝ@@-@P Q PP 0 *0 $0] p@-@PP U p@R P0P PB0 U404 4C0 p@< T\ X\ p@-@PP U p@, P0P PB0 U404 4C0 p@ 꼩,\ (\ O-PMp 0GW"S00`0v@Y P-TPg +T@`0@ ?  0 0   P p  ! @00Ds \a0DSW0DA0DS"70DURX : QP   S  R  "000T@ W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`v00 R0  Ѝ p p᠀堐0 ?0 2d XR A B0A PR W @ 0`W p pmꙙdY 00 0M0Ѝ2d/@-@0LM`Pp@0 P LЍ`0 LЍC-1 0MM`00<0pP!x@P V h1 0S P(1 ^|  P( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nSP0S  .,@PPP(*|(DPpnfsuniop@-`HPᰗp  @Pp0@帗@p`@-@P @(0( (F0 O @ꘚU @-M @p 0: S  ᅗp  IЍZ00ЍO--3$M0`@0 ;#;$SP00T00S00 e00 P@Pp U * 徂@P 0G Pp@ 0 Bp P PE U@* 0S` PU|0 H Y*P 0    U1 T 0Ḱ @[UrPPu Y#: 10 001[ 00 @b0 P @ 0 S0S[ , @W9 0p@D@@0 `$0@b$Ѝ0 00 0l00S0d0宀P 0!ᰖ嘖p`z }T0T T0 I  l @ЧQ p@-P т @T @˂T0 0pp@-@PP U   p@Y D0D D:0  U(0( (;0 TQ X\P 0O-`PPp M# W+ 0Y0  eV 11* @ 7/P 0 T VK:0 0S0 ЍD0D DD0 W,0, ,,0 ꀫP nO \oO-PDMP@4S Z\ TU 40000Px ZW 40S` 00U0`0E4 0 000`:/PPP Xg*0d 0 0ᄐp`  pQ`(p0p$ ` Vp:/PU `X0$ (pW*`p `P@F:/P00[ 4 0@F 0@[@ p0 `V: @ PU0 0[: K :/P  04  K P%Qp`00S 40 08p0[p  P 0 `1&P #Q{t PFR'000  0 0!܀,UPP@P@ 06&```00A @Qtl00A0A100H H0H 0 Hn̄mnX8 Dmmlmdm7 @-(@@ @(t0@#t4lp@-@P PP P @p@p0 A0 Zz6 A-PPp` @P# P# tP  OP@3*d"00@_004 404 V0 )Q00@,6 z4Q:// BQ://G-88!000s0S03 0p0Q= `AQ@PP 0 `Q ̀@P   0PR@ v{Tl@0@S m{000  B BG!`8PjjPp@-@P P8PpU0 =Sp=Spp0Rp@-@P PPP@Ppp@1{ 0 0 ti3 p@-Px@P 0 P0@php@-@PP LPp P3#p$ $0$ 0 ]h3 08O-10  MZp @To p `P P0=S] @PT[^ A@ZP1Z04 S@@@S*Z3 z 81 0  H `ͮA0S:a ; D!0 0 @ Ѝ0Z   RS@ `0S a1S  Ѝ PPܨp@- @t,PpP 000pp`A-l`PP` p\@P 0=S SP(00@0 @N,@-r@P0@De,@-r@P0@ e,@-r@P0@d!00-!0!Q00 000000 0#0, 0# 00!R0Q0  0R000p@-P@1`%S 0p 1# R  " R     Qp@PP@1`%S 1 S  \  1  p@ Q Q      p000 0/A- Up `QU @ @E 7/P@G-Tp `AT P PD 7/PX PPHPG-Tp `AT P PD 7/PX PPHPO-P@U`pX 1S P@@E  7/P/@P@@ @@ģXC 1Q0000/ @0  0000Y @0S0@0 PT1S1 S Do  00000@ @@@@0@@ 00Q0 -"P 0 PC R00 SAP 0@/ p@-`P@T0h \ H RH  "   T0"g \ ` ``R```0000000000 0#0 0#0000``0000T ^pp@\R4 /o"!T0#00#00!01 000T p`^`  T 0V0pp@-Q  `T \ !O-p`uP& 0Q@@PppW@Q0Jh `X  a0PX@aao(Op(0pG.wZ_TaB& 000 D.@-,@@0@P0S@`M-`@P@_}P(p0@aao0Oo00ZO.TTaXPB(0( $0 0 ġ؛l0p@-05S PoP0SZ sX@ 0CR\op@T P UP@o<$Z_YY/p@-@P $P1wP -w$+wP 'wp@$w0 0 ~ $ Mp@-PP@ T $0p@! 0/L L0L 0 bT, ,0, 0 W# t||# |Pp@-@PM$ P$`0.UP  P pp(S00S 3/Ѝp003/( (0( Z0( " " d~p~A-$P0@MSp p0(`0 0@0p$p^Pp0(0V,00S 3/@Ѝ o00,0(p03/?pP A-PP@M) T2 0S Ѝ $`0P av00 @pP fЍ00pL L0L H0< T0 000 ,0< t|||| |P|O-d`yM(p`t,PP } t@Po 2 n20 RF n0!$@ !  00ڊ0 4L  00 0. $(p,`X PP 80 03/``tP"  _ !0 0 1 302yߍ         PhouP uuP||PXou``POo귪z1Xl8L z  Pz ,zP00/X@- 0UM 0H`0L10(p! 0H1兊@$pP$0P`p  S 0$< ,0 0 L1 30Uߍl/1넬|Wp@-`PP`@M& T. pbPЍp rfP aP  aP |0 0  PL0L LG0 kT000 0H0 aꬫw$ x wO-@P(p,aP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV sP``wn@P V@0SZ V@t00 vG-`R p@P8/PP @VG-!1 0M@Q000`PQ UI U .00P!1 0 0 30ZЍ0) p00P 00 S00 0)PP  0PP 0PSUp!0T  Pp0 pPp Pp 0 @P0 00P=/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R  B 1 // 0R  B  2/ // 0R  B 1  // 0R  B  2/ //0S :p@-@P0C0 I 00 0p/0p@-S@ :P0C0 7 00 0pp0 $000  / 00$0lPp@-PP@ T" cP 0S S pp@caP p@aD0D D0 T(0( (0 qx tqxqP Lqp@-PP@ T bPp >p@wcH H0H X0 , ,0, W0  qp ,ppp@-PP@' T Pp bP 0S S`P p@`p\ \0\ x0( Q@ @0@ w0( G0p@/ o Tt0t tt0 4 P   0븛$iPh0 ThXh ,h`hO-PPğIM,M IM$J͍$@@Pp P0`S S  #3 I0$ 0 30Iݍ,Ѝ RJ- 岐RW# " "  J=00h^ \#Jy0  ሉ J- 0S 0S> S" UV J=00 s J=00Xb O<  XP 0Su 0SD0S  0S0s S0S UVJ= 0 03?"R #< {<0J8 0TJ=00 0 P vJ- 0S.J=  0eS) S HJ͍0 E:01 00000G0 ,0tTP @-+ 00SdLP# P P J=00X0  XPmJ͍`Pd Ƥ뀙 fHd$ O-xxğ M@pQ4@0P0C`S,H6)('&%$#"! D QWX00 R04 0S SYex#p3 0 0 30ЍP#D3 0 0 300 HD@pЍOQWX00RT]WX) 0 "? s0;pPJTH0S0S ? /r x"s0 D&PTVT008" 0  lX: `P00Sj!0 T@@O 00!0 piT 1i #;pYp \1\\ P0 pY 0@D    ˇT00? YRp0쐟젟PP0 ppW 0@Df    ᫇T00? D ࠇP|TypdX  ꝣ ؓada$a``q<`4{xq_z<_^G-p 0 FM& P@`p )P  RW  P Wr`ov` 0@Sp0 0 0 1 302Fߍ000 00?1 00  0P Y: /r RX 0S ]P 0 IDtA-@P`p 0 | 0P `p@-MP`P@@P@T 0S  R0S +PIC@PЍpPA;PЍpp@-@P pPpPp0 @0 7T [0. AASq0C .S .R Q P-S.S S /Q P_S /0@-S GRC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ R 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0S00@-d!$M""0 0 AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S0S'  R  R R R/S /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PP0 PyG@0S0S 0S  Ѝ0$0$ $n0 o$ V@-PP@p`M T Q Q Ѝ0SS ЍS 0  0|PPpW0S S |  0p00S SH0 P 00 VUċT8p@-PP`@ V T! 0pAPpx x0x t0 *V\ \0\ X0 T@ @0@ <0 8 TT ThT /C `<0 0\P0  03/P 0`&<00&,SS00 80R0S  RD(ՒuPUA [?:E$040@,$0 C 0\@P0  03/P @0] 0P0+]`(]Vx80Sg UM &<00Sj&<00SD2!P` E/o0"SQ[Eo᪢R,0S0DZ@0P@C<0D\; \^7 @0C 00P3 0P00,00,0%SB @%4 0, 0 30ݍ4Ѝ\00&<00Se &<00Sg  E'UR!`y [I_40@Z,PE [p H0P0P0 p p$pP 8 pP  \!\ T0n0 0 00R"  0 P  0 ` P4{004000 {0PCeY0 Re대Xnd1SlXFS00S !pX ;P001\//V:p@-@P P@P eeTp 0  0-W t9L9rO-`P,",2M 0D000 0 p@P0S A@\ ST P-  KP @!x1 0 0 30UЍ0 SRB P> 0 c@P30* 00S  Pm X0 SR ]P 0 =@P 0 00S @P _@@ |@P ꆙ`jUi8O--ϟ MSp 0E 08 x@0嘀  }0 0` W, 0S0S  ` 0 . "2 Dߍ0S0S;0S^>3> `.> |.0] `P 0 0Q P 0. ^ 0S 0A?oP2U0P00S0S  p [ 0m吝`n`P`  0A a30<aP[ 0S  ?Q( 0$  0기$` +0 RS S0 00F`P  `<00@(0PP`$pY i792 I120Y0 0 S   S  R  R Q ^  ^ \/oQ" SQ RRV  0PsQp 0+0 0Si QRe 0S %_0P,0 zP , 0 B  ` 0P0Y ,00 X,8`l uP1x00x0 _`PPP@ `0V 00`_T0`_O-PLM` Zi  @㰱q p  PP0 0 0PF ``0S S S T@P `0S `(0 ( (`)P00 U `V Y 00  Y``VU$@LЍTT T0T P0/Z8 808 40/` $"h 4 ""i G-XM`@}P pP @o00  0 }P 40S0- XЍ PP _ 0 }P ^8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 0D DD@  00,0, ,0 ꉫ#EgܺvT2$ A-PPp`6 W* 0!ᣁ000?0"@@h>V0: ?0hV@Hp` 50S@@:p`F AH H0H 0 , ,0, 0 $  p@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@(` `0` 0 >T@ @0@ 0 3?h >  T\G-H"H2 0M000020"00P003  `p0\ @ 0 XS@@|Q0 C" T. .0N|Q0.\'^V*00QP0@^*0^0 8< 4^*0 8<W==|<- MaP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp 5(0!@$R0@0T$0B0S \@0S ( !0$ R0D8;: H A- rM`PpP: UB @X0^00pAtAP0OP01 000TAΌ LLVP5  0 )ypP& 0@WP 0 0 1 30 rߍ0 <0 Uh0h h=0 P iX00 0P0ꈍ9B8 8   0   M Ѝ8 -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/7p@- M@ Pt00h` 0`0 `P@@X@0@T  ЍpB,7@-TT1 0M` !000lp @P 1 Z lp k@ 0 0 0 30*ЍkPpW @@T PU 0S^P@KTC00@B<00ӌ6i86 0p@-P@0 0p0W(0PW(P,PW 0\0PP 0P 00,,qP 00pH 0@-@ 0 0 0 0 0  0 00@- 0 MP @0UW 00P 0 B?o20c Ѝ0,4 00 0p@-@P 0U0 0pp@-@P,W0PP(W(0P%W(P,PpG-P0Pk `Pd 0@00 S S0 S S l pPS 00pXp p8 (@P 0q0p0S S S@ 0A S  A@P0 ! 0S 0000UP   UPC0@>@O-@ 0`p M,0(S{: )(T_ TppW 00SS 0 RM@D@T0PH 00SD000@D@D0P0S- T0Y  0!0J@0PI 00S$0AS000  d0S000   S0S& 0p@0V0pp,V(0p)V(p,p@ ЍBUP  (,@(|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ0=p 0$  $ 0 . Ѝ0O-PLMI `|E$P@ @0 `` PP$mSpPL 0 ``PA$PPW* 0`@Q QD QR Q/ 0S:00Sz >SPb  `000 @p R  R/ RY R 0 @T:p nU 0J[0H 0 LЍ   @QA@ 0S`:   (⼐p 0  ,  p0p 4`0W G`@ @T: 0U00U `^ \LQ  QA@ \Y ^ Q\ @  p, 0S QAR^  R  PP@T( Q  A X " X. X= p X@  P@T+:>X X X 0` `p  ` )  Q@` ``  \0\ \]0 `p`uT ]  @-@P @hT( (0( 0$ @\Tp X</Ni'QO-^p P`ᬦPU<Q ( [@$0`  $ X(0,2(``-P p`[ # 3X(0, 0!(`` -0P p`QJ`a!Q0#03U0S` Q:PQ Y5XX030#1! 0 S@~000X; S`3 `#61S41`F2s2`Fs1`FPS0`Fh 0`Fv`4:0;`0Y S`3 `#61S41`F2s2`Fs1`FPS0`Fi 0`Fv`0809```L p@-`MGgp& @hp) P0u0'{0 {@0@Dgt h0 0-P Ѝpuh/g00)g / p@-\ ,@\ \ Q :\ :Ap00p00C-P$0@SMJ 0( U4p :`H;$963>0HG81GpB70B- 0R  R 000<890L>1 0 00LЍ 00!00{ 0 0@-S@ 3/@Rp@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$EA! BB  D B &"AA!@@  B B!"AA!@@ pQ Q@#`  P`PE@F$NN. B B&"@D@D"F$NN. B B""@D@DA$NNU. B L B \'"\  \ \ , ($P@\ \. \* \, P@^ ^ N@N P@\ \ \ \ @wPU  0R40008 Sh`1S   ;`1S0 0  0PJ0  0P7P  PP$0  0P0  0P0  0P0  0P0 0P`1SxYz < P0ppW  0R 0gzpW 0pW  0Rx 0ggpWf 0pWa  0R0 ,0gTpWGpWD 0 PS00 g`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  0N001p 0C001p 08001p 0-xt1p 0#[uNL #gtЍ tЍ 0 n10 g0 ` 0 Y0 R 0K0 Dx0 =LH  P lHhH(@-@`00AMM0 400p00 ?PP0S wD 80 0 4 30AލЍ.2ꑁ 0,@-@ M pp P?`PP 0S <0000 Ѝ00S.S 0S Ѝp@-|0|AMPt 0 ` $ 0 @P %8 00 0 4 30AލpCXp@-P@Q`  @Q cPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝp@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00Ѝp80@- MP0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0 T Xp@-Q`M x00<@QP 0PU  0VЍp_40P 0`Ѝp @@  0@- MP.0@0@=@T  0U Ѝ0p0 0P[U:L@@ Ѝ0<00@00 0PJ Ѝ0t $,PH0@-@ M T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPLP xp 0@- MPM@O@ P Ѝ0 0( 0P Ѝ00@- MP2h0h@0@B>@T  0U Ѝ0O,0@ 0P^ Ѝ0 $4Mp@-@ML 0 Q0P0<00P@ ` 0. 0?T @D 0D000T H0 0 <0 30 @Ѝp@Ѝ/.0 Tj2 \  O-PM@PP a pi`e0 裟Q  ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'< 0'400&( '( ` p0R0`g 0 T @ P  S#3@ P 0RQ  S # 3!# 0T: 0 T @  P  S#3@  P 0R \  S # 3 # 0T 0 0N 0L0 000J 00  0;4 |O-`Q0 dM R 22/18R{20\0QS0N0@0l2a!##\B2b1!AP2aL5BX2dD@AEW0E0<02h8's2Q>?2crlqqHL01NਂhL΅ReXT P0HP QN} } }[P0 T XF Z H Y J (0L0$0\04 0<0,0H0 0@0p 0D P40|C[ [HZ WHY SHdЍ00N\0`R`(`j  0 0dЍXZ HY  8igMbQ(د@-@P$ 0D .R\0@*S0T .S@@TH H0H D0( [QA.@S@@0l @-$MP`@P`\0pv> 00pp< pp_p  `Pc$ЍTC-@P@ `p MPOP @U ^P@Wt Ѝ @Pt0 0000 !0 P"@0S0Toᨂ#P  |C-@P@ `p MPx@P @U d^P@Wt Ѝ @Pt0 0000 0 Pg"@0S0Toᨂ#<  |p@-@P00CS0 S u P `0 Ppa`u0 0CS0pSr P 0 /a@-M@s0  00e00 !R !0@bЍ@-0 S 0@Q0 R  004S 0@l@Q0R Q    R Q < Lp@-DPD0P`@0pp 00p@,X0!H Lp@-@ @ `@0Ppp0p@, LA-DD p@0P`p0 A LC-P0 `0pMpp@ H 0D @ <8 @Ѝ :< LC-tPp0 `0p MFp@ ( 0  @ Ѝ9 L0 00/ L0 00/ L 0 00M0Ѝ] LA-TT p@P`Mp 0 :Ѝ L0 00M0ЍO< LC-tPp0 `0p Mp@ ( 0  @ Ѝ9 LC-|Px0 `0pMp@ 4 00  "@Ѝw9 L0@-P@000 00M 0 0Ѝ0 Lp@-D0D 0@0pP p@M9p L((  M  0 Ѝ?H L R) p@-P`@V CP 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` 0T  0C0 ЍH0H0 p<0<07/0 0 @ D8O-Mp`@PPMWC*00V>:Y ` <1 p0 p, `P 0 P-0 P 0%Z ` p0 P0V0`FV0S0 0 Ѝl0 oP 0`00000Ѝ`ܹ^ O-M 0?͍0,0= 0080=͍000\ @p@LH$0 gPG 0@S P =4 0H P0 M0P000 0Hk=P0= <<0g@PU *0,/ 0|> 0;/ 0`Hk=0PE(P0P D0|4>xd P0 IP` 0 P0 0`PyYY 0IS  'B)?mZq=m#"pCXd~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! 3Pr R 0S .S 0S 0S00S.S=0@\90- RD) <9d 0 @ ! PE 0D$0 SaD0C8.800440PJ0000$0@ 0CS(00x0p` <Y@`p @D0  P(0ST0 ~P 0 0`P8000#808, 000.0 r  .00Q! AVP0$0Z 0D: 0@H+B 0?R0S \' 7 0  0 30  ݍЍ$7Y =00SF=0@60\=0@60V=00P040H00!P@00 0?0P00|& @t6000#80\P =4 0H 0 P4P4@4 0PD;5@@2 0)!Pd00004 0 BrPY 0H@ 0R0JZ0Szl%l5l h0T >p=00S4 @0D;,5d 0 P`0 P+4 0P` B;P"H40P`<8p@C 0P`)P0 yP 0 P`P(=00Sx4000Xd 0 0D3 0! SP=00P@C 3 `PM V ʜsVp# @Pս0 4P0T00 E+P00d0V0@DV!P3d 0 d! PEp`$P0 9@P 0D 0PYX+ !$$P$=00@CD20 p 0 Pv2@DK 0d  *0 Pd20D; 2d 0 0 PR4 0p BbPI$0D P@C x2C P` P2"0 $@ 0ZD8: T! P($0 @C20+Y] =00SC0@d 0 0`P0 zP  0 d 0 lP$0@T 0DK*S$` pPTDK 0d 0 00  NP =+L0W 10"3$ 00;L0==0;L020 200;L000300;L0<=0;L0L10 0;L! P 0D$0SHtp@`T  P‐0d U`  R @ Y$ p0d  @! P{@T0 +A0W 10"3% 00;A0==0;A020 0;A5; =+L0W 10"3& 00;L0==0;L020 200;L0L00 0l&;L>L C +A0W&1 000&;A>A C6;w  4 0 B4P 0DK$0SPvp\' `(P倐P 0V  R @0 Y$ 0d  0 ]P@T0- \7!?C0 S!GP|P`S1 0(@DK1#0Yp!0/Pd=00S= 0@h80W 0   4  BP 0Dk$0PCUQFڸ@p@U<1 W2 y0d  I 0 P=00S= 0@L9040P`<8p@C 0P`Pg 0 P_ 0 P`oPV 0 PN 0DK$00CS @ :0p4 0p BRP9@ 0 P1 `jDK`0PD[ 0d  0 P0PD[ 0d  0 zP 0` 0P 0;@d `0DK P 0 `PH=@ 0 !OP=00S  0d 0;0 ! ;P`V D 4 $ 1RP@p` PPPP=H 0 0$ ᳹Y@ *, < 0PP< 05/=0I 0VHD6 $0S@P 0 P@P(0d 0=0 5 ! Po=00S/@/ l=D @@2 0 `p0 PP$0 @PHf ]0P @DK P<0 P5 @0 DK P+0 0PP# l0D;  0P4 0Pp B(P/@/0P0 0( D[@>4@0 p`0 cP- 0?@B!?C0 SL0 PP=00SY=0@?0x=00S0SK==00S< O0@d 0 0w `P0 P0 p0d 0D d 0 P 0 d V 0 P0PD[S3jC"!$%P%=0@?0=00S. p0D;?d 0 ' P`0 P_40<8@C 0 P`jPQ40 PI 0 P`YP@H=00S=d@0 0H[0 4#8T` *0,/ p0> 07/=@D@P0 `0H[0L>d 0 ! yP$0YD2*`@~p0p DPY V 0  YP `0d  @ 0 KP`F@P 0$ YH !:Po@P4 0@P BP 0 &P PDK3. 0@/.H,.  X5 ᮷=00@P , d=| 0`Pp< 05/6@==00S=0$,@ < 0(=00S- 0D;d 0 ) ! PHc 0   4  BqPX 0D[$0St+C1#00 S}!T PC=@0 0H[0 >"BT` *0,+  p0: 07/ 0P-@DH[P D[@=@0 0H[0 "T` *0,(+d  p0T: 07/ 0P-@DH[P D[@ !aP=0@90(P$0 PU 0D[:=0@90~=0@90x0@90s=0)@9 0r=0@h90e=0@T90_=0@@90Y89d 0 `l ! PU i `P0d 0 0X  0PUDK!P PDK 0 Pd!Py 0@PhDK40`PC@p0 Ph 0@pyP` 0DK$0S!PSP P`PVV wp@PK0 P90T00 EP000d0V0@DV! P!P @PTT vp`P0 vP0V00 EmP00f0T0`FT!X_P@&@6@ <0T =0@60P0 0H0 ݵU@>*, ,60(P5 05/0E,e `P0 pD{ !Pl5d P0 hP0 P 0 ?P0 P,0P D P=H{` 02PP{V *0,$ 0|4 09/ =p`F`H{ `p00 `P[(0 PS+P0  D PF=H{` 0PP<V *0,# 03 09/ =p`F`H{ `p00 `P<0 P+P0 D xP=H{` 0PPV *0," 02 09/=`F` `pPH{ 0 0PPP0 FPY+(@0 DK @8P=HkP 0t@PU *0,! p01 07/ p=`PEPHkP`0 0P0 P;PD0 PL$!PZP@(ȡLԞX0P(JpXDp$ ܛx(,X\p. 0EH|d<̖h@ܕlDlDܓtܑĄhp<L4ȎĂ|txp\d0$< |" P0 0H0  U@t*, 00P1 05/f!aP=00D!@CH1 0=0@`10=00t!@Cx1 0!APqpP @`PVVh qp@Pdz 0 $P0T0 0 EP00d0V0@DVI!L PBd!P|rpJ@$0@X 0D:.2"0 /$0"@C2 0($0"@C2 0!=0@2020!PespO=0@$30 0sp@P` 0 PL0T0 0 EPC00d0V0@DV!P4!P-sp=00#@C3 0=0$@ 4 0$0@C 40(!~P @tpIH4H$0 j$0\$@C`4 0=0t$@x4 0+I W0W! ##4 0  +I W-- +I WW" !"  +I WW  #  +I W,- +I WW! "  +I W 00;I!.PPUD{ p@- R  MAL  ,@0@(@@; Ĝ0 Ѝ9MM$000 1 2Ѝ/WA-PS`-p@ @W0 V :0?s00@PU F(P(0P0TPD0?T0S,0, ,l0 NPP G-0pW:P 0?W0: 0/W : ` SS/  0W*Q(00@0S X0T0 "$ P0@A-QMyp$0PS@` 0! $, (0v(`Vh0Sd(0S0! , $P, (0V-ʀ100'PT, 0 ^,0O /  , U/ ,(0T0PT(0 S0P$00Q (0, Ѝ0F 0P',  (`, \ :0,0?0s0\, :$( ,00(0 SPU$P 0"곿00ꮿ(00A-QM}`$0PS@p 0! $, (0w(pWl0Sh(0S0! , $P, (0W0<0000*PV, 0\,0Q U/r ! , /r !,(0 Q0QQ(0 S0P$00Q (0, Ѝ0G P(,  (p, Q!:0 ,0?s010Q, :!( ,00(0 SPU$P 0"'00"(00A-P@P`w Ul T|200p,2 < V'Ì@D.?pN p2 00< V'Ì@D.(2?p::0 0 p 4 8<T0 T! T00p#2<0W0!T 0 000=   = R*0@R0@|0| |0 `0` `0 xH0H H0 o~   0l D Єa  O-cP`PpM U Q@< 2䒟`2 0 002 @0 00 0 02 0ᨂ @=Q^ P_ Z 񏐓,4U WT0 @ QZG@Y4ЍU W= 0 @  Y 7:P0U W* @ U W0 @  Y 7:P8!818 40P ׻Ѝ Z) @ZQ 0@ QU W R 0 P 0౻Y 0 P 0৻MQQ 00@=Q 먢 |  t X H  PZ4 ؁  ^P 00/hKlP 0/(/ ///$@-`M@lTpP@TL0 @ P@Ln_3ꜞ ~\rA-Q`PP@pR TG 00S@00XS< 0ST.C+SQ1- ~``p 0000  0C ^7ࠃ0ࠓ`0CVs 00000  0C Q700C20L0L L?0 404 4>0 غ |HD F  ~A-Pp@KU`* T @ W0``W0*.pPE^p P0070 2000 S037#Q00 ^00, ,0, g 00x ~}/Ȥo/஻갤///L@-` @0 0DM0<000p2 0*0 RP+ 0 0C 0< 00 0 <0 30DЍ f h}| O-H2HrP0੒ 0 M #r $rgqC2(0B刀B# C@$AQ i!dP`3 @@CB*TJXRW/Y  @0 SP7[0S  `  0T0000000S @B0?R0S2  Ѝ @0 MgP Y W 0 \P@D 0 RPX  @0 HFPWY @0@ @e0 హ Ѝ: %I$ș |z zA-`pPᱭ0S-@ ºT 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@ꖻ( 0 p@-M P@ ȍP k`\ PFo4 (0 0 8 30ލpe L 0-@- M0@R0  HPP * Ѝ@Ѝ/ * Ѝ@Ѝ/dPRp@- `@'PPVP0 ?p@DD*00pPRp@- `@P_P4P0 ?p@bD"00pp@-@Q `P?PP0 ?p@000ZiP IP NP<4@oP 400(S x  201 0ZnP q V PlЍ 00XS 40Y Y00] V4000S @ lЍ zgk\ 0R0D Rk0 ڐLg{R[{{0S, 0yS0%bQ, 0BSPQk S0 0 {k{'{jP0 00 oP 0 S B ? @ 0,`v@?AX P00 0 0 41 30)Oߍ Z]00E00<4 ►P@Ux x0x t( 07 T.R  :P uV` ` | Q -T] 8C]  t@BBO-PPM@ 0X0 X0 @ߍ0( 0P 4000 00 ` @ p cP 0 "00xP ? R R R#[ 0 R@ 0PUI:PE0S[PEi p @ ᶫ p[PEW R! 0 0 墬00 R R0 S S p PP  Jo P ᗧP !Tk*0@ZU  0쁟pP`P R R R RZ T4*ԙP  R`~pp 6 R  PEGXA Hq < PE  W   U*(P@D `( p@ 0 @ 0 00 ( P@D pa `@0P`p+u  `R`P@ (=^@-pp10LM`P0D00@G Lp0PS- @.0 P( U( qp0 0幝0  ?P 5   0 0 0 D0 30LЍ>Ptpp  @  T@ @0@ <0L l/ULX P   0 Ѝpp E@T Ѝl>P @, ,0, (0\ e&&` ;: O-ʟ UMMLōj|ŝpP`xU刕 0 0S 0  R0 R R 0p*0`: 0 L5 30UލЍ@:0$0(!0P00 0 ?s0ZS#``Po 0h5 0 0@P0 $03/P Z: 0B?o2\0R0S80s ỜP0`PLP00 v`V T00 Z@05`F00 0@P0R?D H<0p4X`P0 C 0G`P!0 $03/P @ ` Vf00p0 S(,0XW ,@x TH:0040D000@Q 0 d0H P0S\ Q  RM pp TP@ `BZO[P0 0 0S ! R soQ \ V\pp0XP  70$00W @0ST0 B@Gq 0P^!P" SPSP@Qp`0S 0 0`@D @PC0@P0CS`@:Dp` @rH0T C0 0CS`:080S0 S R:  C'SR]0@ 0P0%L PJ RSdT5 0 <0i@PC0  ,0@S<墛Y 00`S4 <``` P'05P0( 0S 0S @0S0PP( 0@T` *X0H0Q*p䅨@0`@0,@Hp@0$4 0l I 0SM#3 l 0=C R| R 0L0?R0 0 @P0 > ,0@SP D001Q>*0P*P P`P#0` CR00SYD0004D04002<gPeLp 0`P@ CR00S!@P`@$03/P `00D(`C 0P00P}  0 D00000i 0 0% x `  0 Nύ00>@1s;S0帕0pP`pK 94P 0 i@PC0 , ,0`S@0S00PD000ᚚ@T Hp@0,`%0%L x4$P D001Q *0D0P00eP 00D(@C 0P00P  0 D0RD0400lU DU T   L3 d3 A-@PPMD 0 S`05 S Ѝ0p 0sPP> jP9 80 0PP  0 0P`U 00S S 0pN8 808 40  0 X.-G-30BMPP040@ 0 00S0. S @ᬒA~ ` p0v #0Gw5P @T *X` \"T2P 0 <"$2 0 4 30Bލ 0    ! L5@PS ϧ`PN 8 0 0@ڳPK` 0 00 00000 0d0@TA 0 p pIP* ጦ00S 0  0pW0   0 0ᡧ 0 0 0 >e 0 ሧ 0 ၧ 00S Sy wwPH --G , + +G-M0`pM@P0P0 V 0   0 pPLЍ 0  PP 0   0ꄼ )A-M`pP@P , 0 (   P0@Ѝ0, 0ЍA-@P M`P@pQ UV'0S9 0S0S9 P`4418(!<P P0 0pP 00 ЍU U, / 0 0 Ѝ0S  0 00S000s S 04 P` @8 808 4 0Z06 0)B d 'O-DDğ DM<h@P 0 (0P P`sp0 `PP ʓP ,0  0P0ß RR RR 0 Q Q 0 R R 8 $0夓$0@P`  s p0S S S@ 1Y g*@ዓ@P 000S 0 R0 ?@B 0I  R06@DQ1   @Dԗ T!:  @Dp0 Sq CF P`0  פ@D q [p>`ᴗPT* P`86 0  0d!P1 0 <0 30HDЍ(CPI `  8P@ڶ P1 0 0 0忥0 J P`00 0 0 000p00 `O`PdB pp? p@-M`P@ ),0,0   0cЍpLM@-M@ $$ 9 ЍLL@-M`P @EpP0P0 ɠ@0@ 0   @0PDЍ@LXL0@-P MP@T 0t  P00 000R P 9 @ Ѝ0#@T@ 00KKKC-a@P`PMD UL 1 0`    p 0\# 00 0 L RW0100 L.\3W 00 @Ѝ R0 XS 00 9\0 @ 0 m0 mU0 n0 c\ @ pG W QU $ (,03?00,< | l p O-ß3 0,MPQ0$00@`# R P P3 U/00T#L3 0 $0 30 ,Ѝ(#3 0 $0 30,ЍOLr p 0I4 Vr T T 0@ 0@:T000 0@ TB 0t"P P` `@0 ŕP 1 Z, @ `V pW` c @$pT氐0Sl T0D S0 s\b 0@:TP ~ pጕP :V8Z' 0S 0$ S氐Pq1pJ04 ℡Te TSU 0 0@ u{0S 00@ i@$p@.T`@$pTPʭMT$: 9 9  x  @-1 0,M@P0$00`P V(  0 0 0 p 0P"* 0 0 0 $0 30,Ѝp0p ph0 VT0T Ti0 , 0 L86 5 d @< O-ğ lMQd@p0$ R P P4 / 0 p$h4 0 d0 30lЍH$<4 0 d0 30 lЍOyTdP`0H ⳠW T T0 ⨠ 040 $(,00h1T@ RT@P  0 q0S P q u ZP 0SP q: u00 Z0S PZ2U001P40@ 0b0T0` V?*:0UT0[ H"K 0 /PY0@T 0U00S 0Su0P040@` 0bu PU 0 S *  0CR00:!80 S8:7 0 /HQHaH1P`I0 T. T0S% !1 0 DZ Z Z@P0( R0  KP P: 0 0˟00@SP{ :0U0@K4 4 `4  @4   O-ԥM@P pP  500SL ᩗ([[ U U U  0 壗Ѝ0` R 4 ?$0[' + P&P 0;/qp 00P @ P 00 0 00 lЍTp p*P0  * R + L UY pp 0*P 00 0 SM  00 0;/qp 00`PßQ <`V;ጔ0 zP0 ;/qp`0 q 00 0`VßR <0`VßpX0P[ Rh0x0cX0`[MS  00Q\ <`800C`V0Z & "  RP`L0i?  `;/qp@ 00 `P  @ P I00 0 `Z 00 r\P)0S&: I y AJ0C0ᩖ;P`T 0S  0C`ß@1@!@G0 zA`V0 Z 0CJ `J`P @0P 0000 00m0 0 L0_h0h h0 >0e 0 M/ 8 $ l`H 4O-P$M@PH` U\0000 0 00#pp0 0@H`Y 00S `  PP $00[O X0 00@PF  WRR 0 B0S0 Q  R00S 0B Qp `R00S R  T*0D0 S P^ TP`p^H  C0 H`@嵕2 QY. ~P* 0 S! P 00S S0S S4 S9 S? PP000S 0 0|T $Ѝ`dP`VP ATq ^" S 0 `W FW WS SSH0H Hh0 0S@  T p@-@PP` U 00F Gp 00p0 60 Ud0d d70 0 0@p0TS00|  T  -M0 3/Ѝ/0@-@PP M U( 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0D0D D0 ଡ଼U(0( (0 ࣜ$   x 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 mU, ,0, 0 b0   t p@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0 5, ,0, 0 +P  ( p@-@PP" U 0S S S pp0p@0/0p@0/H H0H 0$ , ,0, 0$ t DL 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H00 ྛU0 000 ,00 ೛t H $0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0@ {U0 000 ,0@ ph %< (&0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0P 8U0 000 ,0P -\ E0 F0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L Y0\ U, ,0, (0\ P $ $e0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L a0l ೚U, ,0, (0l ਚH  (0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L H0| qU0 000 i0| f@  00@-PP@ M T 00vP00 Ѝ0L L0L H0 CT0 000 q0 8ꈓ ,\ d0@-PP@ M T 00P00 Ѝ0L L0L H0 T0 000 ,0 В t@ 0@-@PP M$ U- 0S S S Ѝ0003/P 00S00 Ѝ00 0S0 02/ Ѝ0L L0L H0 ΙU0 000 ,0 Ù광 X$ 0@-@PP M U) 0S S S Ѝ0003/P 00 Ѝ0 00 3/ Ѝ0L L0L 0 U, ,0, (0 ꨐ L| ` A-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP P0P L0 28 808 #0 (ԏ eD * $A-PPp@`M3 W< T% rP RP P P ЍPX 00R X# ЍAt 0 & 0 0  0ژW 0  0Ϙ 3P@ J0SP[@@ D| T^ (_H 0p@-@PP U  ;p@|L L0L H0 U0 000 ,0 Č h4 A-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0I 0  0?Xl l0l h 04WP P0P  0)ꠋ x L  0A-@PMP` 0$ U- 0pS SW   dP R`V* V V Ѝ00 0 /0 U 0 0 ؗ[0SP Ѝ W` K0SPVZ  Pp 00 x܉ L$ p@-@PP U p@T }P P0P L0 U4 404 0 (# X$? 0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0C/;U0 000 0C/0h W< 0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0G/U0 000 0G/ޖ { dp@-@PP U p@QX X0X 0K/ÖU8 808 40K/⸖p@9ꈅ ,\ p@-@PP U p@zX X0X T0N/U< <0< 80N/⏖p@b T D0p@-@PP U p@X X0X 0R/pU8 808 40R/ep@<  p@-@PP U p@'X X0X T0V/GU< <0< 80V/<p@ꘃ <l @-M@-P0.S00ЍP@-M@p  B0?R0S Ѝ(0( (0 0CЍ8 P R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//0 0 /D L0 00/$ ,p/0/ 40/0/O-P0 MS  ģē \o Q Xj@.   Rc @Rf  X^@\AS0SI <  cSB!  S   XJ`#SpP@@P   pGW`W0P@W `0FS@  0S0S R*00@BT00Q0S@"@2@ 0  ЍT S (00@AQ R!   X@\ P\! C]R% X!q#c!! Cr   "!!1Cs0#"1 0@0@s 0;S !S" Cr 9"X0@S \S X 0@@EQP S pg' 0`@0k pg'!"p0`30^Ꟗ000X.0 0eP 4 ,DQDO-Pğ@ $MQ `0Xt P`p)[V> *P @Qa P @Q`P P @`VT*` P`Vy [\Vr .V DAv Xt0S Q.Sm @]Pj `0PCU`PxQM  D P XS  ``/Qj ]QOP R02   0 ]R) PR  "  XSnP   R0 F b"r R` V` v`A ` @R^ .R @ѕ@  0D0C  X1ĕ(00$Ѝ辕00P  ` < V   \  PS X R0Q  S0 T 4*@DT[@ XS(@ X000… Q ` T`4*@DT[@S X00` } |y 0G-XAQ@L*p0S% RC @R`P000 0X: 0s00ܠ   \ 0 Sp00 @NT00Y0Sx x0x t0G/AS 0SPQP!00P0X(0@0 |w $<RO-P3P#RP3 M0U 0p`\ @W @RH R R4 ݔ(00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[Q[ 0 0K/‒  Y*@T*0P 0A\ R!ɑ" 40S 04 0u - M| ЍO-S@4M p0S0h 0S 0S0^P @^Z \S 0( X S B `$ ,PU P0S @Sf   [@9U `PU00 S 0W*0 B>^A ZP `00  K Z0T?\P0` RP SAS^01"0!0\VP`(00X0S $0 Q*0F S(0S 0 `(  0AU0S"  !  [)@˒Z0 p w(  ABQ APAU QpF  p  r  0B>SE0A S0AP`0S 00圓(00@4Ѝ R p0S   P\`B0[,? 0,$ @C /Q R!1 0R/Bpg00 0 0R5 P`[00j,@J0? Q0S 0 |0R/ sX \Q\ @ @0@ <-0 Dq Jlp \jp p@- M P0 `00p @ !|p < 40 0 1 30ލp@< A-P 0 0M `0 10@0 (q^p 0 ph0 (0 0 1 30ލo<`  Q:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R{00Ct(00/C/A-@P`TP% UVT P @TP 0?Sp G00B(00QSp@-`P@ ʈPP@`V  0R p/pA-PAUQ?UU@A`pP W ځ1AP(0000?00Q @-A?SSRB 0@S Aۑ00֑(00/-- M/ ЍЍ/@-M@ p TЍR/0S0 \ S 0S0000/O-P M@P 0DT"S ` P-Ya +Y Q0Yc T@ @Q q;pX`Ppgf;pwX`P" [-SQ& K0Iq P0aIQW0IAIQ70IS| V[SQ;+ 720S \0J0 Ѝ`Q0YXP$ A@0L ^P @ 0 0R0   ЍQz ,0, ,?0 Ɏ]T@@qhh 00 0M0ЍG0 DA-00 rMPPp`, V4 @X0^00pAtA50Oq `p00TA΀`L PP%0 @t0 0 1 30rߍX0X XF0 sV<0< <G0 i,: D  g 8f 0   M Ѝ  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/, O-@SM ] YXc 0pS000!R !01 PP E`#3`7P*Q30A 0#1#2#4#8 P 9    U 0C  pSKP0 0@pQ 0S  ЍT 0 @00Ѝ808 8@0 ō 0 0td 4A-@`Pp0 z0@$0$ 0 M Ѝ T6p@-0 000St@@@pdPddP @P@P 0000 0 p66x p@-P@ᓏ p@A-@`Phppp0php %T   2<0 qd  A D@-@P0S 3/000S@zĔ A-pP@`  F Vv000@P p@-@P?Ppp@@-@!1BMM 0`PF040@@@ @@8xqPpU h10S \!p0@  P8A0@ P< 1 0|!0 0 4 300BލЍ P  @P  4/P Q Q 0 0|p0 00P 0 0 @WP8 x3,D \ O-qQpMP Ap@f a@0` RD 00]G1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W 0@@00嘦dIQx00p@@5ЍPЍ<0 0{긑 D H24d1 10 0@-@PP$M U" 0 P' 00 0 P $Ѝ0`0` ``0 ɋUH0H HH0 ࿋ 0\ ~h\ G-@PS  RL `10\0SA HaHHqP`p #)/0PS-00兑 000S 0 000 00 0 00 0 00 hz G4P00H H0H D0 O8D$pxԾZ A-pP8 0S@P$0S!0`PP @0S PU @@P 0U00 St\@ 0@ P 0 000 ,0 -,dY pxO-XğdMR  0 S X (4`000SYD@0S00 0#003 0  0 00P YP3s003@0p0VQ QN  QI AP0S_ 3/0 0PY@p@ SP00SJ" 00C0T@dЍ.B,@@@#20\ 0,0Ss  R20$   @$(0 0 L00LqP 0S 0 <00@00<00aP 0 S@$0S(  ( @0P1 1S@i!1 0&( "0S X @L!L1L H0( X0!010 ,0( P, 00C0@g00$   @$(0qP @$0S(  ( @0$  $(0 p, L+t+ *ȉ |*@*p V U aU 8b|( d C-@@Ÿ 8MpϠl?2c Q11QQ@AP`\00QE?8@<`@ RdP*W?!1 0 0 30[ЍU00ì?dPER ?\00S T=*0!0 V5 @0S00L0  0(T*0 V @0S00U0Pep 0PT*0@0S00 V@@W <0Pe 0P4 Q`  Ĭ`O-ϟ M|ϟp `0S㨐嬀  V 00 0S %SP 0zS񏐆~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[YWVTSRQPONMLKJIHGFE.@;:97(54*1G*)('% {`?$A4/X-L= 0 |0 30Ѝ bOd @04  $0(P,9,##,cR:,c2S<4-PP4- 0 0C#/@!b!b0C CBq\\<N./3b112N 04<  #cQ<5: cQ<0!<3b112N 0 [0 S 0! V*0`0S00 Y `|0 p` Q @+(0 dP0   V*0`0S00 S0S~ ! V*0`0S00 YUSP  0S0  P 0P  V * Y ` R  ̉P0`p `0 S00C`  B29Q/0A!b0dP  K Vy*0`0S00r Su 0  B2P9Q/0A!b0dP  + VY*0`0S00R YU0  p(`CQ!/ b !Q  (0 dP0   V-*0`0S00& S) Q 8(0 dP0   V*0`0S00 YUPIUPE0 p``p0 L5`0 S 1h V*0`0S00 Y0Sz 1 V*0`0S00 S V*0& `0S00 S0 p` 0S 8 @ qp  qp @Q 0% S! -R S% 5Q0F. "x@V,h @P^Q  -R 0hDl -R P0R 0R R0X` O-PPß M@P  0S0 0` 0  0 S  0 020230ߍ0 0  0 \ 0SV  R 0x0Pz ] pP"rNA U p"^QFVh-X0X0XQ RO Gp `VE 0FlQP  Fl R0 h oh0 B00000  0 -0S b 0 0w0 0 00S 0h ?oh2A 0 B U 0 VAT00 V;00*븰  O-@SM@ 5 ˄ h R2<JbP0RRP=[0”` L4\,O 0CXdPReReCHDSL0P0000 $zp3ϠgNl@ l lGLˌ,#H#802c2c3L 0? zßSD >BW@122e3c`PL@. c 0z0#(: 600+$0+>! 0#Â!!!0C0(AX Oÿ2+" ?00 #2>[?W'`FPG`@2#2:#0D"D "Q0 3 #101`0U15? B4sppp0/S[0 o c 0z!(: 600+$0+>! 0(a`! o`!!!0C0Xÿ41+" ?00 #2>`T[i@t c 0y $: 600*$0*.0$1110B@T0 I:#$B0Nn:E.€Q_uk9"mn& Sc$IųQ\(\ףp= ף$" ! Q(\)\ s c 0y8 (: 600+$0+.X0(a1110BXt0 o☉;#(0```0 0 cQ @R0!T BqgqgYpC(1 ? c 00ky0,!(: 600)$0!)>X! 0Â!!!0C0x!Xß)" ?00 #2>r/E B 2?A1c1c0R0B 0 2P!502c4"2c2A" "b1C S/  `008P2P":#"0 όB! TY: 0"#2>"Q0030#0000U  PE0 S0  P P$ 0Ѝ@t)1?c 0 0x0t#):60 0($0#(>!!!0C#0Y("1 #2>t<0P0@<`pa0@<0P0@~T 0 0@-pP M0P0@P T0S V [Pjx<01#^ 0 01>! 02P"> 0R \ 00!1 R k~00Ѝ0PS, 01P0% V 0? VP(x4Ÿ0 1#̀P0PQ V0" RU̡bFlh 0 P F^P2l VS`@0FSHdpP [ 0S10ƒ!0 hh "0y0Z WX! \! !Z <Z9 R R >R@p7S*S0S -S0 C R`@0F)0H`hlp崠VUB tQJ d1d!0 t0000`0V m``@ vP P =D0C0CS\@0d/@D  ?@D0P0T0S00#  1 PWPࣷBU|,dwP@L0L L0p0 000 6 `f[ 4 D@-\Fn@P5  F0P- S& 0p@ 0$  0, 0 (0 0 Ѝ0 >0 n 0hЍ.q0000@Ѝm ( YLY@-@P f0#3@f0 ;0 ndXp@-P`@b R T0U:T0T:p@o^p@-@QPJ 00!R ! 00! 0S uP A0Q0R0S`' 0S 00C000P0S 0 U00SpIdP#0dP ` dP  \0\ \W 0In  A808 8<0 =nep 00WVVA- R` P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ 110L00^ 0A pW \00W00S PA0 SP0Ã@80p@,1! L0  A 0A]C-p@0T@1WP` M o to0S* D!n00@ Ѝ00o [o0S 0   o0@)o@O-P4M@p `\n0  00ShSf  %R0 0BZSZXWUTSQPM'J?>=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK 0V & 0 aQ S  T s4ЍPP؀PP؀010 00C0B Q$ROLP00M x3 0S 0V`1!'  x 0SM 0V`1!  x 0S6 0V`1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p V`1 0! xO 0S  0V`1!xX 0S 0V`1!0 *RS 0B Q@ 00B S@@@ x: 0S 0V`1! x  0S 0V`1!    x 0S pD 0V`1!dx$ 0S 0V`1!W V  x 0S] 0V`1!F +  x 0S p (  xz 0S px) 0S 0V`1!x+ 0S 0V`1! x 0S 0V`1!xn 0S px 0S p  0V`1! py xp qp jp& cp \p Up"s R 0Hp0y  V@ `1 | x 0S 0V`1! | xm 0S "pT  0V`1!t ; x 0S4 0V`1!e ; xX 0S p/ T- i* p# p$ p7 p#l x 0S 0V`1!'P x 0S p[ x 0S 0V`1!  xi 0S p 0V`1!$R 0@C p7 x 0S p  0V`1!x 0S 0V`1!x 0S bpx! 0S Vp@ x 0S Hpz  0V`1!  x  0S 3pe  0V`1! PZ X PU S PP N pG PD B P? |= P: w8 0B Q@ 0 B  0B Q$Rh x R 0p0 V`1@b P O p  P C p pO p P ) P $ P  P  P  P  P  P  P  P 0s 0 S ~p  0V`1@! P $Ry@00 P  P  P  P  P  P ~ P{ y Pv t Pq o Pl j Pg e Pb ` P] [x 0S pP  0V`1!p PE C P@ }> P; x9 P6 s4 P1 n/O-@xxϟ oM M0Pƍ0PD L@ D0S 0P00!R !0w0n0 d 0S   R  D0 0 䠍H I/@(吠` 00040h0\0 0PU @%U PU`DV 0p J0`0S00`` pU 0v0%10P,$0 0EZS)'&$#" A9     o <=7wOrj3P]P    R\00sX D0S Pb?`1RR`O`.>TQChˠNP`G0L,D \DPt/0@8D@P @z]P@ @0@ 0@00r@00E`PA@00E S$U ,@DTW V4 $;0p0  f S !0S0q-0v0$0S` $0@TS@@{ 0R00S"@v b`?0pdP$@0X`T`<`8` V` [0P00 ([0P0 0L 40S 40儀0@0S 00 00XX p)h9 0 6 30  oލ ЍUc ` Q`b_@v X T < 8 %1,S000 0Q00S@00儰0AYxR   0 R v 0%!R ` 0 0 $!  0 R [ @DT L  0 RP`0   , pBWS@0 00P(U0G0Sv +[r080$0S@@0S 0 1 00080S|00 x0 ,7 `R10P | 0R0 BR0SH 5 40S ?0P40 x0S-0v00s<0H P SL00 ppL00;00Dğ 0 0p * S ! `$0v`S0\O$00p0  0R00SP 0 0p$\b w`d`$@P`FVudVs V0  X0 $@v T0<080D0 0 b S% 10 / P/00P@UL 0001s010`L 0@0b P PPP v0PS 0v0 PP@-000w0'w0 SR\  0S PP`00E S @@ A@00B S$R0 S0L0 10  ,00 , L0,0S0c,0+0Pv000`@!V00L0QP0@L0U $@T Z0P  0CS00 `P0000`@40S VL000L0[  $0S$0SPDH/ P!fP`0@ 0$`P@~)`T PN '8 , (T 4 l x#P#^#p"h\"3 L P P0  0 0@s`0@pP4pe /> P⌰eP0 p 04 0@P0r000 0 0p * S ! 0000P@/ eUL000 bL0 P0p` ?0@0 00RpL0L0x0 b%1 :0ʌ`$0 S0v0p\ w0^000<0c Rf bRdP 00!.0e0d`$@`F0py!000  0e0SQ 00 Bd`0E$@P`F0paP P倰P P*U 00E S0$0 P! 00E S$ @@P@P]c``0 0p & * S !P 000S%Q<0,d`0Pw0\0e8 R R4 H< @KT@T ڔ 0 RP@0 <TIY\p< WP $   d 0Rb 0R$ K[[ ڔ 0 RP0 &$p[ pGWWڄU`P(P@FpGW    0RP0 S 0, B[g[Fp   pK[   0R0 S[K[0(& 0 \  06S00(0T嘰 pK@DT   0R0 S@DT0(\'0 P @ 0S0 RW0P000(GW0P00 >W0P00 $ R @bAd@@PAH00Q@P0 S W0P00W0( $HpLWhP0J0A Y+)p l@ @pPJZ0QP0SJZ0( P l@) 0 ^0 Ev OV0P00 S0 V0P000(FS0 V0P000(Id0Uv  V0X0$@T0<080SV VP@@0 (0@*0 Pp0 ;S@0 0:W[`(P@FpGW   0RP0 S 0PV0P00 \ EV0P00H0( 0CP0 +02V0P00g t@P0P0S VP@@_0h 0J? 00(   0 R ,0   $  d 0   0 R K@TM$ H $ 4 S0   L0L0$0 `S  ࠡv00p0S R``@D$@@`-0  Pp0 vS U0P00) V .>  0Ja400NSr `Uv vH^P0$@0@0X@`0T@<@x.x>x  0,ao.>  0"abWڴ^`P(P@FpGW 0\P0SpGW 0,0Pp0  GKU0P00  ] @  W SL00   L0pU 5 @  / SL00   L0pB@  S 0 P 0P0X@T RTo`Tw8`<XT[P T< @DpGK0Q 0O8 BXX ڔ0Q 0NX  ARR ڐᘐ HX 0Q`0SHX0(  0 T ^0 T0P0 0 S0 T0P000(S50(;T S(v 0Yڤm@``pDIY|   0R`0 S0(YT0P00 PT0P(o(1<0 S+0S cB-0C R)1ھύ L1BcR0 0a0  AC LQw*J_`L0 `0S0( SL 0 01L S-0`v0͵$0S` L000 L000000S 0 P  SL00   L0+ 0 P  0S0 S0P00!0(0 0@X0T080?4P0*:  0 g_|00CH0S0b0(0w<00 00b`\d` 0pP`F n  b S 0  Sp 0SL 0 01L 0 G S 0P<@S00(r ]   S0 L10  L A   S0 L10  L Y0@P\0SO <A0S0S S0<\TX`@?4P08@j`U@ʐXP v XPS0T0( 0S@L0@00 L000000` 0p0 w0^00< `0G ^0b{o\<@G8p`#" . AlS t '\ ,\0[PFF \ S 00\00ST0 08pS(0t@dJ\b嘐`(`pI@DT>   0R`0 S 0yQ0P0 0 0<0$@X0@T0?4P0QP00 0F0SPF0hS? TQ0P007 4!0  P@0 @T0$@07WL0 00L0L0 00L0L0P00L0L000 0L L0PL0 ̜ |xH8@D H 4D8̟Tl  >X8\p U P!` `0` 0h \|00CH0KL0LSL00L0 000 H <@BOP 0P (/> P⌰]P 0 pP 0@00l!l1l pD 0;\!1 8 01\4h J? 00( SX 0P!<ASG 0S; 0*L PL +L0PpL0NdSU(@0o)^ 0 0 0D 0lpQ^ 0 0 "2 0[| @B0?V0H@]@b SL00L0 00 0;0D 0?p 0SmL0 , L0jL0PpL0L P0L P 0P I(@0S P0@10X0T0 0@0074/DP00E SA@A@00A S$Q0S$ 1$0P] 0 0 *  SL00L0 00 0S0L01 $000$ L00D 0p_ 0SL0 $ L0 @̍@-@`P MDpIS@0p0 00b0@ES Ѝ A-@P`p/S0 L0@/SO--@/ pj0Pfn_ X  O{(j43): @y 0Se0T0 2a PPl"! 0#000  @ 0 `@P 0Q/ R  B / 0Rp@-@P*`0B @!S@ *@B@DQ@@@ "S0  `f2& pS@ * A BP    Spb ` PPO- -pX|M@ 0&F 0d p l0`-P-+*)('&%$ cj000P0 0 00@ S 0 0(0tP@1T00PCT!Ђ0 @l@00@ S0\ $, EQ 00 lp0l00+SZ -S0l000C ^0Sl~l00S 1C\u0X 0d0 00 0$0AS < S6 ?o240ZgkT@Xpp XFڐ*5 g01[5[X 0S 0S %0hSpHp tpH hD Pp t0h0 pLWt0( t0h0t0  A R8 Q, (pCW0 Qp hq0h000(0, St  800S~,080000 00" 0$ 0S B ۟˟p?@0 0$ HL0H@5 P{  L ! Rp0* @Pp p   !RhPt` PE a R$0@0P, C0E$@ PP0C PEP`PU00 S 0SPE`FK$0SmEQ<Q 0S{Vs[  P3  PP. 0S0SA ` 40 pSp Pp W 0Sp#[ V@80, S0d0 p [0[`} KQ 0Z00S<00P00Mc000h 0#Z00St0D0I `\X `P \QY[00pS  !c p Pp 0 S B\W80, S h 00 B0h  WD0h t000C?o<2Q0S )K{8Ik{'Zɋ,0S    0Sp|Ѝ ?@V瞯<? N8?00XS `l`0P P0 0p Ql000Sd00d0R ipj d|Ѝ , RiS IS NSl@>P 0 d0000l00(S 000nS 0p lpd0P0  ^P00ClT0j 0C Q$ Ql0l000C Q, 0pHpWt*W-  @P glp0000l0PX `00W'"&20{r:#:?C0C0  AQ' rR!zGpGp4656: HkH 30{  0QF 0S l00S l 1CQ$l`0C0$0QP0Cl00C Y1l00N0C YL\%0Z0a0qp Pp{ h00h0Dl@eP7 l0`0Cl0\Pl0 0l0 00000p d0s\ 0pHptpg  401{pt W'"40{u:#:?C0C0  AQ' TuR!zGpGp4656:L HkH 50{  0\40H 0d00 0 <PtpHW 501{'$PrR  OV 0I h 0 0R0h 0P z0P00 00@ L P @P~p@ Pp 80t 0C B80t  pF0p0{k V0 0ƋP00000H^P:00XS Q0p O)AoR^" 0[0 k12000 QS0T0l1 c, 0# Q:|00Q )Q  0L O-M<0 XHX8@`p00S 0 0Pu0@0P0  DB0SG^P0D= PPb P0 Q DS ZH P 0S S SD `Pb@00@0 00Vp@ !JT 0 PeS5q0 0@00S Z 0 P\Pc R  BPPb SP0E0CSڣ0SPX 0Sa =0 0UX 0p 0 Q U P  U UE^ PLU 0CC10BfP0DSy`0 S0 S C U 0S S S jKP@"00ЍRq  BPP+\~ -\  L^ ?L NZ @\ #L@NT @Pl '@Ѝ \ 0P@0Q 0S00 LS S80S #000 0 b@0K"00@C |`P `D21 2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf w0 S_ J@"00Ѝ@P0M@E PL `K"V`pKW  ` 21p 7 ` PEF@QP!80Sj80S 000i U U EP 80S800c8080S `T0)  RP!@L#80ST80S P 0 0  B P\ \vj 0`e  BR "@` P3 `2 c 1P5 X  /A-@> RP`pn3 ^P 0 W@0 p0U0`PEPU 0 BP @` pV  0 BPp0U`980@-- M@ Pc@_ 0 B00C2S*ސ*KU Q6cZ AKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ ;H0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/hl!H@!$!A-^0000PbA1 !0T2, l!p(  T2,0N10C#10R! T TNNN1^0R @-P@M: Q @ 0 R Q ~@ЍA-$a$1`pP0MS3 U10AT !0S 000Q @T 0 0S0 00Ѝ@0!0D1S<000)S 000!< pP <z 0p@-@P0p R pPQ`00App@D `80 0QApp@ p<0  0#10/sP30s R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P;pP   ! %G`~P03#01S412s2sS/1J //@-@P0@0O-0Z  @ SMpPA PaU* F B  F  ^'* 0H0C X000300 ZP@T   `d` X`Z P` @T@T 06S @ЍG-0@pR$A0 QPiV'10SP`P\ 00001010i0S l1 zPP4 @p PU `@00SaPP# 000S 0ͳ0ȳPU 0C  pPph0ⶳiV0S <0⫳ ,0R0i  $pq<EpG-P0R@T`塢ڃ0TP$ Zp  !pE0   a!  \2)0L0C\0003R @@HpG \ -0P!1^$23\ *G-0@P@DTpD !1PD*32\ ::P @ P@a0 0S 0S Q 0@A@DpQ$A3 ! V @00S 3 #V0`F`F` 02NS @0@PpP 0!Q@3A! p@-@ AP`DD 0` P0R @ *\ l10D R56 501 P56 +Cp0R `5<#511<?@--` M@P=@P : #z:S 0W0 0 C.G B 50c0 Ѝ 0P c2# R   W C>C0C012`0S0/0 R /@-`ap`@PM= H1P4PP2 pP,0S  Q5 Qp 0: S.BP 0uPP0@ 0$  0,  0( 0 0ЍE00Ѝd0d dE0 qC\PE00EO00$ (dH@Pp@-@P a;00CS00 P_;pP0 =0 9Chp?@-@P 00CS00 @ 0  I0 C?Hh$A-@PpS 0rSL wS aS_` 3E 0 \`0S! e C+Sr ^R)# `0S``0[S0\S0TS0USP`0 >0 B긪=p@-@P7 0S= : P00P! !& 0S 3/PP೼000P @ P 000 `*00aa:d0`` 0p7P404 480 qBD 0P0et<ĩ@-@P 00!R !.P 0C 0 ;0 MB e;X@-@P 0 0 S 404 40; 8B0 0 S@7d;$p@-Q@PPE 100S4 0 XV ?000SD 0#$0 3/0P:s007p00P @ P 00< R 800p@0PEH 0 J0 AU7P00s0]8  0@000 pC 0 @00 dt4:@c-Ѝ/p@-@P@TS S S C 0 pH0p@,0p@c0p@6@00 00 0000/<P 0p/@-C/41S O- @\c\EM  Q 5/p17/9? !0 p;o7( `l (|:/  p ;o$7@(p:/,$`;o0(, 7:/4p80`;o<48 7:/<`@D L;HLP̀FJK GpE` tDI( | HpŐp$` ǰĐpP`Xư`0`pA/`pf APpM_ĀmZPQ 0piPUQ 0piPJQ 0piP@ Q 0pwiP6Q 0pmiP,Q 0pciP"Q 0pYiPPQ 0pNiP YEߍ/BOB,aQ@-P @41S  P  P0BA-4!@ pPP/1S 0L1 @P!PPPUQPMoPP Qp ݶW dBp_oR_Bp\Bpp@-@P 0@Ķ@A-@`ㄵP] VapPwPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V A0@BA@SSO-P M. St$AT`p$a(q ap A`TP XX`A( [ʋ Q `0(qS 0 P@  Ѝ0Co$!?P (xp ₰\y Q @pT`x^y0TC G(V: ( $! AT$$( [ `( A^ \ :0  @P[A, R$!I(1s V( T  0 ? 0 ?0 ? (R 0Q0(0$ 1@($AP 0 XoPh D0^0$^4/Ԝr/r.O-,M0 0 S ! rp2/0, (Q0 CPu @`P@P\%$P 0  CZB 0@PUpWW 0 `PM 0@SP㲀1UJ[K ,Ѝ 0 mPPu/  $`mPB 0 $ `P# 0@SP㲀@1  WP\ \4 \  ᰠZ"[ L`PP  eP 0 hP@00,Ѝ$`p  0pmP   eP(q@GT 1S(Q0 @-@ ! \ @,%@ 0 ,1@0S@-@0@ @00,1R@-@1  @0? ,!?0 0O-`̙0S ]MG pPw!@P Uq  @| ?P 0 p <* 0ɟ0 00 84  Dm>@ i>PXP V P0 S40R !Q!3^ pdȟ ^ ^@4: P3p D H 0$p fP7ɠ3 LJ<,0(y pQPVNP P  0 p pt 0} Vo 0Sl A/ 1R *4+ )4p+́* (4) (<' 0<' .4 .<0 4< <0 4< 0#<  <$ 0 4< $( 4< (, 4< 00,#<0 <400 44< <840 4< 8<0#<< < <08 8 8Ġ  4   4| pp $ <  x0$0 (p , ( 4$,0p ,(048 < 4x0080 < |@ <4, 8p | < , <00@)Ġ| )  p' pJ0  | S!tpH (( x 岠*LL,| , S[,CC r A[W 3pWSA^O  8/@ PG( 5PC 1DpN8ɠ0  !NV QiU0 aPP$4Q$Px 2R Ÿr@ B 0! ` `]ߍOP Q=P| 0=p 0 pp=P=Qj=pW/ <*  8004 D]<@ Y<=pX ڕ==@P=P=P0a|=|=< XatHH<O-(P`P10p5fS@(Pp5 Rؑ嗰P- (f ,0[ D D S 1"1 Ofꂡ VP ر J$ J; ᡱؑ@-@ 13/, (Q0@-@Q .00 2 = 0 O-鸆MS`p & 0Z0 P!U E Q[ [ R Y <<YYY  <00 Ѝ P 5%0 ܕ !@P 0 10$!12֮P- 0@S0 200x5V00l500d50 0\50 0T500L500D5000 S S <00P p  20 2 803p! 0 0aUP U\3UX# 2Z 00 20120QSE  000 1S 06 pE6`@V*v`V`3w`0 ,P0 "  9-P 1S0S1S -0 29 20 29 20S 28 2CR2S # -  P}P s R < "4 " 8(P0<S 0%4,<%<00.4$`<.,,4<&,| 4& 80<$0480 < (0480<,0 4480 <*$,00 4*,80 < 40Z$0SW(PJZ㪠O*z0[* C00C 1! 0Cs0 1! 10 0 00(0 0S 1S RV  R[K  1'q 2 Y 0 xpR "' 0R1 S0"1!x1x!xb0 ]3P9  ' 0 CIY㩐2*yI Z0 0P0{ ! {0!10CS` *v00C[010{/ⰰ1l0l lb0 3T0T Tb0 36500딃  ln|nTmhdm0mD@mO-(0p RMC @a0kP`0P P FP"1uP0y1JZap@0 R 0 1S@10CS㣰L* 0Ks0S0Cs00 VqS10C1(0 0S Ѝ@ Q! R0(0 2 0p. 0  uPR  0R1 S0C1ȁ p P p 02"b0 r2T` Y 0I p1P QPEUP *0EY):YQNQPEUP:$2$"$b0 I2u00CY Vp崑 (00(0I1!0b 52u00CY*0 p1{PH Y Q I%PP @ PAgP8(00 (0%0!0!0 .%PPm 1P0CS㣠)*0J 1GP(00  %`@00 0`p崑Pq J(00(0 %(00(0@0@ @b0 1jjj<,jii h@0hp@-@PQQp $P 0 0[%Q $P 0 0N%ppO-P,a V0Fh  1$@P `Vp0ഀ0 0 po 10CS0*S0ST P" P 1!b0 ]1  H 1zp0FV㴠p1p 0 R 0 1Sp10CS㣰4*0Ks0S Cr   0Z0s00R10C1 $ R bP  0! 0 P$ $(0( (b0 0lf|fdeO-Pp@Q$M $00 2T T 300@$Ѝ(  @i @$Ѝ007طا0 0 Y`Pd  R bt@Y*  P 0PA 2@D @T㴐: 0 bt@0Y:1ᴐ0CS00 01*S0C0  @P 0p 0BRs00@010CS0*SP@0 #pP 10CS0a*Sg`0 @0 $ Pq  0S @ ĵ `R 0S 0 #q,Y@ t@@DV #qY 0G 1G#P: A`W@DT@: b004$0b 00n #4$b0 /1 1@0CS0*SPN #T0*T6EP@ 20 2$Ѝ4$b0 /T y#3#b0 / l#TE@ @DOoB33#b0 / X# S# "pPP @W1 @t@ @01` 1 0@1@`010# "P@ Hx 0  # "P 0 !@T|  #T{ ~100q `  " Pd 100,p Q^ [[ "QU`F "Q0WK `0E 1L"P? UR  Br@!V@ `F!( 010Q00P 1@Dt@@v01 @1 0 "  "P`F 10CS@: b0.  "  "P P58dd<b ba4$a``(`H8`_ ___^$]@@-@PM 0 0P Ѝ0 50 .(\O-Ÿ JM M@Pč`pPg VW00?470S 0SNIPIT/ j"P 000L"D2 0 4 30Jލ Ѝ > 0X0 0UXS 00; Iv0. T:+[) P0K/S  0ٹ0P00: S f0000S0I S\0?00$1$!$?0 '. QP PV# 4- [p!A00S X  \0 RK [ !P*000W ᒹp x⑹P 0@omk k @ZR Q0P:Q0Q:.@-u @-@@o $ @  p@-@QPN#q*`HP$ p@B0 0@-$M @@0S 0P000 00 0 pp 0S$Ѝ0$Ѝ00TP 0p 0S0     0Wl 0O-TM Pp`0H0 @8  8$(4PD 0,0`< @@pLp PP 䢟䒟䂟`p  @$ "dXb`%0# `!,l(a `& `zcna'b(*abf ` +l(ldH)c: fj.`d\l` %pଊ眉a*pl&`ah `猈b,) &`dL(bdl+`|.`lXpp<%cjgpl&`` `ga*aldH(d` &b() `b`j+g .pl\c:%pWpl̠*0S00000#R `V 0(p,0 000CS?1!00 0R0 0  00!0VS00 HX㨀*x戀10 0 \XP0TXP2/0  S  0 00 !0 00 0 궄HX 010<0qpGWp*< wpp0qሀpG0wp0qqᰁpHX㨀 *0x0,0LpS^ (0S  2 0 pPB  v raZG P 궄HX 010<0qpGpWwp*W  0 0 sP:<1  刀0C s0 11qpGWp*wpW  0 0 sW0Lp0,0 S 'P  ! dЍ 0 S10C$s0 11  R00000 0H0n 0 oP 0 0 0` 4@p00q H P haHX㨀&*x0V* C``F W0,01`01(p>a` 000000 2b 0$"2 b 0$qpGWp]*wpp10<0!1 b 0$+!1 b 0$qpGWp4*wpp10<0 X!X1X b 0$wp* P 2 0(-p00S ( 0 q$ 0$b0 $$0!l 0 b 0$ 0 b 0}$p00V;;4444dH4\4< 44433x54,3$322O-M  @pPPj 0SB 2 I0200$2 002 0 0)  봀X(0Q< S   Q`PR A`@DT@#*t@@D @h P 0RX @0`10CS@(*t0V 0Ѝb0 #Q 0崀 @TЍ  0崀|0| |b0 # Q P 00 q 2<2D0T0O-`pQ,M ^00 YY 09J  (0IY 񏐕fb0IS%00@,Ѝ(0YQ '帷帧,0 P1 pU 0pP1 0P1 pGp0 1 @P QPEUP: 0 b O# 0QPEUP:uP 0 Pb @#1q0pGP 1W p: 0 b 0#1|||V,01 PR  101 01  9@P ! BR : 0 b# @R @P 0 00QP(0r00@(0 = P 2@ ] 00,Ѝ0SN 0SK 0v@TF @R 0hp@7 0S "0!0 i @P& YJ YG Y(0%QUYq  OY#  @P 10CSP*PEuPY P @R  4Q0(0 @R y)@ #P @ Rjp @PEuPR c(01Q0CPS㣠uP *z0UY> P U r@PQ PEUp @P: 0 b9" @2"b0 /"R @, 1 LP 0TS>A T0D@ (2(00 2R0 @ 0,y0UUQ U0E  1 !@Pk 1PU0CPSuP棐: 0b !1!b0 !N0CsP 0@NTT  0PEuPD0!1  0 PC 1s @P0 10CSP: 0 b!1PP!0 P 1S PP @@ @ R ..--))l)4)t((@(|'p@-@`PP 0 00(0`00Q(0pO-@`$M,  弱 pPJ 1p0C0SsP1*U7 PrU @t@ @ 0Es0P P 0%0!01@0 @ 0[ @Kt@$ 0b ! t0@0p 0$Ѝ 2 @ TQk10CSP:l4l$lb0 u0TQ0 0@p P P ἑ. 0P0 0㼡 [0 30 0300300 u00CY0 00l뼡 [} 0J 1pP QᴐZPEUP:b 0  " @QP@ PG 10CS@D*0D@ 1PP5 20㼑 [0 %뼑0 [_ P0I 1pPx @YT 1 @Dt@ @U0PE1H e \ @C1!b0 ?  K0PppGw0 1 01P01  HP0)0Z!0s00 !p̰̠ 1@Dt@@U0PE1 @10  pP 10CS@:L 0 b|&t%$$$\$!<"!\ u000/H @-@P L  0 0@ ( 0"dO-@T2M0\0(P 00$` p @ ` pP03?0% 0g#"," ^0  0#0F &0eA$  "eK$  0 h10\00` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 @000000 00 0 0 00 000 000 00Ѝ A-pP@ $Q`?PU(7 )0(0 0`0$0d0H  03?\0h  08R(@R )P@ b)8 )P8 b 0A-1?`@Pp @f(X6 @ 0刁0 0$0@pG0($0p. ?W?@`G?`@`(`0@ @T 0 0$ < T 0$ ?pW ( 0$ q0 0$ ?W@`G?`@`` 0$ <@@ T 0$ `R @-/ N@-@P P Ό 0 0@ (4 0"̭R @-u/ )p@-@P X00m]\`  0 P  0$$p4O-B(6TM0^~?D00p$0 0 00(00400000(00,0000,0400080 0<080H00P0H`L<,A0$ @($` P p`p4<&c0<0$)$7'90#%ɠ%'nj) "ˠČ 0#ˠČ@0 ",0  .Ϡ' )00 *$(0 (0'& ( 0@0 0  0 08$  ( 4 , +  ! 0D Q, 083`0~?00L`AHpD`    $   @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP& 1` 71!004 4PU 08  R88P@PX`0(A@ ᤋ0 801248 Q!:$0 S p808P卋P8p0P 8 ` 0`P p80008PnP8m00`h  p P  T0  RX 0(0QP0 P  PY   T`X/oT" R@pP T 04S`X# @@@0V@ 0 W 1@U V W(: 0 0 0 30"Ѝ-@@@~`@ T X _Y` `@ T`I`~U | 00   h @- A0@ @ €1p@-P@Q Y0P ! "0 2pp@3p@-@P` VP$p0-P@  P 0S RP0/P *0?c0 3??oPP0/0/R00 B-ptx` PP5}  R l  ` RSJPQ P?e0 3??o80⃑ i`P5I 0 038P?e0 3??oP 0C"P1H RJ@, 5IP?e0 3??oH0 SP RZ 0P@ 5 0S015Y,R0<PR4@@PPrR TP @0!2P4@@@ P5`P_eP 5__oA/@-4!41 0MQ020' 0S0. /!PR*/ "RR /@ 1@Dr0Q R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ ӻ QRO-`P$MQP U  "100000@b0pRppP0@࠰P㒛+ 0` (P   5/P   5/P 2W00Z & 0 0J AQQ0@A`HQ!Q0Su*R*0RI: \ 0 C0000  5/P G00`Z, 5/PW W 0 S  0 0S Z W  0`F W0 [W000000S00R*R:  :W0 SW 0\KWJ 0\0 0`HCAQ!QQ 0CP 5/P ) 5/P \!0  05/ P 删  5/P 0K  05/P    5/P ڈ0F  5/P m 5/P  5/P l 0WC>0[000S0W5/P `0`Zn$Ѝ A   0@w N !0Q0 0`HCAQ!Q 0C!0Q0 00S  0 I 5/P n 5/P f  5/P s 5/P Ek 5/P T  5/P .K0@哐*Z`c⃀Y*`  V@ `5/PzW W  0 T0  5/P  5/P % 0 R0@0@ @l0 (0( (k0 poR Q0P:Q0Q:~@-銹C- 4PS@ M  $3/`t  0  QP` &|4P4S  $3/000 Ѝ00A- 4dpV:@T@T 0P0S  00 S  0т@P0`0dp@ B ! A-`M p@P0: St孂PP ˅P@ P 0 " tdЍX00PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0y? L 0SL@-  00AS 0uO-4MS{@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0    Ѝ P@ $ 0  | QP 1 {$R P0)^ 00@000dS0  pq0Vp 0  $6/Ѝ 00}00yO000Q 0A00/0@-S@  R   0 Ղ0SЂp@-@PT @T 0 `pp@TcP`p  0S S/P/ Č Ȍ$(0c03?c00 R  0 0 3??oP//  0S RP/0?c0 3??oP/@-P0Sp@M:Q !SV@Ѝ0A 0` P Fk@Ѝ T 0 @00O-PP X 0S & % 0S" p@p" a,0T T 1 ! 3/PS00CS@D0 T,0@pVP ?0T` BB \|  i V`!  0 0C00`@000CS0 0T` @pQQ  { D R ! ,03/`PIʼ0@00 "R( Y `1`! 00PVQgRJ ,03/`PY M 00CS@D0 T@0Tp   P @0S*V*  000P@DS*`A 0`V:▀0P 00``F0 ``i  0Y0C00 00oP   00C000Z`  000YP sd0d dG0 XH0H HH0 00_ 00[@ cbp@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 V0 O a0p@-@P0 R0 PSpb 0P0, @Wy PQypT dR0 q R/ S/p@-Q@PP8 100S 0  R 0   p0 0c0'   0R00 P @P 0 0 $0s0 ,0, ,<0 p  `L@-4aPP`p@M' W/ T7 p plP0:*C/o" R/  S L 0( 0R Ѝ ; 0 Ѝ0 0 Wd0d d0 TH0H H0 ~ ;0P  _pt^H\^ @-p#p3 lS0lM@PP0d00B 0 C 00  $#3 0 d0 30lЍ ~0p0S6 `}0P " V000`S0 rrhP0 L"L2L |0  0"020 0 0S"$`@ ỘPa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!`00 +{ {*{ 00{ 0SP pl 0M `` ` 00 ``!PZ  ,]0]LX||p@-@0MP!w00Ta#xV( )x0T1S Orw0T1Sx0`x 00UTX!\!R Ѝp@v\!x00Ѝp@v00UX\! X\!0 000S/8 pp@-0 00PUp@0v00TQwU0` TQUP vpX1P0X1w0T0`X1 ph0h 000S/@-@0v0X10CSX1 @vT1Ov0@vh p0 000S/g p0 000S/p@-P@0vU0 \AQ\ X10CSX1 p@qv`w0T1Ov0p@fv p-X X0 04M 0,008 00 0 ,0 304Ѝi p@-@QP  p@$O 0 90 t,@ WO-M8@qp0P:s0:T0Ѝp, ,0, i 0/4R Qlx@-@P 0S X X0X |0 @ppi, ,0, {0 lQH$4Q㼑O-PMp 0GW"S`@P-TP0{ +T S 0T W  p Su?0 0 0   P @p P 6 Q P  S  R- !" P 00Bs ^a0BSW0BA0BS(70BS%| Y[  Q P  S  R!" "00"00 0S \0F0 ЍS@ `" ?0 0Nj  0 00 R0  ЍS@`` j0T0^ XR" A B0A PR W  pQ ppMP0P P?0 %( @p` =W7pp7lmM<00 0M0Ѝ | 0 0000/P |0<0/0 0000/ |0<0/0 0000 / |0<0 /0 0000/ |0<0/0 0000/@ |0<0/0 0000/ |0<0/0 0000/ |0<0/0 0000 /t |0<0 /0 0000 /0 |0<0 /0 0000@/ |0<0@/0 0000/ |0<0/0 0000 /d |0<0 /0 0000/ 0<0/0 0000/ 0<0/ @/ /H-M3 0ЍH-M 0ЍA-`@pP@8#pW0PpP@-M/"O R ?#0!PO$ P!ЍG-QP@ ` S V " RpSR Pa 0Cj /o?o BR00 b8VS& ?o/o0CSpp0 c08ϠT \  Q0SpᢏVP00B V0 0T0d0?oc008?o/o Brp!0 S c10pV Veo0`08 @c0q< Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /| 0@-@ P  000褛m / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 0000@-Q @% ST 0 C0 P @D^TPPU0N QP Q  00S@R S Q0 S 00 /U/ S R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ ^S QNP  S^ PU@Q @0S Q RU // Q#/  //s R RS0  0/U/00 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@RP` R V  U  R 0 p0 0 ĂCRQp@-`P@ 0S0 0 0R0  0p 0   0: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M00 0000@>S@P  !0#00  :P0ЍM000 @-0M00 000@>S@ "0!,03,0  P0Ѝ)00@-@Έ@迉0 00/ -$0$0 0M 0崉Ѝ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ꀨ p@-@p@-0@ ,pDpP)h0Pp  //////Y //1O-0pPW`,M 0200000"00 ( 05/,Ѝ @PK 0S PPP S0S3*0! 00S S( #S1 0 0S  0S S * Rp C 0QW001 00 S0000t0t t0 *0X0X X0 봇@Tp(P6(6///O-QP00͟ MQ0Z Y6 < 0 0 0< 00$0 0%SS  HS{ 0p  0GZSZXWUTSRQPMJ7~}|?>=<;:987643210/.-,+K)('&%(#" ZU  {IrW  0`@ 0,p`,0\  P [: Q Q0 [4R BV Y ӄ ˄@T*a 0 PCUPE[ 0 [04PU*U 00Gp! 00G S[   * 0 00S- r0 /0 R0 bp< p*WM 00G S4p00G S-p)p&@ 0S Pu   0 P 0  BU@a `@Atp xp0 $   00sa 0SP00Y`@0`0 ` R R  BL \  [P*  QNAQAH0 [4Q*BH  0 0 000plWp p0` 0@ `,0, p倀p@ 0 00 0p 0SP00`0@0` <  000s  0SR00w P0 ΁0  c0RP `EVS @F B dV 5 00Y  000 0 +0p 02p/ 0pS 0 0)L5 00< 0 0 0 0 pS P0"".!c i< 0 p0 k R0P0#%:@```)a@ R`D<!i. dT0 ` c/*0  C0Cv Q 0000O0  C 0A e [  04 AQA Y˄Q* Q Y$ Y  0Yp˅0 0 M  000 0k0 [0K0"2 0 0 30Ѝ0 0 / ,  0 (   @ 0J` ` 0@@2 000+ X0 @r   ! q 0 @| q m@k 0 0 j 0 02@0 r 0 10!1  0Z 0  0@0 @r 0 00 0^00p0T0 0 V4 l5X5D-̠ h*؅`)04)(_A-@P@ `t0pP@PU J0PES 8/`uX@pW$0$ $:0 }ꨗ t' 0SS S 0R / 0R0@o/ @-YoO-((@ CM Mp4čP`r0@ k 0 @0 44 30+Cލ Ѝ 0p `0p/P Bqt 0h pL+  i  0i/Ϥ뀖 H 0 MG-0pS+ S'QU$ X!`@0`S  0P 0#S@0S 0S0S0S%  P V Q@0 R!R  "R0 R R \O-  紀BM⸏xMXčH1 0!p P` X' 0  p`bP@P Ucc0 ZP?PH <0 0 4 30BލЍ1  O-PP AM @ MT0č?2 Y.: px (R`5 P_0#s0S"uPU/ 0 0@T bb0  P PU t   0aPP D0 0 4 30Aލ Ѝ x (R֣Ȓ  O-M Mϟt p / 0  @T 1S 6 S `1  0 ?l@X@0 0 p t  @0H0 ^0S3 S90PpP@u` R IP' p 0 ] 0哃P R!R㇓ 3P PpU`@P0ST `u岀0S`V@ 9 S 0S< d - L - @ T p P  Tc0 <0040v?D0\@4 0` S1S < 300S S00X01< 021帑Y[0H0tSp080400SAT <0CP D0PpPPw 0;O8@  dP P@N0P IP 0 4 <0 @4 D 0 T<0D \@0S  H0SQ )<002p0^ S00H00SS *pt`P|@600P @9/P"8`0 @PF 0  Pt |*: 0 6 30bݍ ЍpW 4@P{D0Ppw} !5D0Pp0 e  0 : X0L D0pd4000S70X08<0PS\0S  徿P@|U  0`F0P?$P0,0 蘰 P(00E0, 净P [0.(  QO `1  0 P90 X0L@0c Y  @0a0@0+$0 0 0 SO@0b0!0Tp?A9c!QP :0S 6@40P !n0P(0@' ʆ  ,@0P@01 Q!  (8 0 zP0`1  0 70TX0 @00 00r  1 01 0@0`1  0 $70X0 @0r0 M 00 X6PW0&0< h XhLP 00 @q @1W㲐@D0 `TPv? 0WP G  0‹2 0U 000W    ‹0v@1粐0 0 l5H@X0 i0@0! P0D p\@Z0P Gm0$0@$  / (0d00@01m0$0@D$D څ0 AQR  `1S9 0   0@ H0 @@`Tiʋ |@ A`!!! Q=   30 @| X0Q 0H RC A aV *Pv|@0p t@p6/P񏐠0+S .0CS@0PPPU a0 2|@X0 0`!02 @@XXi S0\01S< 3`0`00S S8P16 |`0 P00 `~P101@PDy^hP p ` U~0PW`0P 0D TP Br R D0DI b~PO0d0LPJ0@E@ ,d06SH[F %L ( txL CHhPTth8L ԅЃԂP 0h^6pSX06H`s DP TP Br R D0D ~P0d0@0P k0 0@! ~VW0 0R 0`1 g 0 @1l0XP0 &0R  Uk0!0@! R 0 P 0 1 X@0&0 R  h {H0S[=00b{k0H"0l"l $6   & Gr R P T Br R D  R,#w}Pʎc 0 c0@ 0 P`P 81011S1C00 '0 x30 X010<0d0/d000 3@X@0" !&0 R  *0 3 X000m 0d0@0P j0l$0@t$t 0d0  `0 e0+S .0CSB@0P j0$0@ %  rW 0|p0 (0d0wP0 @ @r0|5 @XPj0%0% CP0 @ j0&0& - /0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@n}P$Ѝ0 v}P͡0ıġ0"c110$Ѝ00@-$MP@N}P$Ѝ0 V}P͡0ıġ0"c110$Ѝ0MM {{2aЍ/MM {0/1A#b{ Ѝ/MbO-@ßBM M 1Pd$č$p000 S00- 0p } P@QP0l T0h PN0@0A !< S 0 wT40 ; P0 0000 ; PPY P00 [ hP10$430KBލ ЍS" [ 0?s0S0Q. Q( Q" [  {  u KϿ| 0/?r s0 n[j[g[꩜w $@ @Ev h~p~X~C-LLP AMM č@`p04" R3 ܀ 0@` r P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R` @@H JD D ঀ[It } ,s B}|O-嬡 AMM  čR{pPLpPG `DPPB t @+0CP7 0S4 `  0S+ 00@ p6P00@S 0S0S 00@ @K @ ` @h dD ,0 0 4 30AލЍЛs r h|(.|q O-ß CMM`,č@pPX\@oZ0S  .S@0SV:T d10S#0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $'Z000$0D DR @@ 0S+ .S& 0Pʵ0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@1( P/d!  0Sx0h 0@$0000\0@P@Tk0!0$  00$0s}0S 0S YV0 kO0  YК8q @p O-p0Ÿ\M P@`$T V  Ÿ!3 0p!100UϿ@ 0V 0 P\ЍD20$  0 ~VX0 0 0 FXP0swpCY@Y0SUPP[   B RX00 0 BxXP &Y#Y$YY PAUTѺ$0 `F 0S0 s YwY  Y0sY0S 0  <PAUT0QU d0d d0 S\ЍP<0\ЍPHUT8m Hv`tDttG-@0`P p-@D T@<)X0WpX뵐0` % X  @`DX 0/?0s0?0U00S Pt D D0D @0 (e `\srs0sG-@P` p崒Ḃ6 F0S@`?0WV!; dX@`X` ,@F0W0T0S?T0 *GtMX0U0`FV0S d d0d ` 0L @ @0@ <0 `@rq=rtqqAO-0P䡐 M0S5 @@d@t@`p S S0  DP&  >P0 8PI  1P00^  0  SR 0  SRS ЍPd1 00d1 HV}P0 I}  P  P060 P0 *} ژP  ӘP090\ }000< }i0:0  ෘP  ఘP090090| ࡘP010r  P020h  0P0Z^ d@ ?R? # j] 0 2M$ r0P0ZC @ ?R? # O] 0 (32 WP+ @ OP010  EP010qqq`<qpppH;Tp:ppptopo99|olonnn@-@HM1xx x% |Ô0{ D   0  x{ 0xxHЍ 4@-AMT  w0000 00wЍ@@0@- 0 A0tMT0l00  w 0P0#0 9@ 80 0 l0 30tЍ0@@괗a (a A-@P:v 1!01n0SPpuOPp )vp0Sp@-Q@U x3s|p _b01P Yb01000p vcnwVxvP //XEP //(kG-P`@>V%0VQ\@ 0\!R p Âp p "p O-PL+L; 0MM0500;@00U0XT 0 0_01'0`,4 05@ d!A  d!. 0`11110`P  PJ0@ʏ@z$ p d10 d1r P$ `@ [`0D@SH _\ S\  S S00 Q@0S SP C0SQ0 0CQS00000,9,{`P < 0 @00 P+0=P 1#S;S 0 S# 0(Sz 0(S> 0(S 0(S 8 R 00sS2 S S 0\( H8 R2 S S0S 00 S S SS@@ P `09[_AP@ 0Q"0A'A+S? 7R2 S S00$R00S 0@0 S S00 HPxP0S S 50P PPPPP00H00@06w_ 00 0IrPeT% 0p  40 PEaT ` pZp" 0  7  0 0 ]z 0 z]s$ 0 m, T xZ@-<0< 0@P @N: 0 0whL @-$0$ 0@P00L 00/$ @-@P @(:00w @-@Pۣ00p@-@PP  P  0 p 0  |0 u t0 ,EA-@@`V 0 CQPqXP pG PXP 0`0pJ@-@00 R \\  $0!0D0 0@ ($ Tĝp@-@PL  0S  T0S@pYnY@kYP/0-` 00 0Q,000 P0($0 䠜p@-@P0`H P 0(S  1T  0 $000`pp@-`0PV@P PVP 00p.H A- 0@S  P t00  ( $   PH1H0?:Q@ Q$10 p?  960@`@0O-묚8: @,@pDt`4ؗ |8Ж`(|P|BȔA \0(Џ=d=<=@-@P00Q  P    $00<0 0@ ($ ꀎ p@-l@@`VpPPp"0U1pPE1PSp ( 0$ 0p܍QA-pA@PT`QV0-S@P  0P"P` pp``@ ;A-p`@SPP T  000P   li:;@-@@0/ 00(/$000/004/00/00/ 00(/000/ᬋ008/ᘋ008/ᄋA-``PU 0AP ppT0APT404 0 ,(0l  R TT/-< <0  M00( $ V Ѝ䬊 P@9@-@P :0`00@=0 50 L8@-@Q 00 2 2 0 G-xsPp@M 0ڨpE T 0S0{00 0  0 0$ -0{PP 0` 2* "Z &= " 2? 0  0 qp X X 000@冦 h@PЍ <R 2"00@qX 2: 2 (LiP0 0Z 2< 210 010010 010 0100|100t100P 0 R00   0T 0 2 13/pTc0-00vPP 0`2 2ts00p@Zl@i0S{X} 2: 2l sPv 2 @0 2@0014004) 8<,C-@`pQP M 000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH xP (0$( p 2P ;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p @ ЍR @-@`pQP M -00U,0`V( 2S * 2 P13/PPF `P 0 p 2P 00 Ѝ  Ѝr00PO-1PSM0:00 X1*q`I`[ Иp@ p W 0 J P tZ 2< 2ЍЍQP O-MXr=*`00A̱P嗘pP W [K DQ@P' Ȃ @1@DT0 @ 0S 2< 2Ѝ1@D0 @0 Pu 0SЍЍC-"1`S M2:rWB R"*T$* RU  R00U00SR t0  PpX U"B Ѝ 2< 2 Ѝ8QP"! ЍG-pZ RbM'*Q* U@0U @ RD0 } P X U 2< 2Ѝ@EЍЍG-P഑p 0@F `` I`f!v` 0 !`!0 0CS @QàHz0S0Cs 0 R 0 1P@10CS㣐**y0 0 00CSÐy0S Cr   0U0s00R!2 B0C!2pl0l l0 T T0T b 0808 80 , (,0 (,++p@- @RP ` xPP  ]pPp@-P`@Q O00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M 00 Vu 2+ RI 13/p)  0F! 2$  00 3 p`0 9/P 0 9/P  Fd0P 4Ѝp$  0qp 0 帖P 2: 24Ѝ?p`(0 0,9/P 0  0[a`FV`&*0v`  RP !q0S!Y ! Y Y0!00C0 b0  0!006Y`2`Ѝ0E 1(P 0UY0 0 0C0 0Q[@@pGpЍ\8&G-p`0@ PR@Dt@p wppT@$:@Dt@v0p@00T`:P0D0@l0l l l0 P0P Pz0 808 8 r0 ##$l##P#G-P@@ `RNZp; 0ഐS0FI S0y 0 B 0V F B 0 0 \ q|CC0R000 00@ @@T*80`F0C@J`80000 Y4y, ,0,  0=G̯l" "G-M( y\Xp`PK \<S<04%R @@|ZZ0 L l3< 0Fp P3,0SI 2 R , F  $,4 ,80< Q0 U@P00X06x0Hs00ᴀЍ\006`S <0 PK,0S0S $!Q #$ 000#$ P0A 0S- Ss0 Cr 0 0 0 X0倀@0@}ڠ@0@d d0d 0\ 0S0 0O00h #T51Sp@-@M PKaP8 \,0'P8ЍpM/G-4Ÿ`0 MqMŸY w @P^ 1 R2X< *5S0@ZZZ0 Ϡ B Ό b3Ό2 0EpE YO\!L1 0  0 30H؍ЍU80`J8 8000S   "4<Ġ"< ̌Q0 Z "Q Ctӡpp@0@0O00ꉂt  O- P `J@P H1嫲p0q1  J08 10000N`ⴜAO-40@S`p M0S0040000 PD 0$B1;0C10 X0 M ^ X @[ 0 PW!B! 0SQ|   R 0S  "  0!2#$ S C$ U @ U` SRZS5sPoUj 0 ᳟Pb 000@@℠0ᄐ000ಀX20HPIᲀ0@ ЍX D $ U D R RP1 PD D00CD0 0 10CRL Š B QP"y0 0sP!1 | 0P!@ 0C 0$ 10C0S  0"^MPO Ѝ1 _00 _@0B YPUڰ1 0S 0PŠ!D PDp0PU PHDŠAD41 (1 8D<O-@PU`p 0M1^000Xg*0Q P @PU \000U00SP ^̞ PЍ`0SP0@ 00S"@P 0S00 000S` 0 P00080080ЍOƙ !0008(8540PЍ0@0 00^00` 0300Cs000 0S;:00Cs0000 0PP 0 X0:0 H0ಀ0 0 ` `x x0x 0 70 X X0X 0 0< <0< 0 0 ꀡT, 0A-s %!@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!A2pP 0  < 0W4V0O- `ştMV@ `Pԝ0P(0i 0 ̝ P0 a (v`0 000 00p0SRH@0 P@ P 0 $괐X ` x F W 00H00ᲀ`P  R@ڴ R  F@D 0IPx  A LH $ {`(0 0@PA~ Q` 0,0040X0$0<800CS0s00 R*< A Ar 08岐S0Q რ:8 @ಠ0 0, 0A0P,0 \f 40|Sf 48,0400<0 \|QdP00Q0 00 R@P ` 000z QD0s00 ᳐Y;00S pB C TpP\Xh0S$0Q0 00 R 0P 0Z 0 $0f 00040嬑S,08400<0 PS Q^40S 470,0`00 0 0 0P(d0S 0$ `@0T$0 h0`S,0 40l 0Bs0 Y0@:0 I 0( pഐ0000 000tЍ( 0d d0d L \0 &H H0H 0X 0x  SL   O-X\p0`S0P @L$P XI HP' Y  0z S40  0(10S0 1$10$10 0S0"P 0 P0S 0P  00S 1$10$100O-MYP@000X00 ``FV*Yv`s @$  8$ 0$  = 0ಠ0`2p PP Y!```0S S 1 !r `p0 pGwp0H0m0pF0F000 B 00p0@000 ``FV"*Yv`+ V 1 !0p pGwpIH0`v`0s0抠G0Zp01`:0y 02"0 Y0v`0``FV*Xv`T hhh2 0 00ಐ0X0p0`0A00000``FVA*Xv`2 V 1 !r0SAq 0H0ppGwp `0`v`s0扐G0Yp01`: 0 000SY0`0FlЍЍ00PP @0 0 v0 0k m0 `0 b0 b0 0e X0|0| |0 MXv`j  `   Dh hG-p`P@0R"  0S00 0ᬚU@ T9 P0X BPR RQ00S0Ӳ00ô00A0 0qS CY01*s0  0000YUU800C80h0剐CY01*P0D< <0<  00 0 S ಐTO- @T @P@D(0t@S(,W ࡙0PPI# (P @T @(0@Dt@T `pV T`  0 }P``p@-P@ 0^\ ^ P0Q Pp\ p pG-@` 0PS 0S  0Qə@PS"  00S p\: 0 BS P= 0 \᭙P   00(!S$! 10$1P0 ᙙP @0弐p 00p 0 S 610 B\r ἐxP  $1 0$1(!00 O-\0`0CS0P@Lp M P aF (EP& 0 0  eP 0z S0  Ѝ0 0S0.P 0 0P000@- M@ P p10 Ѝ0O-@PM 0 0P`Hpj o PV P0S !1  0WD0Z0 0 @ @ 0 pWN0@r s pGW03*0@p 0@000S p0Cps0W㲀Ḱ04*0p00ᴀPP D0ZPPЍ0 P ᖘP 0  0| |0|  00 pP P0P 0H 0꜌f(T},Ȋ<G-Ÿw?`0 (MR$@p2S:0JS OP P崐2S qp V6 8P ZP崐7 Z1! BRE:0CS㣠5*z0Y(:101@0p扐0p⶷ 20  2 !1 0 $0 308(Ѝy C00C 0 0b Jz0Y*0 pDP202 p 000 p  ` 0iyd $A-@pPQ`M 00 2   Q `:1QF0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1  R* 2<00?0 P  R: 2 E0 EP VP V$P "0* " Ѝ00Ѝ0PU Q:(0 $P0PU`PAP  g BCP 21 sD@--M0  @ Wh hP 0PSP000S 3/[ vWRYD 8 80 $0Q/ $0S/ᨘ L @<<0 0R/$ 0S/X HhA-@T 0S%bp`/XP0P@Q0@ @@]BP 0A/PdK .rorx &O-@$M`>iDT Fpܴ4$$0Rab    "WpVoBP b0@SFSC|<}<}||<}<}<}<}<}|<}|<}<}<}<}|}},} 4=3 3$$ 3$ $ 3  3$$ 3$ 3($ 3$,$_H `3$d `P]$Ѝ $  ( ,  C # PU! Pp "PB]@P< ` R嚉PxB `  p  BR ԉpPG Q]($R0 U tWS UX,$R$ ^ap4 Iap0 W$RD $pR $R !\&@ $R $ap P$R& U Q R  T$\&@ @ $E<  ` &@ T `   &p Up$R UMap -ap P  ^ap U?@ Pz`^0s &&z\!- &sx & &?:$&ssO-@`MpPgC뤳3#@ @Bp#x3B RP!GP P( caf@(hPF  H@ Pꐂ``````́``xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X @ǃ` `Z`r`T hPP   @`Pd 0)ȱ0V!Xq``pVpP @ 㙃% B Rꬃȃȃ4ȃxXȃȃXȃ 0S ᓺU X g0S X  R 7/ P  R #;$ B  $ B  P0S PIX qX0b%Rt\!-&cttttttO-PyM`f ~B0pI00 00 7Dp8 PEU( 0R` S 0 0 vPePRP&GP cf0@S긆Ȇ؆H0@ SpaP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0Sp 0pSppT0T PE4T&   P Q 6P/[  00010SwU0Sppp C C0S S/R 4nUp0SBUa(0S0S 0 0 MUp !Q 0: S UH/[0%= CU0: S0( 0 000JPU   Ṷ0P0 0P 0)ᖽ0P @/P050CS"ȉ$ `A / + `00媷PP0S P0Sp 00   B R(\ L` V `,Q$ /0 !P@`0 j!P` J/R  S/R/   C  R: x ` 9 3 0S S/R$ 0 SR& T0sX/ HL!R\0X\!R\ X00: S 哸h C C `mT0: S P1: S ,T : S!  Sn  Sf __ S_ S L0S !`PN,0SM XH0(尥 0Z gZ80 S80p1p!pp]Q !TP!P1: S 00Z0S 80 0CS!800 ^PR X0| S (0S !`0S !`HV0<&t&tub%[ub% muutuuu v=vx&]vM 6pvvM ?vO-@PsdT@@&Ap8464f@(FaP60` V @b0S0 㙀 `>RP 9qb4P0805H`40"bP0%.(0@JbP7zP0X T5T%H`RP8P H04 0, %43/00P08004 [4b4a 0V0!bP (bP 0 00000 d@0D 0 RdP0; S @ ,0D(0#!H0`86/,dP0`$S:72`` `0Vs0 CS 01#SaP0 0( ,S* B<"!0 0 a8PH0U 03/ps0SDfH0803/p(^P`؂G0 `0d P 0 S * X  0 $03/0  0-Q3  R Hk7b0  0 -1/ [7P0 0 0 0 `0d 0 `0d P0$ ,!a 0,ؠܐPYZ0     00h0 l 0 h0l   000 R1b0 0013/t S` S>`XP\`0O ( (0, PU`00 XP\`> ;ZT0uz&N ''?:f%@('zz''('z ('  D(' zhO-M Mpb8V>44H4 @p 0 Q 0  s0(0G@-P񟗙$dЖܖ,<HXp0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S 4v~PU RnR oR0P<0,㵹`P  .;P8]~`P,㡹PPPP VxSR8S;d5PhvPLa4 1S}H @0R. PV`@0S0H0S 0  dP P 4R㓥' FM P3mY`, 0 ,0S| 8 RS P0SP vP4PD0S  $4dPPP401!ౝP4L  R p #P T0S`H R 0 T0S4"0p.dP4T0S 1YX 8SU # ʸWpVJ  h00!"00 00!"00 0$0!"00 (0,0!"00 0 040 0 08 <0 0 @ 0D0 0 H 0L0 0 3]P tP  aP0~('\!-~,~Q~a~{~x &&[ 4 ۋs@-0DNP000T00Sdr0C?o21 =p0 1000C00S8 000-S30 2R(0pP EP SP , (TQsP xP4 3" 3" 3" 3!00000C0?k$P=|t]@P4 Pdj`9wT$32S D#DTSQ\UiPBa1S bVRKwPL2S$ 2"sT[d d2 0S 000S 0pP 0&hPǻPN000!S 0  兲0S  000S 㫻Pv|S:Ua`0:E100S S v!0`00019l PAq P k P{r r r&@2Sd`P@avhPW2SwaP0"lS XSL@pNP= 2S 80"@\`*'[&O x &F\!-Ud*'Wbd-'UXlL(,'K & &A-@MP`/P@@P2 pttB <p=X2Q=0 q E - Pf Ri Rk R3 0!BSQg TNPb0: S^00 E{!X<p10 ER!MpS1{wPePLP PPp FP c{f@Pꠥ000000000̥00ԥܥp000p0 0p0p0pp pQ |:{P  M@P0: SpGP ${@R.'&0, rO-M`z^|:LlrPp@` ;pH20!1S U``$ MPja2 `[A PmP pPP ;A\_P z^@ 8` apx dX000 00S mMP"0 0_MP 00 2[` UMP/  Q  T: RLp [mO0S T* `[`00$C`İPE@D.0p/SP/P0 S: p  >ⱄPPU0t/'&A-`P@M4] D 4 0e LP  K }LP  K sLP  K iLP  KPl>h3P0`3P P$PD3( 0P+( P3( P7( P;( P?P ( PP( P P8$@Ѝ(P (PT"㚷(0S (sP(0S (iP(0S (_P(0S (UPq0S zJP`!0S0S qp X屺`PPa D1R`3PU 0E /R ^4P(PU  400,0/00g000CS|į̯ P0$0u00S px뀐0s00 $z'x &qP'LWy\k%, MX0'/'A-@P\7`p s9p 00S V׎PLxLP PP ``P $S 0@dM0 & & &zO-`pGMP[v7` `  59p 6Y.0S ЍfP WP! PP p `RP dP vP iP0p0 `rPxPpp0p0 p$p q 0S!R  ~VGeЅPU JP$0  S0S/ 040@0S* /R! /00P0 .R R .R0S[   00 0Q@  0P0SP$0`S0S@ pP T\'PP0S <8iw50C SV`T0$S P P6 |00$ @6 0P 4 0!0 0C0 iIP 0S' .0S 5S 0S 0SIP 0 0~ zX PtHt0SmgP h0S g0Sa c0?S] _0S+KW0S S0?S O0SS :6 d000: S0S<0S 0: SiHP1 0S!  S/o" R  ⤵P SH 0SsIP 0S 0?S 0S 0S :x'0&tA-P@Z5p` c7p 0 R1 P0C@PiKpPp ٶHP-PW` /nP 0S 0S0PoHP-00C&p@-PM) 7 $ 0G HP H@IUHTD GP00C85ηP3 WP 30S S! S  3H \3! d3 00L30S  R ,#6 R #!SR3 3 2 20S ( 2 20S +0S'002@T$P0"q@qxB00CS00  0 < 0S60016 R0S 10S<\0PR<0 01 10SO 10SK(Wp1\1PML10S H10S d1 X1 0S 160S 0  @1 EH01/'((0S0F0S 003s0Ss0S 00w&@`|P@ To@'0Pl%x''p'''|'`F$Q -\m%dm%7l'k%xt' tP G-@MP X&42br@@0 S 9X "5pC 0 L1 0uP|7x GPdg,`x GPL_,H8 GP4W,T; 0DS 00S8 @0xL 0QD0@0 0Q)@0SZ L PUxta0@S񟗷ؾؾؾPH@| FP \`t@@L P kP P 0@0 00 8@L+L,0@0 00 0 bgPL|T"D0S hx 7GPT+EI0&&MSYBt @cht@nt@y$&\!-ogt@-WwE+IO-M pWtG3_@0o0C?o`DT20<$<4@@@ >2p$4 4 00S ST [@ Y`> Z``: sRPGPP! p"H@ Pdp\`hP dP fPvP$@``j1 00T 00; R4 : ˮP @d"A0S #S!7"d2 00 0 `PXL 0pL#>. ᣿ P (Gp ?p 4" >Fp Bs0S<0 0@0050C SR$<<h<<<<<,<[ 6Ԩ@P0S? 0s$ p2 ? p0 R qX  Pp P    3/P00 S *$ pl2 t pZh000S H0\':m%&C\!-'th'tthO-M MPjcJp^nNc5 00 5uc5005*c<:p0 00呴P '" 匴pP pV9P!Q rA@6P񟗹<$0$px0WS }055050p X3pQ Q 0X(tȟS SSy `%r050505484 ὶP 巶Pv! 7!ط $ p0"S qꐷ  p {0"S hL  pl0"S P 06rp["0z0500~00v01w 00 0s0g0e0c ^ ^  ^ QS00 00055e46V0 (oFWPE2%R U%RpUQp0%0;)gP%5S 0DP80: S0550GSTU%R 2' WUz05$Ur'(4P$040PHӉp`(`tPP  C\$iB-%`.uTD00000 0BPP#2 B'CB#C8CPc`0 0S #Pjpp@#0Ss0#S  gB(C㠡 ZR0E?o2?  TB `V4IPP(f/6$`euV '`PCh*H00CS0 uP Pp PNU0 P00CS0u0 U9'0S:00S:0;+2U51''1S)1S V! "Pd`d!iBZ,%l-UxHP 0T#P! J'`0U0w0 &P>p0PEUiP@wpP  f/弸0 lT  E(x!Pp'e t\!-$'@Ym%&<' M' &58 V &md'PC-@. 0P !@㐐`p@XP^G P1`00CS`0 H@T ЍX0 X @1p( &`PS$?p Xq:w\10  W* >W t7$/>A!14`(SXpp>r037  7037lp V7037Gh7 P 0 S 0"R S2S S 2S 2Sd 0sTV =p8 P/ ^lP4 f/壴H7w0L7TP'\?S@<"820,"(2 w/PPN0 0P UY'P`T |kd2S+ >pT#=00dX!\1 \1X! 0 \=/02T7,2P7pr#%>pU%I=pP  ]#U=P#L% 0P 18U I:GPh D:rWx 3023,2 3(2,T\2S(",2QX"\2 !14!8!(o%$P1 SR Q  RQ!R!RS !14!8!04P)`CQښ. .a0C 2 0tg?(\!-&edA m x &@(@(,~Q~4o%0?( L5 @(zd@@(8^O-`@ṕ̑Q e(p%W㬑 0S 0S op10`VA VP `Q0S HK@`V-Z ЍyPmPPP fP 4;n0@ SPPPPPPP 0 0000000000pHW 0IP x;Pt;P 8X\!-E(&\O-4$M` 9P! 9P=80pD刔刴00PPPl$'p3W00S 0S 0S 4Pp(4 a X' 0S00P 崯0S 宯嫯PY30S ЍzPOPBP4 FPo ]_P@*P <|,LTl00 P2 ܪP20{00b 0 _p=o0` 0ŪP00e @循P00^ 0 c _PV =Q000M00J00G0 m^1 P :e000001000-00*000&000"p 00000000P0St6YPtW00S 0≉Ps#`I%t^Z `7^ZW(O(\!-8S(00&PxW($vq/////eao%//:0O-@MP8@-I`(PUPE10ŴvPlP,HP8 TP3@ ` Z8p@-  _Oqp@!߮0 S ۮ < `<0@Zy :em@ Pl|t` 8"E&p,2 R Q!  R 1,0Q ᳩP,00S  0( @P@H00-SF 80@0$0 p0N@P?Ѝ$0pw1 4?$040P ?000R0Sp c```8ѝpW0SS0S } 00 0@@`p @$@ @P Xm 03/p TX \!-] ^&lx ^58 -^%xq%@-,@,@@Z(q%O-@P8pM -,@彬G8 0⸬f`^ mp hp ed6 Rl,0 P8 /P0T 4P0\80\CpHPPPF U18vX(G` `F0G0`0IPHPU0  B%pp 5pO005S 0(0,00(00 0HP PP% dXPzW`WNWU 3AWF CWPHe Ǹp  aW,e CWe LWf aG Qk@(HPXWW$ lt  $ DR -@K L J ~ dO {05xN 4Vt V ```CpM nH l$0%0!0 0 c $0@S* cI V0 0`PMp 00JFp kW {m0G S=     ,   Lb/b-[mPH0SI0SO005S* LPO0S U5S5 ( pH (0S  0C#P ͳ@P!@ᬼhp``p! ߳P! ͸P|! 0S1`!33/ 0<t@ P`) PP޴8@ P414!4 HR #h0 p P 0 00 0S0 pMq%Z(r%vhr%vZ(Pr%vr%&1 qr%(r%\!-vr%vr%wwmRn`> 0 p@7t>?q0SD>D$RP$r R  $t n▥l00<4A @0<4x00<$ 0/p M <4 D!@ 4d2pPEB@D4TG(((#,(#((((Hh((((((((((((((`( @ x !@!(((x!!!"|"(#(8##00<@ᒡP l< $y剡Pt ||  8< l (<$$r $d4LDrP ;$0 00  0 <M0(00 K0, ;0@= \; X;$40 00 `0 t ;&0!00 (0 @ : 0(00 0* :$ 0!00 0  x:(0!00 0  @:,0(00 H0 p w:0$:@90S nP4: 000  6!00 0 S:0!00 0  Et:0!00 H0  7940c 00 0 P ): 0!00 0  888刈@0S C.0 JP[Jq偠P0@4j zP@d 8([ 8@쇟lPD40 lePD40D4L L G X0P 0A $000 1 1 7C0d7@PP00(7 000  7F:PӖP/ΖP hw[0SX 0T40000PEU UZ R⩣ ⥣0PQ 4S<4Z H4L$0 RG.pk?HL4P4SH$L4R0h d&,pP PB RI.p << 4S@00XS $EnF?rFHdLV00 $?e`4VLHd +XJ`P +>[ kwQPP;d%PPPT%TZR.p P1: S(%,6 $R ,@P%,RP$  NP0IXZc4S04>0$80tp!x$ ,` = l$0MP$0 r0 4IP DP$,03m`,`40S0X44S@0S4p2S 2"0# )!Pb 0T40S P 3T#0S ,BHg(P`!טc(7Inc(x <  ^?Znљ p{%dߙB' KɚHL4 Q} QQ040SVR0V 4S$iP 44崐S04144 0S @4S 0 y0@4,4S $4R#1ѣ1,40 0 0BUu *t *0S p@% P' 0d!l90>]L8yP;X.R04ʃ1$4Q :$4(+1T4S%6 ,d0("l0,+***Lr+\4$@1H4`D1x0<$0@ 07+pgluP>0Z LP>0fP  4Pp  T4 { 3(0. 8-O-0pIMM∹i4, pP_`9`4pGs04WZ `͠  ɠYa' 4S<44S $$4R0(*p  `+p  4 SP,0S x0$媛 $tZ0 0o 0$垛 P$@ 1Sf  $$4P_*`1XZUCUDPEU10H400P4000002L20002002000h1vbPEUU30000300`3000330000300(46 (&p00( R0C0s0SJ p W044s04?0 00 d0 p610(00 ,V0,L 0@" 40 00  0 0*00 +0 0*00 +00!00  00c 00 h0 050!00 8 0,00 1 1 40(40SYW00; T$M0P0<$NW`b*p 4S (PP#\$bO`P#D  8(@fJP,4(0(00`V Z 00 p"#8$p = 0LJP0 r0 4P ⫛P#0V3}p$p4S80S4\ 1S 1!0"< 0S,j≛P 3"b~11   $$!0#ZpT2   V$ rvpԑ{ P le $ t$4嗂s'4S 0<%.?X   $tR $4&S 4%㰚X0; 4 44 X  0(p0VX㔚X0:S Q 4 $S  0 ᵙ b(0S Z (+!࡙iX0⫱bX+g(\!-&!k(ט%`jA& ܝ7ng(  ?ZnљG-GMM@ph R !p40@D@DTQ@@5P:9::99:99;99<;9:L;999\;=999999999999|;;;9;;9 <,<9L<9l<<<99<<9=3x0403003k3(x3 p0,0p0L3000<3080,434#  3@| 2Dt 2Hl2"d20L0`|2"X\2d"P<d2D"|HL2 tp0V0  2jW6 2 bp0X01!X$ 1P`p0x0p0\1 (p`P%  ?qp`P0 S   0`YP T0S0Sh`lP0 A/5P 0$ 0 0 @x+xGH@PT GލЍ4 &\!-PêժvJ]!O-` -PMp L`KP'tDPhT 'Pj&p4T &&p$ `>8P $pP$ 0{@{05S = #3 &P, C@4P`DDAEEEE DEEBEEE`BBBE@CEEEEEEEEEEEE@E@PAE`A8DlA|AEEAEB$B0BtBBBCEB`D 09 0 P P P  Q R T 0;8;08; 00H2HpPt" P R  s{ r+SS P P R / < _ 0< 0: 0 S@0 010@;M 0@0 00 008;0T Pg P P R / 0P. 00~ 00{ 09x䰟 PP ` PR |ꬰ P= P R @R dmK ?`RMb@Ar)Ʒ{Gz?&ض,JfT}) u)\!-p})6@}) 0$; 000H Lv 0P 0 000l ptPE  P R  $S0{{Z_%PZ<;SX%PS0g QW $<|W AG8 ({*<0(+R[X= P10HH2pGS1<+0X2 10S Xp<0H1 ,d P 0: 0 >0!.0u 028PZP ̌p ZPUpȌ 刀ppPt + 8RUpeARx&0 u)t)$&8~)$j0O})})\}X})ps) %4%`s)t) 0@ @ |0 0PUfPh 0C Se0400000,00(00$00 0000000000 0000000 0_0p 4RC PPH)@PWC )n8;p 00 HL0&%p 8; 00 L0%p 8; 00 L0 %p  8; 00 L0$p@ 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;P+2(b╚P L0$PW;"0#10@00 0`K`QH `    ` 0$Pt3K0S PP K0$P& 0  00 3$Pd $0 6)Ss``0 |$P`4$t$š!2P(104d 0`[[[[,Q0Q4QPPPP㩚d<;SʔTU$>@ Uz{ A k::˟cB$@ 3UVz{ A k9I:`"2RgdD' ({ @`30S 0 ' @MHIN2 X0弅"pU00 F@+@0W0 00D(PT2 ppW O P $2#PG`AQKY#P~pjc1{{7 (H{CAZAGκ@8HINT{({*Xz"@T7 a0S3 <<'0xPT0T00P0p+tY"P L0S 'v͍#t;<000[ Y0 0 |f#  (d2"SS% 0 " $@-C6?8~A@@r)`s)})& &8~)X})ù@})AFx &Ot) %< pI1 @S3 2R`P@pmUTT0dR?L0 0 0 d20 !  6  `0P0hl0K?ph{{7{{{3{{ {  M@ 5 X 3PŠU h2Y0Ph2d@ f P 0h 0S hN 0Y 3! |"<0 0H 002 0BS+ (S3; - 0H;e'U@P-P2!0@0Css0S  0I s0r M' 0 w1帑;    0; 8' 0@0 0U |r"<0 0H 0@0P0W 0 0D0 1 J 0 _P<0[XU D0 00R ZU |="z<0 0H 0@0ml  0 I0D T&PPL0ZP t) %r)tʺ8~) &})$'9Zvѻ&D0 &0CS UDVhVXXV$WLWpWWWX(XLXpXX0 P Q;UUUUUUUUUV VVV$V,V4V&   ~&0募P@0h|xtplhd`0 P; @0 P2 QVVVVD&7&0 fP  '&0 VP &0 LP` 0 CP Q Q ($w u0 1P w0 'P 0 P 0 P 0  P 0 P` 0 P <0 P % 08 40Si CS S U | (<0 0H 0@0P%H  ";Ukּ ,:_Ƚ-Imw¾վ})r)SIZ0KUI7P[%DDSD0J0ZD0  I)0K9+ 0K:  QJY0KUD03 +Y ^P UD0 '%D0J C 4 ḛ +U\%PDD D0I0YD0 0J#1 K#+ % U$O-M`Pݖ@0L-S@ P. @,4 t tp+40SP a`F0pP[PPijQNpGKc PN   3M֑P@ \3pC d0@Sx]]]]]]]]]]]]]]]]]]]]]]]L@20SDK@HGG 0o 0p Y \LZ'`E`PP`0b 2 R l   0 S `  [ U+ 0 q ! 0!00 X(̕ɕƕÕ 㽕Dp4 ,:p0SP}XK}` (p 0SQ1P0pp@@  0]L Vp$}`@}*h& _3Àq~0׿H O-PAM Mʋ@`#xP lPd70`W00-S% @P ᘇPL@ p0K0\Z `F0S0`@DDA@Dv  p .6p0StbLpPt63 Q X XP -00 r`@Z-00  D0B5S񟗊c````````|dpd```@d```````````````|ccd` d`0d@d````d````@dd@ddd`@de ,00S |KP}wK0 0w꤄4P pK00i00f`400b `4 ^0S HUK V 04 R00O#P H ܃ 300S P60$010(0.0,0+t0C?o 2R0S0$0AP<\9P4@5w00!@DT3a00@`FrS; RS iS/ ) tS xS  똒弢+Z 0p 0@00@00S  0@T0S c #R0B(0/S O(0S  0@GVg0S (0S p|1 0h0PS 4L(0S (} 0@g$5vG P+ 0 PH@T[M~*&\!-&@*H@%e\/x &VL%0|4 &6H, Bax@0O-PLM)@pPph/@ p\?C,#@DRQ0I 4@@0SRJvP cP SP- TP0(3 LP d0@Sjijiiiiiii4jii@jiXjdjipj0D003030800H00 30$30,3 0RVS[0DSYPQX!100gS @&kp, DX0P  aR @L0Y? SpA 4I0-S @03RknnnnnLoon,o on`no0n0nnnnnnnHnTnnnoo|o@nonnopnoomononnnnnnnnxnnnn"0 0: P@0 0:0 0:43043k0830<3@30@3``jjiihllkT ,0T ,0T ,0T ,0T ,0 n0p 0T ,0aL00L0T ,RpT SH S0 D@00D#8 D#<#  P Q0P0083 00k0CSppppppppppppppp0 @0H0H 0H@0G0G0G0,0  ,0 0P 弌PH0Sl'llB0-@PH0SH'H<60! ,0GSW p43gS0@{/-aTG cT5 gT0C@m03SX0SZ 00gS$ H0S!_pYP 0d&d G0SZ HAWppTpWP 0S00{ 1 ,048<@DTLЍ0000H3@0P xH30娀@D30) 4 00R*SCP 0C00 ,0  @@0TB A 㮏40  0,  T0D ,0 0R@ B @ w<0S $3S p4@0 00 R  B   0w< Q $0Q @0 40 R  B   0w< Q $0Q~ @0 80 R  B   0w< Q $0Ql @0 @0 R  B   0w< Q $0QZ @0  <0 R  B   0w< Q $0QH @<0@DSJ $3S0S D0SS @<pdF07S B  00# st  ? U  h  z      0S 0S 0S  Q 0   wpx@T  8 30(#0<   Tڰ@mꐹ* &a`: 30% *******i J_@ w0*k< Z**!/@M/G-`XMP)?P yI ,p 90VJd FDP% b0@SS,zyC 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0Tqp 4y 0P 0PQT)D0JZp3V Tu`(os`F P% 0SU030#:U 5%P\h P L 2 4P&T6K/r0m3PvTS0 0R/# G@=uRPEX9 P3u 0 0<6S"46S" 02Q" H201up$6S `*P W0`W  0㎇P t!EK/r0,6S m/PP St<6S:46S: d1Q0@6D&Sx1 0 00Rh!  H&\RX! $&RL! 8&R@! 0&@R0! ,!Q   @ q @k@|0P|Xؿ*&E\!-fk?C(***À$& &Ȱ 3_@9]g:::O-A-Pp`IHM p10PEU* HP h0@ S S0HHIIl1fd1T1 P1 `q 46P p 1!rqPP MC Lp$@@Ѐ@(@ @s NP OP0S DPxV FP XC0 0000 :&\!-0% 0*yt DCt MX0G-`HMp0&,S,C, p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 a0@S|$4\l|< 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PT!PsBV ДY 000 0HЍP PPp  TB0S  L0 `PFPV qh V `F\P*\!-&8% &WjT*C-Mp`ᎋῆPPF! VF .pSPU 6 `V V 60S aP& tP8p6 R m h&   p<6U@,V`F V"@T 円P 偆P!PV 0S A@D  P`V  tP9@PA@3P񟗹Ћ̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉̉$8̉LXd̉̉pxȌ̉܌zP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 03: $0S=<0S800S3<3PͅP0$0:(U 0S# 0S 0S`V Q DPF A0S 0S 0S`V UUl囅P \喅P X呅PPEU4؏ U3 UUU  U4 @U U0`0 0 ! UQa;PJ<0000 0 !P   $0S s! i p Wqpf*_@ T \ 0r"600"$0$P @P  P`sP$*&\!-WLzx &8QG-@PMaqM [p1 R1 p0CġP R ލЍRP fP74P#t/P` @XOJUP1 JP/0: S2  S)J 8#P0 JN@n` 04S00`M^}0S p J #PJ #@PJ0p@IL*&fpLC-PGMM L 0Mc#= <8=8X@8DX喁Pp=0D80l8"=`{C0D `XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxx8oPP   uP:? 0n?bL  ZP< <T@P |P @<P  0S;+,Kh8S <PU nhX 'P@ ׃OoB;pp~x+;(8pp~P `L[T`h6UPdh@`(;l[L  -ppT0Z L,+ 0 T0C 00܌10 ||  \<8T0>0P XP唘0Pl Shvg0 lIP4:T{ |BP :h(s\9P 9T(X(i8 e,bP 9h(g40GDS4x $P@$4|`Dp4@,L 8(VS h8X(T(N T8,J8 8P 00S= 8 L>8, ,, ,0 7,, 7H((Na$8pfa7, | 7L( |7P(w+t P :?@ 074wFap幂P78 7T( X(`7 6<(L7 6P 00S 70 7 6P 00S 6  T6t(6@ 86,p It68p`p0┖80 P 0S<6d pW 8-0pQ'0 0l5L(5`` L5`(d( 85uh]$5P հ@ y5?Q4QGލЍx5| p,h0D\< 110101$1m   (G#2Rip`d Pa Q1s0S kd`qЁБmmp00l V B/o" R npP  \m=`S 0 0000 l{n1s0S*v`#RS S=?o20 S S lan1s0S 0 S ` S S SmRox`+Bs7L7s7`7&$&7p+7[ r55 &7D%P%77l++H3 ?737&07B.@-@`P0P 1 q pt10SAPX1PH uD1C@P 0P 1 nPbP9P0P 00@0c0@ S 괨ĨԨVP z   h0  X0  H0 T TTg` ktu0SKs +Q>&FsEsx% Ux &>A-`P 0S6QP10/JP1 0Q ޡU 0S*TP\I͡㑡PEl10S `10P"HQ?x0S,1,"~P#P v/PGqp 000000Sx N{랍PP`0S ~PPt00S#8 +j>RsL+e>X u>|>>>+$+>+H%>+p+>++O-pPB`ᘂyp 9pp2 0 QQ PPPEx#yuP`P GP( IP) EP m0 /(a0@SꀮЮ<@H0000p40G 00 GR`18`1)h.0( G1!1pQlqݳ0( q@Pxd1k 0> G0R  >+00.( `18`1=0ZSVPMP 6PR ?PI 4P㸝N@P񟗬0<HfP j@PP񟗛t4 $=0X1h = &hf`}蜟zd1f3d1kt0000n0d1i\ l@cㄜ`|]0 P(+P d1~P S0$P]( L0 GR(W0 (Ӱ@P 0 P(! 28l&h(00`1(Cp (61S(*P 6 ?=(ⅳ9(v(:0P /d1@ @ Tp  p ( d `1 Q 0P819: `1d! @`1h* ` p@P Ÿ뽝P*$8 %`11`V amPPZ: )Z90)0 0+)(d1 (⨗yP^{P 唟L z(0 09#2p@p  X (0S` D UUPQ 6{0S (`!d10d1808"/0  ⫐`!2sH8"/0 睐2`!s"/ ⓐp= `1X (⟐P%<`!d1 0d1(00 8Rp 138(UⓝPlw`t(00 7pz0S x`1aHXz0SLz0S z0 S `1d!8 0d!'zpz0S &tϞpz0S &@ž(cP q( 帞pm|呞d`1 I S 0⁢pL9 _p5 P 4d1$A>d1 0T1(00 6Tpwd勞s$0 T1w(00 5Tnp zp  _p P d10d1Ktj"\,d1(@0d1`P  4`1 P40 (GpX `!d1$ $$ 43#(p (HSDp)(00 4p8!R`14`11(ŸP+h(v!P0!  R!00!R00SRd1z(⪒`1 0㄃儓 Q01X: ((`1 (⊒1PU3`1d!( ; V A? =?(o(ɭ1R@T 0S 0 @ʚ@ 0S   0S WP`P P ( RV  R   (001嚚0 S   0͝PUQL|8d1@0@e̛뼝hd1 " " ;" !& & & ,% " " !&0' d \!-J \ t & '  !) 2 @B' 7' D' 6B#, 2 !<&S' i' ' ' p' ' ) ' ' ( ( &( 4( D( Y( ( ( ( x(< ( ( ( ( " " " ( ) D.) q) ) F) .) ) $X)  Q/0p@-x@0Ppp@ P T0q4p@] 0 0$010Rxhd8R/p@-hPMP@T Ѝp@ `0 @ Nh 0 @GhXlFF0ƒ S"*0@- R P@ 0\ R^D00"@ 400 0^ 00"@0/kxkdk@-M @Ѝ<h  0S/ -PM00 0 p 0 S 0 0 Ѝx /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/) */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*/*/6*/*///*//7 */>*/ 4T*/@-@Sv@*/*/*/*/ps_strings missing %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)ctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20230516NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:inN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.99.12 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.99.12 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.99.12 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.99.12 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.99.12 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.99.12 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.99.12xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/10.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.0.8--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.0.8 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.0.8 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLchangingaddingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenIPv6-Only Preferred received (%u seconds)reject invalid addressnot ACK or OFFERdeclined duplicate addressofferedignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d Gst{r؀Z8 Hrdrr@r= r`rrSPrrHrr@ Trd dX r8 r< =Lrr rsf s@sdsd/ph9>3[@[)s`(s`h4y1sDw:s(N1BsI hEshKsh]PRsPn}Ws\st طcs( .rpushdnepopdneyXyx|(@@y,\(yp@@yy\uyC 8 yHy@@csr@@yunblock and -DNO_CONV?T0$x@<100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLinkY e {IJƵڵEZ(BX#b b_t^tFt<t>?PATH= Ң= t݈fids݈c%ml,3r ' Żp;кnCv Kb    EOF reading here (<<) document<)h8<@EJNRV[`dipw~\"',2|Pj/}-+?=@@xc$?ofilabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.''0 ,'1('1.'88'0F'0u'0|p'0X'0l:z> Y) 6g".>k?  W C  sJ  mEܙ$ !i$?Wx                  1``, d' oRhX> !ltd  qd&J)X{x/x39 _ `At I4L4üLP5L>9 =;0;S,=@@=DZ=##"3+#*32213837#X_ @@gHP _@fXm9s z C$CC$CP@@   %@-5 = P@@@@@@@@@@@  @@@@@"(/7=qCJPWaipw}@@$*;K|-@KOkt!'.59+5h??E2OV+5?HO^ektrw +h  ('.7@IR]fqv}t!'.59+5h??E2OV+5?HO^ektrw +ht!'.59+5h??E2OV+5?HO^ektrw +hFf  AT{   F b A, Q e z     !j#j$ &j1j2 3j4j5 6j8 9% 9, :E ;_ <} = @ A B C DG E] Fr Gr Hr J L M N O P Q R S T' U/ VG Wa \k a c d e f g h i p qjsjtju1 vjw7 xK g x      %Ea/Kc%-:]pjjjj!3M]x ;Sq1LjjQ j&Vjw[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] r V+5?HO^ektrw +hreturning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockq q q p         @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-PXXXYY>YGYpYzY- YVs]\ ]]4]F]Z]h]o%Hq%o%o%o%p%p%8p%Pp%hp%p%p%`q%p%p%p% q%,q%x V+5?HO^ektrw +hf  AT{   F b A, Q e z     !j#j$ &j1j2 3j4j5 6j8 9% 9, :E ;_ <} = @ A B C DG E] Fr Gr Hr J L M N O P Q R S T' U/ VG Wa \k a c d e f g h i p qjsjtju1 vjw7 xK g x      %Ea/Kc%-:]pjjjj!3M]x ;Sq1LjjQ j&VjwSFH0eCgSFU0eChHah!IdontNeedEFIhh(s*K>;} h|nQn- q+(h4h|nQn- q+ChMh|nQn- q+Zhch|nQn- q+thh|nQn- q+h=rGy=iG}hh;Mt?hhmWC 3KOOhhyD<#*=(hh3Dh&hh\ M}-ii@Mjy֬$i5i-чHFi-чH[iZIчH uiIчHiIчHhi2IчHiL6 %?aiiS'@ )Ѹii*1@ )Ѹi1x )Ѹiibackupstore_gptstore_tblin_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsooosetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatustrw printallmaindo_setifpreferencedo_setifcapsvzi0s%Qyiqqqr%Rnv%Nqqr%8 v%H; v%Jn@v%]whv%pv%xHr%uLu%xTr%xv%xv%xhr%xhr%xxxxx xyy@ y,y8y@y Iy0Ry@[ydyiy2 ny yyy y@rw init_current_mediasetmediamodesetmediaoptsetmediasetmediainstS{G^{S{li{3 trw^{3 S{3 `p{x{@p{x{^{3 li{media_statusmedia_constructor7{@{Gzw%Lz@{Gzw%@{@{Tw%J{@{J{7{pw%I{@{4zw%ea@{eaw%paddr_match (   settunnelz|r%| x%print_link_addressessetvlansetvlanifn}x%}s}x%}}0setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanGJMPsethidessidsetapbridgesetiffragsetifrtsv@y%uX(r%}(z%|}(r%(y%'(7* r%>Xz%y%\y%'r%C5 y%C5 $8* r%, y%m~xy%875(6}}Linvalid major numberinvalid minor numbertoo many fields for formatffs@Ԋ   @H% 7Պ ?R_uϣ ʋ@֋ @- rrFKT Y]ah܌ 7 @c @  ' bnorripbgensbextattbnojolietbnocasetransbrrcaseins܌ 7 @@c #N@@܌ 7 @ @c #@N* @܌ 7 @@܌ 7 @@c @bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror܌ 7 @Nc @&ej3  @??  @^ JP‘Ycm x@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvc ܌ 7 @@ޚ3kݛ6McڜDWxǝ >sߞ%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@'B8CGFSIlLvNO1SabЫc۫efhHiTk`mnnorsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp 9` ²Dz@ ̲ $1м|^t0 Non-system disk Press any key to reboot eeeeeeeeeDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYgz+Ss9aUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_printpPPPu,P9PGYPfl{PPP (P <P LP ^Pj} PjPPPPP,3PLbPPPPP%P7<PJQbPPPPbitmask_scan:3 w~hw.disknamesfetch_url" D sendrequestrecvrequest0m&q&u&y&}&&***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]ahK̏ lK̏ : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data0}\ ',o,0,#0x,/8`|,I_},Zb^~,q,p,],0{,0z,0,m,|, {,0@|, Ă,(n,2Cpm,O'w,\'wq,m:s,vKt,u,r,v,0v,0w,:,K,0, y,),50,A0,collect?;V+5?HO^ektrw +hNAME=rYmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsV+5?HO^ektrw +h edit_fs_type_extV ~ @ ? @ S T b b 1L0@ d@ tp@ edit_and_check_label V+5?HO^ektrw +hdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskhiy h а p Ԫ @ P X  L $ ( P  X 4  t  L disklabel_change_geom H x!outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default,,ܠ,,pm_from_pepm_whole_diskgpt_freegpt_create_new!dإXęH$$lh xĨܬTX0\ hh} } h hghiii h! PX>YYpY- V     r  r F KT <hY]a i hgpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eCgSFU0eChHah!IdontNeedEFIhh(s*K>;} h|nQn- q+(h4h|nQn- q+ChMh|nQn- q+Zhch|nQn- q+thh|nQn- q+h=rGy=iG}hh;Mt?hhmWC 3KOOhhyD<#*=(hh3Dh&hh\ M}-ii@Mjy֬$i5i-чHFi-чH[iZIчH uiIчHiIчHhi2IчHiL6 %?aiiS'@ )Ѹii*1@ )Ѹi1x )Ѹii    % h A I   - @ N mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new !!x@Tܻ8(<tD T$8tHmbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************0m&q&u&y&}&&control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2  dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2023 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option! b8cdMe+ f1 g~, h, i@jk1 l8 m1 no1 pjqr1 s1 8t- uv1 w' x1 z3y1 A2 B2 C* D2 E"2 F'2 G12 H- IRnJ;2 KB2 L)MK2 NQ2 OZ2 Pg2 QlS@To2 Uy2 V2 W2 X2 Z 12 42 6$2 1 |~2 }2 2 2 2 2 3 3 3 3 3 3 $3 *3 03 63 s/ E3 N3 8 W/ V3 ^3 h3 u3 3 3 3 3 3 3 3 4 3 3 3 3 3 1 3 1 3 3 4 4 "4 default_configread_configrt_compare_protoXXrt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt00rt_buildrt_delete88sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initPvw8 3' ~8 8 8 cn, /8 script_buftoenvR3 D2 3 o8 make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os: : : : : : if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leaseread_leaselog_dhcpqD |D D SD dhcp_bindD B D D y: MB D r= D dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaee f feeVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\BBH TtHH NH ԊTH vH m-4ZH TtH `H BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~oH ,&sH %!-!|H )!-!BH HH NH TH vH m-ZH @H `H !!!BH ,pHH NH <TH vH Ĝm-ZH LH ԝ`H  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstring_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_number_alloc_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_reset_locked_prop_dict_keysym_put_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equalsprop_dictionary_set_prop_dict_keysym_alloc_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_equalsABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_internalize_decodeprop_data_data_prop_data_internalize_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_remove_prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynameTLS allocation failed, terminating ;Zx0Nm<[y1On%s %s%3d %.2d:%.2d:%.2d %-4s %s %s%3d %.2d:%.2d:%.2d %s SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesortsetup_seekdir_unlocked_getdomainname @_strncasecmpcreat_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEXxz`l<D N`'[<  `   $8       ( 0 8 @ D L T \ d  l  t  |           <% x4 T[ \b , h$< h x  X c    L| 0 |  \.     l 0R 4     <J x   " ,, hh    XX X X          L .  $ 7 ( , \0  8  @ H P  T  X  \ ` h px    0 00 0,  ( 0 8 D PX\dhpx|X8dh p hlptx$[!|0_!9,l_!4 c!<g!Dl!Uy`u`u `uo oo o o o 0@<HXdx@!D!0!,!(!gnts T,prbmn`Ptcid(\.T/1&d&T&&& yekd1-%atadABAloob0NN8NyaraLTYlXRQ      (4LXx    4- @Lp|@`$(08@HPX`hpt|(4@LTdlt`|\  x!x!HTX\dhpx|0      $ ( , 0 4 8 < @ D L T \ d l t |              H  !!!,!8!D!`!h!t!!!!!!!!!""$"<"L"d"""""""##0#D#X#l######## $ $4$H$\$p$$$$$$$$%$%8%L%`%t%!К̺LLLȹ`Ի!!!!.00101L1x11112(2D2d2|220...0P0 0 00X?`?p?x????x?=9d8h8t8x88888888888 99 f9 $9(9 H9L9 `9h9|9999999999999 :::,:L98:48<:D<@:D:X:`::::::::: :;! ;$;"8;@;#\;d;$l;%|;>&=;';;);;*;;+;;,;;-< <.< </(<0<08<@<1H<P<2x<<3<<7<<c<<<<<<==4=$=<=D=`=h===#\;=$=%|;=&==';6(==);>(>,>4>8>3????(>?47(707@7L7\7h7|7777777777 78 88 @@(808@8H8P8X8X>`>|>>>>>>T?>>>>>>>?$?4?ȳ-8=&vx-(&-!o-,-x-Ԫ----D!@ -PW&:%&-$-D-&4-`!-8,X!-de-&&< -- -B-t-h&PQH -&$& --0-& &-@-L-&L -!-,-! &L?TF%Qܕ&:,! &-- & -b%̑@M-\!-ԍ &;&b%x'&z ('HPg%.~ bj(jvcfhklŢmעoopppqrc u>t&vT7w.w;x6xI zKszCBɲCnJTO^PmStTVVXZZɣ գޣ  \s(@tP-usP-@xss( t({{|s{ss( F գɣ n/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin'}-+?=###%%%}`'d'aEVeFIT7i(Ll5m=CnGfNTp[bbujzs~q?:sh&vVVx'@=dm%Hm%d VpTrd٠tFwqvz>q^q}hq hCPp>~p] -6ЏF00908EO0X 0 Xaz|(o%!7  ... ...(n:s:L `Lo%@7OiOPxQo%PvVo%MQQ0Yp%@@QӵH}p%0~0p%@ZZs_Lp%@{_bdp%@0@|p%@aaИp%@ac8p%@a>p%ccOef(p%jfq%@ffOdx q%f gO[@q%@'jlx\q%k)s(tq%@mD 0or%n q%AabCdhlNsuvW:w:zr%r%r%r% r%< w` |z%:K*@1@6B<@D4Bw@I@ d?U ?O\A+@TA\@b@gAl@!7   '@@܌ 7 @@c @...... ...... lost+founddA.##.s'L EzNK   8 6 RVI[R"/ aڍ5H; Jnjp s!z"#4 $%&'(ef)*l+,-/11234}56%hx &( . (prog_root)`9 )ٙFw0z>(+4 x]/ I m k  T  + 9 * @^ L: ) \*  S j  W  @  ] r Q h S b 4W  > N A + D  S H t:  ([  Z  Z ' S  i ( 7 1 4+  |#  = 6 4 I |>  : GV  - R ٙ \* 2 (A ] e 6 d < M d D A _ H B r HG P 4 r `N P  HG  D U \j ea * Z  cs < x] <  U c + = DM h S  P I8 ] 3 g  4 4 4  j  D  d  ^  ,S r LO  d  p[ 4 +  l< > h  HQ S pb [ g  9  |+  H[  _ 0 *  ]  :  ( i XR d Pi   ' K & D< b g V  @$!vE ' A.Tq Dp Ps <<k0r0!ٹ4 <w0XI >0K t0J p0K |0(< $0A C1B +1B c31l6 .D1@7 D1@7 R1F m1F s1LE ?1^ #1F GV@+E9F#P5ca_l@s5h5D+ !"$'(+-.03569:0tAzAAzAAzAA9 A9 AAAAAAAABA BAB B'BA.BA9BABBAMBXB_BjBpBxBBBBABABABABABABABABABABGBC CCC#CC*C6CACLCQChZCgCnC{CZCCC9 CzA+CAC BCXBCjB&DxBJDBhDCDDD6CDLCDEE3EGJEnC^EZCvECEE CF%b4%% ܡ%z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ % % % % % %H% %"" %H%H%H% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<uK{KKK is a directory is not a regular file (use -f to see it)%% (N$NNNjNN"N>N OO;#O Q]7+O 5O >O LO#YO2fO8xO OO O(iOO!OO9OOGVO&TfP)PP5!Pe*P:4P2R%\a ?la VB nvB wvB E E pE PR P Hc lc \B R0a F hF DF F R hQ E dL $B SLB xA xA yB VA nvA wvA y` 9y` _ya ya  a ,G G F F ` G tG PG c (c c ` G Xb b b j` k` G |b b ` rtA  A t` ` ` dA X` h` H G c d c b L` I H H H H `H S Q zHzPzczkz|4|!~;TtҁHXNj  g)pYH}LJ<V'ω 3T`dڊފs=Zho.1P{:b]&DXyΚDݛۋbȜ)Uj̝ޝIUg=sޠxNͤs1YLɪ lqԫ #0DRap~Ĭάڬ*6BPg~ƭܭۮjܰDXVҴ 'ݻ1:Iaε &x8R^k}Ѷ$@[Yķȷ(:Sh||¸Ѹ7ANWf{ɹԹ߹ 'ܺ3z¿1 z5BHFKUaj!,Vk`xI`Z2Xn~4"-TDHRj6#*8EM` S J3DOipxQ |a8Th`dYR^٠HR^}Q}Ny } <Lbmxx7X|#qx] ~3 Q$/X0(QAcs 00CPXbgqz}(6BHOZahq{18BYS]r"-6CRfr|YS.;CWon!<K\ju =EjS$5K$<Ug P /38<BEIQMh6/  t,  Y   7   v  w# * n00 6 < A G 10O &rj'V (_ )f *+k ,s .1/ftpT @ V  [@˅ X    ` 5= "| > 6?P PX @ȗ Aȗ Bn ȗ C y D ȗ E ȗ F ȗ G ȗ H 0X 0 X  1t 1d t             - \@t[-\t[/) ; g , 000000000CH H H H H H y: H H ghH ^h  )h H H H H p H I  I I I I MB "I &I *I I.I A2I 6I k:I K>I C BI !SI "bI #nI $zI %I &I 'I (I )I *I +I ,I -I -I .I .~o/J /0$1I 2J 3J 4 J 5z6J 7J 8J 9&J :"J ;,J <;J =GJ >YJ ?gJ @uJ [zo\J \J ]J ^J ^J _J _J `J {J { K |K }$K }i~8K   -dd-ddTdd:dd:dd  @@ `(# #(#0#4#<$H$P$X$\$d%l%t%%%&&&'''((()))** *(+4+@+H,T,`,d,l-x---...///6;;0001$10<8<D=P=\>h>t?|222333978:44 45 5, 4! D" P# \$ h% t& ' ( ) * . + , - / 0 1 2 3  4 ,5 86 D7 P8 \9 h: t; < = > ?  @!@"@#@$@%@&@'@)@*@(+@4&`@'`P,@`-@p.@/@0@(`1@2@3@)`4@5@6@7@$8@49@D:@T*`d;@t<@=@>@?@ `!`+`,`"`#`-`$$`4.`D/`T%`dCtCDDEEFFccdde0e##&&0(8<@DHLT\dlt|048<@HP  @@2$,4<HT \ d l@t@@@@@`` @̑ `33333333@@     33338<@DHxUTC33J%K%cPNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž&&& & L% 33UU33UU33UU &ܕ& &ܕ& x &ܕ` & & &hG-?????p?0<Dh?$p???x   @ 333333333333333333333333333333333333 33 33|& !! 0000000000000000 P-333333ز33|&&& (root)`338`%C!!!!!!!!!]%]%\%]%]%!!!!h&lܬhDT`tx@Ĩ XService unavailablel0A0aeabi&6KZ  "DzSU7xگOA^Jу-KRB! .L]ESUyYل[YARa;mR$e;3{n3Ikj=ྲu?/7+RתiqfL$K\qn^W=6{G( zB{qL{fR=[9g׋yo퓷W}Nk=~u߯;rsz:k/][K/WܻAffʹU6}{wvU+"׏0.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BHP:% !V:% !$b:% !g:% !%t`%0!yb%2!0&!&!X0-!p!1 !z!MSGTXTS626 5024 5049 5066 5088 5091 5096 5104 5111 5119 5127 5130 5133 5136 5140 5152 5161 5174 5203 5218 5762 5796 6479 6767 7475 7531 7605 7701 7748 7771 7794 7800 7809 7831 7835 7839 7842 7845 7950 8153 8392 8833 9271 9306 9321 9333 9339 9351 9370 9390 9430 9447 9464 9479 9526 9564 9612 9694 9818 9954 9995 10033 10070 10105 10115 10164 10314 10320 10325 10329 10349 10459 10479 10485 10499 10511 10522 10559 10593 10617 10719 10756 10778 10877 10932 10990 11001 11017 11069 11237 11444 11615 11679 11731 12003 12553 13082 13514 13852 14185 14298 14313 14322 14482 14653 14803 14967 14990 15014 15029 15104 15244 15421 15576 15588 15668 15769 15815 15841 15911 15922 15931 15944 15970 15985 16001 16014 16069 16080 16095 16299 16532 16561 16576 16645 16719 16792 16822 16860 16914 17368 17394 17423 17527 17633 17818 17930 18045 18149 18836 19095 19235 19271 19441 19482 19618 19641 19678 19723 19974 20070 20124 20223 20234 20271 20308 20335 20344 20378 20385 20410 20437 20472 20486 20500 20529 20543 20560 20569 20591 20609 20626 20637 20656 20682 20700 20723 20740 20755 20770 20788 20815 20842 20864 20903 20921 20953 21181 21255 21298 21344 21491 21647 21691 21970 21997 22356 22540 22692 22873 23020 23178 23199 23247 23257 23265 23276 23287 23297 23304 23319 23331 23369 23399 23438 23491 23549 23570 23577 23596 23617 23624 23647 23669 23689 23711 23742 23779 23801 23815 23861 23890 23924 23964 23999 24027 24075 24084 24093 24098 24107 24116 24133 24137 24142 24146 24184 24193 24220 24240 24263 24282 24309 24331 24363 24379 24384 24394 24417 24439 24456 24473 24486 24495 24504 24510 24537 24544 24568 24589 24613 24626 24645 24670 24693 24709 24715 24727 24757 24765 24805 24816 24827 24838 24855 24872 24886 24903 25119 25423 25871 26087 26351 26623 26675 26711 26747 26798 26815 26853 26867 26874 26891 26894 26899 26908 26920 26931 26940 26961 27003 27019 27035 27066 27083 27098 27113 27128 27149 27169 27210 27239 27287 27520 27555 27762 27781 27818 27879 27917 27956 28112 28127 28173 28200 28223 28259 28269 28279 28290 28295 28358 28406 28450 28511 28544 28591 28609 28748 28770 28893 28907 28917 28940 29045 29101 29217 29248 29253 29279 29318 29328 29371 29381 29397 29412 29430 29453 29483 29504 29530 29727 29770 29774 29780 29786 29791 29802 29816 29845 29877 29889 29936 29986 30026 30053 30069 30078 30121 30127 30135 30139 30159 30176 30188 30219 30475 30524 31100 31127 31159 31187 31239 31245 31251 31256 31277 31293 31315 31344 31485 31619 31632 31768 31770 31772 31774 31791 31804 31822 31849 31853 31859 31864 31872 31878 31918 31920 31930 31945 31962 31996 32028 32066 32095 32124 32146 32189 32215 32259 32395 32397 32477 32523 32571 32676 32778 32817 32884 32891 32952 33016 33020 33027 33149 33218 33506 33644 33785 33866 33913 33919 33942 33988 33991 34017 34060 34125 34187 34257 34325 34418 34637 34662 34666 34702 34720 34748 34790 34834 34898 34948 35024 35046 35098 35142 35181 35215 35245 35276 35301 35310 35322 35330 35341 35353 35372 35396 35445 35462 35486 35529 35851 35854 35868 35881 35893 35900 35911 35918 35925 35934 35944 35961 35977 36027 36035 36043 36053 36064 36082 36099 36120 36142 36151 36161 36188 36194 36204 36223 36239 36257 36277 36286 36297 36304 36321 36340 36361 36371 36388 36394 36410 36425 36440 36461 36483 36502 36512 36517 36522 36540 36559 36578 36584 36603 36623 36643 36661 36666 36672 36689 36705 36726 36739 36747 36767 36791 36808 36816 36827 36848 36854 36866 36888 36902 36911 36932 36950 36959 36993 37016 37043 37075 37098 37118 37129 37161 37177 37188 37201 37224 37246 37754 37784 37815 37843 37857 38058 38280 38447 38534 38551 38569 38586 38615 38662 38673 38692 38714 38793 38985 39013 39131 39153 39294 39313 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-10.99.12. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-10.99.12 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-10.99.12 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-10.99.12 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-10.99.12 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-10.99.12 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd aktivierenntpd aktivierenntpdate beim Starten ausfhrenmdnsd aktivierenxdm aktivierencgd aktivierenlvm aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte PartitionierungPartitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen?Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS626 5024 5062 5079 5094 5097 5100 5105 5113 5121 5129 5132 5135 5144 5156 5168 5177 5186 5212 5223 5759 5786 6352 6652 7293 7340 7453 7546 7580 7599 7617 7625 7634 7659 7663 7667 7670 7673 7795 7980 8208 8728 9079 9108 9121 9134 9139 9159 9178 9199 9258 9275 9289 9311 9356 9382 9423 9501 9619 9733 9787 9816 9848 9887 9893 9926 10049 10056 10060 10068 10092 10174 10180 10187 10199 10213 10222 10255 10274 10286 10396 10458 10477 10596 10647 10699 10711 10730 10782 10986 11194 11385 11445 11494 11761 12220 12886 13309 13631 14056 14188 14220 14232 14410 14607 14768 14902 14922 14955 14969 15038 15151 15323 15458 15478 15590 15682 15705 15728 15787 15802 15823 15838 15859 15879 15904 15918 15942 15954 15972 16182 16432 16453 16469 16522 16590 16663 16700 16726 16802 17297 17323 17345 17452 17559 17760 17833 17917 18017 18512 18750 18901 18935 19070 19114 19253 19294 19339 19386 19630 19763 19825 19919 19924 19958 19992 20007 20035 20068 20075 20100 20118 20144 20151 20166 20181 20201 20241 20258 20278 20299 20321 20336 20356 20378 20393 20406 20420 20432 20444 20458 20481 20504 20522 20565 20616 20653 20838 20901 20937 20986 21077 21207 21260 21520 21567 21928 22078 22247 22387 22507 22639 22679 22726 22736 22744 22754 22762 22773 22784 22798 22823 22865 22898 22931 22966 23020 23045 23064 23086 23091 23097 23127 23144 23171 23189 23210 23232 23251 23261 23291 23317 23344 23393 23421 23448 23501 23511 23521 23527 23537 23546 23566 23570 23575 23579 23614 23623 23654 23671 23698 23719 23739 23758 23784 23797 23805 23821 23852 23883 23904 23930 23943 23951 23962 23968 23992 24002 24014 24032 24043 24063 24079 24105 24127 24143 24155 24175 24201 24207 24237 24251 24265 24288 24307 24326 24344 24362 24585 24891 25309 25510 25750 25934 26012 26067 26134 26174 26197 26231 26242 26250 26273 26276 26279 26285 26296 26308 26321 26351 26395 26408 26421 26458 26472 26483 26494 26505 26522 26533 26580 26603 26652 26893 26926 27181 27202 27235 27288 27314 27341 27497 27503 27546 27566 27585 27614 27621 27628 27635 27640 27689 27727 27761 27818 27846 27891 27908 28009 28014 28091 28105 28115 28139 28262 28343 28453 28481 28486 28502 28531 28539 28580 28587 28601 28614 28622 28641 28674 28694 28714 28930 28961 28966 28973 28980 28984 28998 29010 29025 29058 29071 29126 29184 29220 29238 29256 29274 29311 29317 29325 29329 29350 29367 29378 29400 29578 29622 30324 30348 30382 30401 30446 30453 30460 30464 30488 30499 30504 30567 30688 30811 30824 30958 30960 30962 30964 30974 30983 30996 31023 31027 31033 31038 31047 31052 31079 31081 31094 31106 31121 31149 31193 31240 31256 31278 31289 31322 31342 31391 31491 31493 31558 31607 31656 31760 31858 31899 31990 31997 32058 32122 32127 32133 32242 32301 32552 32693 32820 32888 32925 32932 32959 33005 33008 33029 33074 33125 33184 33253 33300 33405 33548 33573 33577 33611 33628 33652 33704 33755 33827 33893 33991 34008 34039 34075 34109 34133 34157 34190 34210 34220 34228 34236 34246 34257 34271 34297 34345 34368 34388 34429 34728 34731 34745 34757 34764 34783 34797 34804 34811 34820 34830 34847 34863 34911 34919 34927 34937 34948 34966 34983 35002 35022 35029 35046 35063 35070 35083 35118 35135 35154 35174 35184 35200 35213 35231 35251 35272 35282 35302 35322 35335 35354 35367 35391 35414 35427 35438 35443 35450 35468 35487 35506 35514 35533 35553 35578 35596 35603 35610 35623 35632 35653 35666 35674 35694 35722 35739 35745 35756 35787 35795 35808 35830 35852 35861 35882 35900 35907 35930 35949 35976 35994 36014 36027 36042 36063 36077 36084 36098 36113 36132 36677 36710 36738 36767 36775 36812 37124 37301 37378 37395 37413 37428 37450 37500 37510 37527 37549 37608 37766 37790 37920 37945 38071 38089 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-10.99.12. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-10.99.12 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-10.99.12 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-10.99.12 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-10.99.12. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-10.99.12Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-10.99.12Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Set up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS626 5024 5060 5077 5092 5096 5100 5105 5116 5122 5128 5131 5134 5137 5141 5153 5165 5175 5205 5217 5647 5674 6250 6610 7295 7356 7434 7529 7569 7591 7609 7615 7624 7650 7654 7658 7661 7664 7786 7971 8199 8728 9146 9175 9188 9201 9208 9228 9247 9270 9313 9333 9352 9375 9419 9448 9489 9555 9667 9781 9835 9864 9896 9935 9941 9974 10052 10058 10062 10067 10108 10245 10255 10263 10282 10296 10305 10337 10378 10391 10516 10574 10593 10712 10768 10820 10831 10847 10886 11136 11308 11480 11535 11570 11820 12224 12523 12791 13152 13332 13651 13671 13684 13873 14017 14213 14347 14367 14400 14419 14520 14675 14863 15050 15070 15149 15247 15285 15308 15398 15419 15442 15461 15485 15515 15559 15592 15615 15627 15645 15913 16232 16263 16298 16362 16437 16507 16538 16568 16660 17151 17181 17198 17338 17479 17676 17795 17942 18109 18667 18963 19144 19189 19352 19406 19541 19577 19637 19687 19978 20087 20144 20241 20246 20281 20316 20331 20355 20388 20393 20418 20434 20457 20464 20481 20496 20515 20547 20551 20571 20589 20601 20614 20632 20656 20674 20693 20720 20747 20759 20780 20810 20840 20865 20898 20933 20971 21224 21293 21348 21409 21527 21686 21740 22001 22052 22428 22583 22727 22867 22975 23160 23190 23233 23243 23251 23261 23273 23294 23303 23309 23341 23382 23418 23456 23493 23541 23565 23577 23591 23599 23607 23635 23652 23681 23702 23725 23734 23753 23765 23809 23847 23874 23918 23946 23973 24026 24037 24048 24055 24065 24074 24108 24112 24117 24121 24156 24166 24196 24219 24248 24270 24292 24314 24341 24353 24365 24384 24418 24451 24472 24496 24509 24521 24534 24540 24566 24576 24587 24611 24621 24641 24661 24678 24704 24728 24741 24761 24795 24802 24831 24854 24877 24893 24908 24923 24938 24952 25140 25445 25876 26067 26302 26490 26532 26582 26636 26684 26706 26747 26758 26766 26790 26794 26798 26807 26818 26829 26844 26875 26921 26934 26947 26977 26991 27003 27015 27027 27045 27068 27113 27136 27196 27448 27475 27737 27755 27782 27831 27861 27892 28024 28031 28080 28103 28127 28156 28164 28174 28182 28187 28240 28289 28329 28395 28428 28472 28495 28596 28601 28678 28692 28702 28726 28849 28930 29040 29068 29073 29089 29118 29126 29167 29175 29189 29202 29210 29229 29262 29282 29302 29518 29549 29569 29575 29582 29586 29601 29620 29646 29655 29667 29721 29779 29814 29833 29850 29862 29897 29903 29911 29915 29936 29953 29964 29989 30167 30221 30912 30931 30966 30996 31042 31048 31055 31059 31083 31099 31105 31180 31330 31449 31462 31530 31532 31534 31536 31546 31559 31576 31603 31607 31613 31618 31627 31632 31659 31661 31674 31686 31701 31729 31773 31820 31836 31858 31869 31902 31922 31971 32071 32073 32149 32204 32254 32353 32448 32496 32586 32593 32654 32718 32723 32729 32832 32884 33130 33291 33446 33517 33570 33577 33604 33654 33657 33678 33724 33779 33838 33907 33954 34059 34202 34227 34231 34265 34282 34320 34373 34413 34489 34554 34648 34669 34707 34747 34783 34807 34830 34869 34899 34906 34915 34923 34931 34945 34961 34989 35041 35058 35079 35123 35465 35469 35484 35495 35503 35522 35534 35541 35548 35557 35567 35584 35600 35654 35662 35670 35680 35691 35709 35726 35742 35760 35767 35785 35802 35809 35819 35850 35869 35888 35908 35918 35937 35950 35970 35990 36011 36021 36040 36059 36069 36086 36100 36123 36147 36160 36170 36175 36179 36197 36216 36235 36240 36259 36279 36304 36319 36323 36330 36340 36349 36370 36384 36392 36412 36438 36455 36463 36474 36505 36510 36523 36545 36560 36569 36590 36608 36617 36661 36685 36712 36727 36744 36758 36789 36813 36844 36851 36865 36880 36899 37444 37477 37505 37534 37542 37579 37891 38068 38145 38162 38180 38195 38217 38267 38277 38294 38316 38375 38533 38557 38687 38712 38838 38856 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-10.99.12. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-10.99.12 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-10.99.12 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-10.99.12 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-10.99.12 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-10.99.12Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountMSGTXTS626 5024 5065 5081 5099 5103 5107 5117 5126 5132 5138 5141 5144 5153 5163 5176 5184 5195 5220 5232 5741 5773 6265 6554 7099 7145 7249 7335 7371 7386 7404 7412 7420 7447 7451 7455 7458 7461 7572 7757 7985 8461 8795 8824 8839 8854 8862 8876 8894 8915 8966 8982 8992 9012 9058 9088 9141 9198 9309 9430 9474 9507 9546 9580 9587 9620 9697 9703 9710 9717 9746 9858 9864 9875 9892 9909 9918 9947 9959 9969 10070 10132 10152 10272 10309 10365 10379 10400 10437 10647 10822 10971 11006 11058 11275 11589 12113 12475 12765 13158 13293 13306 13317 13463 13642 13773 13907 13927 13960 13979 14062 14177 14318 14443 14457 14565 14658 14687 14707 14783 14800 14818 14834 14853 14873 14890 14902 14928 14940 14958 15159 15398 15425 15442 15498 15560 15620 15651 15675 15734 16110 16140 16157 16265 16375 16515 16589 16665 16743 17235 17455 17566 17597 17724 17760 17888 17915 17955 18001 18217 18341 18409 18509 18514 18550 18586 18600 18623 18656 18660 18685 18704 18730 18735 18750 18765 18784 18809 18821 18843 18860 18873 18885 18903 18927 18942 18959 18972 18983 18994 19014 19043 19072 19096 19131 19166 19193 19380 19429 19461 19509 19606 19739 19785 19977 20007 20329 20458 20598 20738 20855 20990 21034 21077 21085 21095 21107 21119 21127 21138 21165 21199 21235 21266 21301 21337 21384 21404 21421 21439 21444 21451 21477 21493 21514 21531 21548 21566 21583 21596 21627 21652 21683 21714 21749 21776 21829 21839 21849 21855 21864 21872 21887 21891 21896 21900 21935 21945 21974 21990 22016 22033 22052 22073 22089 22102 22107 22115 22130 22156 22175 22203 22221 22232 22238 22244 22265 22275 22286 22304 22326 22343 22356 22377 22397 22417 22428 22441 22463 22470 22495 22510 22530 22542 22559 22576 22596 22615 22792 23076 23386 23566 23777 23965 24031 24078 24133 24177 24197 24226 24238 24244 24260 24264 24268 24276 24286 24298 24313 24332 24368 24379 24390 24429 24441 24451 24461 24471 24487 24505 24554 24575 24620 24864 24890 25144 25159 25185 25242 25276 25311 25453 25470 25519 25540 25556 25585 25590 25595 25601 25606 25645 25680 25710 25765 25798 25844 25858 25937 25942 25996 26010 26020 26044 26130 26178 26284 26318 26325 26340 26367 26376 26415 26422 26444 26463 26479 26497 26529 26548 26565 26722 26753 26760 26769 26777 26784 26798 26816 26835 26845 26857 26898 26943 26972 26993 27016 27035 27073 27079 27087 27091 27112 27129 27138 27157 27303 27345 27855 27863 27887 27905 27949 27954 27959 27963 27994 28007 28016 28062 28188 28279 28291 28355 28357 28359 28361 28371 28385 28400 28427 28431 28437 28442 28451 28456 28483 28485 28500 28511 28526 28554 28598 28645 28661 28683 28694 28727 28747 28796 28896 28898 28966 29006 29051 29126 29192 29227 29308 29315 29376 29440 29447 29453 29552 29608 29884 30008 30119 30181 30219 30227 30249 30298 30301 30322 30367 30422 30481 30550 30597 30702 30845 30870 30874 30908 30924 30949 30997 31033 31094 31148 31229 31251 31290 31327 31359 31383 31410 31436 31450 31458 31468 31476 31490 31503 31515 31539 31580 31606 31623 31652 31976 31979 31993 32005 32011 32027 32039 32046 32053 32062 32072 32089 32105 32148 32156 32164 32174 32185 32203 32220 32233 32259 32266 32274 32291 32299 32316 32340 32359 32378 32397 32407 32418 32432 32450 32470 32490 32499 32522 32542 32553 32568 32580 32599 32618 32629 32639 32644 32650 32668 32687 32706 32713 32732 32752 32777 32794 32800 32808 32818 32830 32851 32867 32875 32895 32915 32937 32945 32956 32979 32986 33000 33022 33039 33048 33069 33087 33096 33127 33143 33170 33189 33209 33227 33248 33262 33282 33289 33308 33323 33342 33887 33920 33948 33977 33985 34022 34334 34511 34588 34605 34623 34638 34660 34710 34720 34737 34759 34818 34976 35000 35130 35155 35281 35299 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-10.99.12. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-10.99.12 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-10.99.12 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-10.99.12 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-10.99.12 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-10.99.12Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-10.99.12Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # Rapid commit support. # Safe to enable by default because it requires the equivalent option set # on the server to actually work. option rapid_commit # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostname else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime [ -z "$rdnsstime" ] && return 1 ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers [ -n "$rdnss" ] && new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime [ -z "$dnssltime" ] && return 1 ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search [ -n "$dnssl" ] && new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf return $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" # Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..